4PBZA

Structure of the human rbap48-mta1(670-695) complex
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
410
structure length
386
Chain Sequence
ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Histone-binding protein RBBP4
publication title Insight into the architecture of the NuRD complex: Structure of the RbAp48-MTA1 sub-complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 386
sequence length 410
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4pbzA00
3B7FA 5EMMB 3PXWD 3RN0D 4A09B 4GZ8A 5K1CC 2BCJB 2IUPA 5IGQA 3RRMC 5FKTA 2Z2OA 4OZUA 3K27A 4L1QD 4ZOVA 2IUQA 1JOFA 1S4UX 3UKUC 2H3XA 4UI9R 4J87A 5EMJB 3SBQA 5GXIA 1TYQC 4CZYA 4QQEA 2HESX 1U2VC 3NVXA 4CI3A 4X63B 2P9UC 3DWLC 4J84A 2H47A 3SXTD 2IAAA 2PM9B 4IMMA 2OVRB 2AQ5A 3RFHA 3JZGA 2G99A 5TEEA 3EI3A 3UVMA 4H5IA 4IA9A 4FHLA 3W15A 4FA5D 1JMXB 2J55H 1A0RB 3VH0A 2YMUA 3OKYA 4NSXA 4Y5RD 2IUVA 2GNQA 5I5MA 3J81g 5HE1B 4GM8A 4CZVA 1ERJA 2IWKA 5IJ8E 3F3GA 2AH1A 2I0TA 5HE2B 3BG0A 3V5WB 5KDOB 5EALA 2H9PA 4E5ZB 2AH0A 2H6NA 4H5JA 1P22A 4R7AB 2CN3A 3AL8A 4JSVC 4X61B 5HQGA 3RN1D 4U1EI 3SBPA 1PGUA 5CXCB 2YBAA 2H6KA 3I7OA 3EI1A 2PM7B 2HXCA 1XHMA 3L4OD 3EI2A 4CY3A 3IIYA 3PSCB 4J73A 3I89A 2MTAH 3EMHA 1GP2B 2H6QA 4E54B 4A0AB 4ZOXA 2P9PC 5I5IA 3JB9L 4KFMB 5HYNB 3RLMD 3RMZD 2I3TA 4A0BA 3I7LA 3MZKA 2CO0A 4J0WA 3MKQA 5EM2B 3I8EA 3CFVA 2EBSA 4FAVD 2OVQB 4A11A 1B9YA 4J79A 4FA4D 3SN6B 4ERZA 3I8CA 4BH6A 3SJLD 3C9CA 5CYKA 5FKSA 5FXYA 5GXHA 3IJ0A 4JSXC 4ZOZA 1R5MA 3EWEA 3IJCA 1N6FA 1NR0A 4QRJA 4AEZA 4JT5C 4CZXA 3GFCA 1GXRA 3C75H 3OL2B 5EAPA 4O45A 2HJ4A 3VGZA 5I5JA 3MKSB 4GGDA 2PM6B 1OMWB 1NEXB 3SWSD 2XL2A 4PSWB 2PBIB 3K26A 2I0SA 3SFZA 2XU7A 2P9NC 4XYIA 5EARA 2IURA 4JT6C 5GMKn 4JSPC 1B9XA 3DXMC 5EMKB 3JPXA 3PXTD 5A2Qg 3JROA 5CXBA 4FWWA 4LG8A 1OLZA 4J8GA 3SCYA 3JZHA 3KRXB 4J81A 3RFGA 3ORVD 4GGCA 3OKYB 3EI4A 4GQBB 2I3SA 2CO0C 3N0DA 4CI1A 2CE8A 3UVLA 3SHFA 3SLED 4A2MA 4PBZA 3UVOA 2OIZA 4PBYA 3ZWLB 3IKOA 2HKMA 3UR4A 5IT9g 2CNXA 5GSAA 5AJAA 3PXSD 3JRPA 4ES0A 2H14A 5IJ7E 4HDJA 2YNPA 5H14A 5IGOA 3AL9A 3AL8B 4XEIC 3J80g 2Q7QA 3JAMg 2H9NA 3ODTA 3CIKB 4L9OA 4J86A 2HYEA 3OKWA 4K3JB 3SBRA 2B5NA 2J57G 4Z8LA 3JZNA 4EWRA 4ERQA 4J8BA 2QC5A 5SXMA 3EI1B 1VYHC 2CN2A 1MG2A 3F3PA 3BWSA 3EI2B 2UZYB 1SQ9A 2J56H 3I7PA 3EG6A 3DM0A 2UZXB 3I7NA 3AFCA 4J78A 1GG2B 1Q47A 4QL1A 3I7HA 2GC7A 5C2WB 4L3GD 2P9LC 4GQ2P 1RI6A 4A0BB 3FGBA 1JJUB 2H9MA 4A08A 2H9LA 5AFU3 4LG9A 4E54A 4CY2A 2P9KC 2W18A 3L4MD 2BBKH 5EAMA 1PBYB 4A11B 1FWXA 4CY5A 2AGXA 3NVQA 4FA9D 5JWZA 4O3TB 5CYKB 1N6DA 4JSNC 4PSXB 3UVKA 4FA1D 4ZOYA 2G9AA 5FLXg 3FRXA 4A09A 2OVPB 5TEFA 3UKRC 2GC4A 4GQ1A 2XL3A 2O9KA 3A0FA 3OW8A 2Z2PA 1MDAH 1MG3A 3CFSB 4BUJC 3VA6A 3AH8B 3U4YA 3NVNA 4J82A 2H13A 4O9DA 4GMBA 3P4FA 4PC0A 3OL2A 4ERYA 2P9SC 4GM9A 3IJ1A 5C2VB 4O1QD 3EI3B 1QNIA 5K19A 3F3FA 5CXBB 4X60B 4J77A 4TZ4A 5IC7A 2HKRA 2TRCB 3PSLA 4D0KA 3E0CA 4MK0B 3PVWB 1L0QA 4N14A 2PM9A 4Y7RA 5FQDA 5THAA 4U7AA 3EI4B 3ULEC 1K8KC 1XKSA 4X3EA 4YVDA 3IIWA 1JMZB 1SQJA 1GOTB 4QT8A 5C9ZB 2AGWA 2AGZA 3GREA 5FKRA 3SMRA 4CI8A 4FB1D 2QXVA 2H68A 2CE9A 4FAND 3I2NA 5EMLB 1PI6A 3FM0A 4BL0A 4O3UB 2I0RA 5TF2A 2AGYA 4XYHA 2YNNA 3MMYA 2B5MA 5AMSA 4D6VA 1PEVA 3C99A 3PVUB 2OK4A 2OJYA 4I79A 3OTTA 2YB8B 3HFQA 1U4CA 2B5LA 4CI2A 5HE0B 4E5ZA 3BG1A 4L3HD 4OWRA 2XYIA 3DXKC 2AGLA 4AOWA 1K32A 2P9IC 4PXWA 5CXCA 4J0XA 5H17A 4PNKB 4LGNA 3DSMA 1SHYB 3N0EA 4A2LA 3OKTA 3SVWD 3UVNA 4A08B 3V7DB 5FKQA 5TDHB 4A0AA 5B4WA 3EU7A 4ESGA 3I7KA 2HJBA 3V9FA 4G56B 4A7JA 1XIPA 2Z2NA 3MXXA 2YNOA 4GGAA 3PE7A 4JXMA 4CY1A 5H1MA 4K3ID 2B4EA 2OK6A 3MZLA 4CC9A 4ZN4A 2IWFA 3RSEC 1YFQA 1N6EA 4JD2C 5HE3B 1TBGA 3C5MA 4GM3A 5EM2A 5FA5B 3KRWB
chains in the Genus database with same CATH superfamily
3B7FA 3GD1I 5EMMB 3PXWD 3RN0D 5M5VA 4A09B 4GZ8A 2HU7A 5K1CC 3KCIA 2BCJB 3ZE0A 2IUPA 5IGQA 3RRMC 5FKTA 2Z2OA 3FCSA 3O4JA 4D9SA 4OZUA 2VDRA 3K27A 4NBMA 1UOPA 4L1QD 4ZOVA 2IUQA 1JOFA 1S4UX 3UKUC 2H3XA 4UI9R 2EICA 4J87A 4NENA 5EMJB 3SBQA 5GXIA 1TYQC 4CZYA 4QQEA 2HESX 1U2VC 3NVXA 4AN0A 4CI3A 4X63B 2P9UC 3DWLC 4J84A 2H47A 3MUNA 3SXTD 2IAAA 2PM9B 3GC3B 3IUJA 5FFGA 4IMMA 2OVRB 2AQ5A 4BP8A 3RFHA 3JZGA 2HU8A 2G99A 5TEEA 3EI3A 3UVMA 4H5IA 2XZGA 4G1MA 4IA9A 4FHLA 3W15A 4FA5D 1JMXB 1C9IA 4O2WA 2J55H 4Z7QA 1A0RB 4BCBA 3VH0A 2YMUA 4DNVA 1QFMA 3OKYA 1U8CA 4NAAA 4NSXA 4Y5RD 2IUVA 2GNQA 5I5MA 2EIEA 3J81g 2HU5A 5HE1B 5M5TA 4GM8A 4CZVA 1ERJA 2IWKA 5IJ8E 3F3GA 2AH1A 2I0TA 5HE2B 2VDQA 3BG0A 3QHYB 3V5WB 5KDOB 5EALA 2H9PA 4E5ZB 2AH0A 2H6NA 4H5JA 1P22A 1GOHA 4R7AB 2CN3A 3AL8A 4JSVC 4X61B 3IJEA 5HQGA 3RN1D 4U1EI 1VZ3A 4UM9A 3SBPA 1PGUA 5CXCB 2YBAA 2H6KA 3I7OA 3NIDA 3EI1A 2PM7B 2HXCA 1XHMA 3L4OD 3EI2A 4CY3A 3IIYA 3PSCB 2JKXA 4J73A 3ZDXA 3I89A 2MTAH 3EMHA 3QI0A 3ZE2A 1GP2B 2H6QA 4E54B 4A0AB 4ZOXA 2P9PC 5I5IA 3MVDK 3JB9L 4QAMA 4KFMB 1YR2A 5HYNB 4MMXA 5M5RA 3RLMD 3RMZD 2I3TA 4A0BA 1H2XA 2VDPA 3I7LA 3MZKA 3IUQA 1O6GA 2CO0A 3IURA 2BKLA 4J0WA 3EQ8A 3MKQA 5EM2B 3I8EA 3CFVA 2EBSA 5M5UA 4FAVD 2OVQB 4A11A 1B9YA 1JV2A 4J79A 2EIDA 3IUNA 4JHNA 3SN6B 1JTDB 4ERZA 4FA4D 3I8CA 4BH6A 3SJLD 3C9CA 2QZPA 5CYKA 5FKSA 4G55A 5FXYA 5GXHA 3IJ0A 4JSXC 4ZOZA 1R5MA 3EWEA 3IJCA 3ZDZA 5HDBA 1N6FA 1NR0A 4QRJA 4AEZA 4JT5C 4CZXA 3GFCA 1GXRA 3C75H 3OL2B 5EAPA 2VDMA 4O45A 2HJ4A 3VGZA 4L1MA 5I5JA 1E5TA 3MKSB 4GGDA 2PM6B 5C86A 1OMWB 1NEXB 3VI4A 3SWSD 2XL2A 1H2ZA 4PSWB 2PBIB 3K26A 2I0SA 4DNUA 3SFZA 2XU7A 2P9NC 4XYIA 5EARA 2IURA 4JT6C 5GMKn 1E8MA 4JSPC 1B9XA 3DXMC 5EMKB 3JPXA 3PXTD 4RE6A 5A2Qg 1GOGA 3JROA 5CXBA 4FWWA 4LG8A 1OLZA 4BCDA 4J8GA 3SCYA 3NIFA 3JZHA 3KRXB 3FCUA 4J81A 1T2XA 3ORVD 3RFGA 4GGCA 3OKYB 3EI4A 4GQBB 2I3SA 1L5GA 2CO0C 3N0DA 4CI1A 2CE8A 3UVLA 3SHFA 3SLED 2VZ1A 4A2MA 4PBZA 3UVOA 2OIZA 4PBYA 4MMYA 3ZWLB 3IKOA 2HKMA 5M61A 3UR4A 5IT9g 2CNXA 5GSAA 5AJAA 3PXSD 3JRPA 4ES0A 2H14A 5IJ7E 3VI3A 4HDJA 2YNPA 2VDLA 5H14A 5IGOA 4NC4A 3AL9A 3K6SA 3AL8B 4XEIC 3J80g 2Q7QA 3JAMg 2H9NA 3ODTA 3CIKB 4L9OA 4J86A 3V4PA 2HYEA 3OKWA 4K3JB 3SBRA 2B5NA 2J57G 4Z8LA 3JZNA 4EWRA 4ERQA 4J8BA 2QC5A 5SXMA 3EI1B 1VYHC 2CN2A 1MG2A 3F3PA 3BWSA 3OF7A 3EI2B 2UZYB 1SQ9A 2J56H 3I7PA 3EG6A 3DM0A 2UZXB 3I7NA 5C92A 3AFCA 4J78A 1GG2B 1Q47A 4QL1A 3MUOA 3I7HA 2GC7A 5C2WB 5M5SA 4WJKA 4L3GD 4WK4A 1QFSA 1M1XA 2P9LC 4GQ2P 1RI6A 4A0BB 3FGBA 1JJUB 2H9MA 4A08A 3V4VA 2H9LA 5AFU3 4LG9A 4E54A 4CY2A 1BPOA 2P9KC 2W18A 3L4MD 2VDOA 2BBKH 5EAMA 3T3PA 1PBYB 4A11B 1FWXA 4CY5A 2AGXA 3NVQA 5E6RA 4FA9D 1TYEA 5JWZA 4O3TB 5CYKB 4O02A 1N6DA 4JSNC 4PSXB 2WQ8A 3UVKA 4FA1D 4JHPC 4ZOYA 3ZDYA 2G9AA 3K71A 5FLXg 1VE6A 3DDUA 3FRXA 4WK0A 4A09A 1GOFA 2OVPB 5TEFA 3UKRC 5E6SA 1H2YA 2GC4A 4GQ1A 1I2MB 2XL3A 2O9KA 3A0FA 2XDWA 3OW8A 2Z2PA 1MDAH 1MG3A 1O6FA 3CFSB 4BUJC 1E8NA 1UTCA 2VDKA 3VA6A 3AH8B 3U4YA 3NVNA 4J82A 2H13A 4O9DA 3ZE1A 4GMBA 3P4FA 4PC0A 3O4IA 3OL2A 5FFOA 2P9SC 4ERYA 4GM9A 3IJ1A 5C2VB 4O1QD 3EI3B 1QNIA 3EQ7A 5K19A 3T3MA 3F3FA 5CXBB 4X60B 4J77A 4TZ4A 5IC7A 2HKRA 2TRCB 3PSLA 4D0KA 3O4GA 3E0CA 4MK0B 3PVWB 1L0QA 4N14A 2PM9A 4Y7RA 3K72A 5FQDA 5THAA 1K3IA 4U7AA 3EI4B 3ULEC 1K8KC 1XKSA 4X3EA 4YVDA 3IIWA 1JMZB 1SQJA 1GOTB 4QT8A 5C9ZB 2AGWA 2AGZA 1UOOA 3GREA 5FKRA 3SMRA 4CI8A 4BCCA 2XE4A 4FB1D 2QXVA 2H68A 2CE9A 4FAND 3I2NA 5EMLB 1PI6A 3FM0A 4G1EA 4BL0A 4O3UB 2I0RA 5TF2A 2AGYA 2VC2A 3O4HA 4XYHA 2YNNA 1VZ2A 3MMYA 2B5MA 4AMZA 5AMSA 4AMYA 4D6VA 2QR5A 1PEVA 3C99A 4RE5A 1C9LA 4AN1A 3PVUB 2OK4A 2OJYA 4I79A 3OTTA 1A12A 1UOQA 4UM8A 2YB8B 3HFQA 3IVMA 1U4CA 2B5LA 4CI2A 5HE0B 4E5ZA 4MMZA 3BG1A 4DNWA 4L3HD 4OWRA 1VE7A 2XYIA 3DXKC 2AGLA 4BP9A 4WK2A 4AOWA 1K32A 2P9IC 3EQ9A 4PXWA 4Z7OA 2EIBA 5CXCA 4J0XA 3IUMA 5H17A 4PNKB 4IRZA 4LGNA 3DSMA 1SHYB 3N0EA 4A2LA 3OKTA 3SVWD 2VZ3A 3IULA 3UVNA 4A08B 3NIGA 3V7DB 5FKQA 5TDHB 5E6UA 4A0AA 5B4WA 3EU7A 4AX4A 3I7KA 2HJBA 3V9FA 4ESGA 4G56B 4A7JA 4Z7NA 1XIPA 2Z2NA 2VDNA 3MXXA 2YNOA 4GGAA 3PE7A 4JXMA 4CY1A 5H1MA 4K3ID 2B4EA 2OK6A 3MZLA 4CC9A 4ZN4A 2IWFA 3RSEC 1YFQA 1H2WA 1N6EA 4JD2C 5HE3B 1TBGA 3C5MA 4GM3A 5EM2A 5FA5B 3KRWB
chains in the Genus database with same CATH topology
3B7FA 5EMMB 3PXWD 3RN0D 4A09B 4GZ8A 5K1CC 2BCJB 2IUPA 5IGQA 3RRMC 5FKTA 2Z2OA 4OZUA 3K27A 4L1QD 4ZOVA 2IUQA 1JOFA 1S4UX 3UKUC 2H3XA 4UI9R 4J87A 5EMJB 3SBQA 5GXIA 1TYQC 4CZYA 4QQEA 2HESX 1U2VC 3NVXA 4CI3A 4X63B 2P9UC 3DWLC 4J84A 2H47A 3SXTD 2IAAA 2PM9B 4IMMA 2OVRB 2AQ5A 3RFHA 3JZGA 2G99A 5TEEA 3EI3A 3UVMA 4H5IA 4IA9A 4FHLA 3W15A 4FA5D 1JMXB 2J55H 1A0RB 3VH0A 2YMUA 3OKYA 4NSXA 4Y5RD 2IUVA 2GNQA 5I5MA 3J81g 5HE1B 4GM8A 4CZVA 1ERJA 2IWKA 5IJ8E 3F3GA 2AH1A 2I0TA 5HE2B 3BG0A 3V5WB 5KDOB 5EALA 2H9PA 4E5ZB 2AH0A 2H6NA 4H5JA 1P22A 4R7AB 2CN3A 3AL8A 4JSVC 4X61B 5HQGA 3RN1D 4U1EI 3SBPA 1PGUA 5CXCB 2YBAA 2H6KA 3I7OA 3EI1A 2PM7B 2HXCA 1XHMA 3L4OD 3EI2A 4CY3A 3IIYA 3PSCB 4J73A 3I89A 2MTAH 3EMHA 1GP2B 2H6QA 4E54B 4A0AB 4ZOXA 2P9PC 5I5IA 3JB9L 4KFMB 5HYNB 3RLMD 3RMZD 2I3TA 4A0BA 3I7LA 3MZKA 2CO0A 4J0WA 3MKQA 5EM2B 3I8EA 3CFVA 2EBSA 4FAVD 2OVQB 4A11A 1B9YA 4J79A 4FA4D 3SN6B 4ERZA 3I8CA 4BH6A 3SJLD 3C9CA 5CYKA 5FKSA 5FXYA 5GXHA 3IJ0A 4JSXC 4ZOZA 1R5MA 3EWEA 3IJCA 1N6FA 1NR0A 4QRJA 4AEZA 4JT5C 4CZXA 3GFCA 1GXRA 3C75H 3OL2B 5EAPA 4O45A 2HJ4A 3VGZA 5I5JA 3MKSB 4GGDA 2PM6B 1OMWB 1NEXB 3SWSD 2XL2A 4PSWB 2PBIB 3K26A 2I0SA 3SFZA 2XU7A 2P9NC 4XYIA 5EARA 2IURA 4JT6C 5GMKn 4JSPC 1B9XA 3DXMC 5EMKB 3JPXA 3PXTD 5A2Qg 3JROA 5CXBA 4FWWA 4LG8A 1OLZA 4J8GA 3SCYA 3JZHA 3KRXB 4J81A 3RFGA 3ORVD 4GGCA 3OKYB 3EI4A 4GQBB 2I3SA 2CO0C 3N0DA 4CI1A 2CE8A 3UVLA 3SHFA 3SLED 4A2MA 4PBZA 3UVOA 2OIZA 4PBYA 3ZWLB 3IKOA 2HKMA 3UR4A 5IT9g 2CNXA 5GSAA 5AJAA 3PXSD 3JRPA 4ES0A 2H14A 5IJ7E 4HDJA 2YNPA 5H14A 5IGOA 3AL9A 3AL8B 4XEIC 3J80g 2Q7QA 3JAMg 2H9NA 3ODTA 3CIKB 4L9OA 4J86A 2HYEA 3OKWA 4K3JB 3SBRA 2B5NA 2J57G 4Z8LA 3JZNA 4EWRA 4ERQA 4J8BA 2QC5A 5SXMA 3EI1B 1VYHC 2CN2A 1MG2A 3F3PA 3BWSA 3EI2B 2UZYB 1SQ9A 2J56H 3I7PA 3EG6A 3DM0A 2UZXB 3I7NA 3AFCA 4J78A 1GG2B 1Q47A 4QL1A 3I7HA 2GC7A 5C2WB 4L3GD 2P9LC 4GQ2P 1RI6A 4A0BB 3FGBA 1JJUB 2H9MA 4A08A 2H9LA 5AFU3 4LG9A 4E54A 4CY2A 2P9KC 2W18A 3L4MD 2BBKH 5EAMA 1PBYB 4A11B 1FWXA 4CY5A 2AGXA 3NVQA 4FA9D 5JWZA 4O3TB 5CYKB 1N6DA 4JSNC 4PSXB 3UVKA 4FA1D 4ZOYA 2G9AA 5FLXg 3FRXA 4A09A 2OVPB 5TEFA 3UKRC 2GC4A 4GQ1A 2XL3A 2O9KA 3A0FA 3OW8A 2Z2PA 1MDAH 1MG3A 3CFSB 4BUJC 3VA6A 3AH8B 3U4YA 3NVNA 4J82A 2H13A 4O9DA 4GMBA 3P4FA 4PC0A 3OL2A 4ERYA 2P9SC 4GM9A 3IJ1A 5C2VB 4O1QD 3EI3B 1QNIA 5K19A 3F3FA 5CXBB 4X60B 4J77A 4TZ4A 5IC7A 2HKRA 2TRCB 3PSLA 4D0KA 3E0CA 4MK0B 3PVWB 1L0QA 4N14A 2PM9A 4Y7RA 5FQDA 5THAA 4U7AA 3EI4B 3ULEC 1K8KC 1XKSA 4X3EA 4YVDA 3IIWA 1JMZB 1SQJA 1GOTB 4QT8A 5C9ZB 2AGWA 2AGZA 3GREA 5FKRA 3SMRA 4CI8A 4FB1D 2QXVA 2H68A 2CE9A 4FAND 3I2NA 5EMLB 1PI6A 3FM0A 4BL0A 4O3UB 2I0RA 5TF2A 2AGYA 4XYHA 2YNNA 3MMYA 2B5MA 5AMSA 4D6VA 1PEVA 3C99A 3PVUB 2OK4A 2OJYA 4I79A 3OTTA 2YB8B 3HFQA 1U4CA 2B5LA 4CI2A 5HE0B 4E5ZA 3BG1A 4L3HD 4OWRA 2XYIA 3DXKC 2AGLA 4AOWA 1K32A 2P9IC 4PXWA 5CXCA 4J0XA 5H17A 4PNKB 4LGNA 3DSMA 1SHYB 3N0EA 4A2LA 3OKTA 3SVWD 3UVNA 4A08B 3V7DB 5FKQA 5TDHB 4A0AA 5B4WA 3EU7A 4ESGA 3I7KA 2HJBA 3V9FA 4G56B 4A7JA 1XIPA 2Z2NA 3MXXA 2YNOA 4GGAA 3PE7A 4JXMA 4CY1A 5H1MA 4K3ID 2B4EA 2OK6A 3MZLA 4CC9A 4ZN4A 2IWFA 3RSEC 1YFQA 1N6EA 4JD2C 5HE3B 1TBGA 3C5MA 4GM3A 5EM2A 5FA5B 3KRWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7F A;  5EMM B;  3PXW D;  3RN0 D;  4A09 B;  4GZ8 A;  5K1C C;  2BCJ B;  2IUP A;  5IGQ A;  3RRM C;  5FKT A;  2Z2O A;  4OZU A;  3K27 A;  4L1Q D;  4ZOV A;  2IUQ A;  1JOF A;  1S4U X;  3UKU C;  2H3X A;  4UI9 R;  4J87 A;  5EMJ B;  3SBQ A;  5GXI A;  1TYQ C;  4CZY A;  4QQE A;  2HES X;  1U2V C;  3NVX A;  4CI3 A;  4X63 B;  2P9U C;  3DWL C;  4J84 A;  2H47 A;  3SXT D;  2IAA A;  2PM9 B;  4IMM A;  2OVR B;  2AQ5 A;  3RFH A;  3JZG A;  2G99 A;  5TEE A;  3EI3 A;  3UVM A;  4H5I A;  4IA9 A;  4FHL A;  3W15 A;  4FA5 D;  1JMX B;  2J55 H;  1A0R B;  3VH0 A;  2YMU A;  3OKY A;  4NSX A;  4Y5R D;  2IUV A;  2GNQ A;  5I5M A;  3J81 g;  5HE1 B;  4GM8 A;  4CZV A;  1ERJ A;  2IWK A;  5IJ8 E;  3F3G A;  2AH1 A;  2I0T A;  5HE2 B;  3BG0 A;  3V5W B;  5KDO B;  5EAL A;  2H9P A;  4E5Z B;  2AH0 A;  2H6N A;  4H5J A;  1P22 A;  4R7A B;  2CN3 A;  3AL8 A;  4JSV C;  4X61 B;  5HQG A;  3RN1 D;  4U1E I;  3SBP A;  1PGU A;  5CXC B;  2YBA A;  2H6K A;  3I7O A;  3EI1 A;  2PM7 B;  2HXC A;  1XHM A;  3L4O D;  3EI2 A;  4CY3 A;  3IIY A;  3PSC B;  4J73 A;  3I89 A;  2MTA H;  3EMH A;  1GP2 B;  2H6Q A;  4E54 B;  4A0A B;  4ZOX A;  2P9P C;  5I5I A;  3JB9 L;  4KFM B;  5HYN B;  3RLM D;  3RMZ D;  2I3T A;  4A0B A;  3I7L A;  3MZK A;  2CO0 A;  4J0W A;  3MKQ A;  5EM2 B;  3I8E A;  3CFV A;  2EBS A;  4FAV D;  2OVQ B;  4A11 A;  1B9Y A;  4J79 A;  4FA4 D;  3SN6 B;  4ERZ A;  3I8C A;  4BH6 A;  3SJL D;  3C9C A;  5CYK A;  5FKS A;  5FXY A;  5GXH A;  3IJ0 A;  4JSX C;  4ZOZ A;  1R5M A;  3EWE A;  3IJC A;  1N6F A;  1NR0 A;  4QRJ A;  4AEZ A;  4JT5 C;  4CZX A;  3GFC A;  1GXR A;  3C75 H;  3OL2 B;  5EAP A;  4O45 A;  2HJ4 A;  3VGZ A;  5I5J A;  3MKS B;  4GGD A;  2PM6 B;  1OMW B;  1NEX B;  3SWS D;  2XL2 A;  4PSW B;  2PBI B;  3K26 A;  2I0S A;  3SFZ A;  2XU7 A;  2P9N C;  4XYI A;  5EAR A;  2IUR A;  4JT6 C;  5GMK n;  4JSP C;  1B9X A;  3DXM C;  5EMK B;  3JPX A;  3PXT D;  5A2Q g;  3JRO A;  5CXB A;  4FWW A;  4LG8 A;  1OLZ A;  4J8G A;  3SCY A;  3JZH A;  3KRX B;  4J81 A;  3RFG A;  3ORV D;  4GGC A;  3OKY B;  3EI4 A;  4GQB B;  2I3S A;  2CO0 C;  3N0D A;  4CI1 A;  2CE8 A;  3UVL A;  3SHF A;  3SLE D;  4A2M A;  4PBZ A;  3UVO A;  2OIZ A;  4PBY A;  3ZWL B;  3IKO A;  2HKM A;  3UR4 A;  5IT9 g;  2CNX A;  5GSA A;  5AJA A;  3PXS D;  3JRP A;  4ES0 A;  2H14 A;  5IJ7 E;  4HDJ A;  2YNP A;  5H14 A;  5IGO A;  3AL9 A;  3AL8 B;  4XEI C;  3J80 g;  2Q7Q A;  3JAM g;  2H9N A;  3ODT A;  3CIK B;  4L9O A;  4J86 A;  2HYE A;  3OKW A;  4K3J B;  3SBR A;  2B5N A;  2J57 G;  4Z8L A;  3JZN A;  4EWR A;  4ERQ A;  4J8B A;  2QC5 A;  5SXM A;  3EI1 B;  1VYH C;  2CN2 A;  1MG2 A;  3F3P A;  3BWS A;  3EI2 B;  2UZY B;  1SQ9 A;  2J56 H;  3I7P A;  3EG6 A;  3DM0 A;  2UZX B;  3I7N A;  3AFC A;  4J78 A;  1GG2 B;  1Q47 A;  4QL1 A;  3I7H A;  2GC7 A;  5C2W B;  4L3G D;  2P9L C;  4GQ2 P;  1RI6 A;  4A0B B;  3FGB A;  1JJU B;  2H9M A;  4A08 A;  2H9L A;  5AFU 3;  4LG9 A;  4E54 A;  4CY2 A;  2P9K C;  2W18 A;  3L4M D;  2BBK H;  5EAM A;  1PBY B;  4A11 B;  1FWX A;  4CY5 A;  2AGX A;  3NVQ A;  4FA9 D;  5JWZ A;  4O3T B;  5CYK B;  1N6D A;  4JSN C;  4PSX B;  3UVK A;  4FA1 D;  4ZOY A;  2G9A A;  5FLX g;  3FRX A;  4A09 A;  2OVP B;  5TEF A;  3UKR C;  2GC4 A;  4GQ1 A;  2XL3 A;  2O9K A;  3A0F A;  3OW8 A;  2Z2P A;  1MDA H;  1MG3 A;  3CFS B;  4BUJ C;  3VA6 A;  3AH8 B;  3U4Y A;  3NVN A;  4J82 A;  2H13 A;  4O9D A;  4GMB A;  3P4F A;  4PC0 A;  3OL2 A;  4ERY A;  2P9S C;  4GM9 A;  3IJ1 A;  5C2V B;  4O1Q D;  3EI3 B;  1QNI A;  5K19 A;  3F3F A;  5CXB B;  4X60 B;  4J77 A;  4TZ4 A;  5IC7 A;  2HKR A;  2TRC B;  3PSL A;  4D0K A;  3E0C A;  4MK0 B;  3PVW B;  1L0Q A;  4N14 A;  2PM9 A;  4Y7R A;  5FQD A;  5THA A;  4U7A A;  3EI4 B;  3ULE C;  1K8K C;  1XKS A;  4X3E A;  4YVD A;  3IIW A;  1JMZ B;  1SQJ A;  1GOT B;  4QT8 A;  5C9Z B;  2AGW A;  2AGZ A;  3GRE A;  5FKR A;  3SMR A;  4CI8 A;  4FB1 D;  2QXV A;  2H68 A;  2CE9 A;  4FAN D;  3I2N A;  5EML B;  1PI6 A;  3FM0 A;  4BL0 A;  4O3U B;  2I0R A;  5TF2 A;  2AGY A;  4XYH A;  2YNN A;  3MMY A;  2B5M A;  5AMS A;  4D6V A;  1PEV A;  3C99 A;  3PVU B;  2OK4 A;  2OJY A;  4I79 A;  3OTT A;  2YB8 B;  3HFQ A;  1U4C A;  2B5L A;  4CI2 A;  5HE0 B;  4E5Z A;  3BG1 A;  4L3H D;  4OWR A;  2XYI A;  3DXK C;  2AGL A;  4AOW A;  1K32 A;  2P9I C;  4PXW A;  5CXC A;  4J0X A;  5H17 A;  4PNK B;  4LGN A;  3DSM A;  1SHY B;  3N0E A;  4A2L A;  3OKT A;  3SVW D;  3UVN A;  4A08 B;  3V7D B;  5FKQ A;  5TDH B;  4A0A A;  5B4W A;  3EU7 A;  4ESG A;  3I7K A;  2HJB A;  3V9F A;  4G56 B;  4A7J A;  1XIP A;  2Z2N A;  3MXX A;  2YNO A;  4GGA A;  3PE7 A;  4JXM A;  4CY1 A;  5H1M A;  4K3I D;  2B4E A;  2OK6 A;  3MZL A;  4CC9 A;  4ZN4 A;  2IWF A;  3RSE C;  1YFQ A;  1N6E A;  4JD2 C;  5HE3 B;  1TBG A;  3C5M A;  4GM3 A;  5EM2 A;  5FA5 B;  3KRW B; 
#chains in the Genus database with same CATH topology
 3B7F A;  3GD1 I;  5EMM B;  3PXW D;  3RN0 D;  5M5V A;  4A09 B;  4GZ8 A;  2HU7 A;  5K1C C;  3KCI A;  2BCJ B;  3ZE0 A;  2IUP A;  5IGQ A;  3RRM C;  5FKT A;  2Z2O A;  3FCS A;  3O4J A;  4D9S A;  4OZU A;  2VDR A;  3K27 A;  4NBM A;  1UOP A;  4L1Q D;  4ZOV A;  2IUQ A;  1JOF A;  1S4U X;  3UKU C;  2H3X A;  4UI9 R;  2EIC A;  4J87 A;  4NEN A;  5EMJ B;  3SBQ A;  5GXI A;  1TYQ C;  4CZY A;  4QQE A;  2HES X;  1U2V C;  3NVX A;  4AN0 A;  4CI3 A;  4X63 B;  2P9U C;  3DWL C;  4J84 A;  2H47 A;  3MUN A;  3SXT D;  2IAA A;  2PM9 B;  3GC3 B;  3IUJ A;  5FFG A;  4IMM A;  2OVR B;  2AQ5 A;  4BP8 A;  3RFH A;  3JZG A;  2HU8 A;  2G99 A;  5TEE A;  3EI3 A;  3UVM A;  4H5I A;  2XZG A;  4G1M A;  4IA9 A;  4FHL A;  3W15 A;  4FA5 D;  1JMX B;  1C9I A;  4O2W A;  2J55 H;  4Z7Q A;  1A0R B;  4BCB A;  3VH0 A;  2YMU A;  4DNV A;  1QFM A;  3OKY A;  1U8C A;  4NAA A;  4NSX A;  4Y5R D;  2IUV A;  2GNQ A;  5I5M A;  2EIE A;  3J81 g;  2HU5 A;  5HE1 B;  5M5T A;  4GM8 A;  4CZV A;  1ERJ A;  2IWK A;  5IJ8 E;  3F3G A;  2AH1 A;  2I0T A;  5HE2 B;  2VDQ A;  3BG0 A;  3QHY B;  3V5W B;  5KDO B;  5EAL A;  2H9P A;  4E5Z B;  2AH0 A;  2H6N A;  4H5J A;  1P22 A;  1GOH A;  4R7A B;  2CN3 A;  3AL8 A;  4JSV C;  4X61 B;  3IJE A;  5HQG A;  3RN1 D;  4U1E I;  1VZ3 A;  4UM9 A;  3SBP A;  1PGU A;  5CXC B;  2YBA A;  2H6K A;  3I7O A;  3NID A;  3EI1 A;  2PM7 B;  2HXC A;  1XHM A;  3L4O D;  3EI2 A;  4CY3 A;  3IIY A;  3PSC B;  2JKX A;  4J73 A;  3ZDX A;  3I89 A;  2MTA H;  3EMH A;  3QI0 A;  3ZE2 A;  1GP2 B;  2H6Q A;  4E54 B;  4A0A B;  4ZOX A;  2P9P C;  5I5I A;  3MVD K;  3JB9 L;  4QAM A;  4KFM B;  1YR2 A;  5HYN B;  4MMX A;  5M5R A;  3RLM D;  3RMZ D;  2I3T A;  4A0B A;  1H2X A;  2VDP A;  3I7L A;  3MZK A;  3IUQ A;  1O6G A;  2CO0 A;  3IUR A;  2BKL A;  4J0W A;  3EQ8 A;  3MKQ A;  5EM2 B;  3I8E A;  3CFV A;  2EBS A;  5M5U A;  4FAV D;  2OVQ B;  4A11 A;  1B9Y A;  1JV2 A;  4J79 A;  2EID A;  3IUN A;  4JHN A;  3SN6 B;  1JTD B;  4ERZ A;  4FA4 D;  3I8C A;  4BH6 A;  3SJL D;  3C9C A;  2QZP A;  5CYK A;  5FKS A;  4G55 A;  5FXY A;  5GXH A;  3IJ0 A;  4JSX C;  4ZOZ A;  1R5M A;  3EWE A;  3IJC A;  3ZDZ A;  5HDB A;  1N6F A;  1NR0 A;  4QRJ A;  4AEZ A;  4JT5 C;  4CZX A;  3GFC A;  1GXR A;  3C75 H;  3OL2 B;  5EAP A;  2VDM A;  4O45 A;  2HJ4 A;  3VGZ A;  4L1M A;  5I5J A;  1E5T A;  3MKS B;  4GGD A;  2PM6 B;  5C86 A;  1OMW B;  1NEX B;  3VI4 A;  3SWS D;  2XL2 A;  1H2Z A;  4PSW B;  2PBI B;  3K26 A;  2I0S A;  4DNU A;  3SFZ A;  2XU7 A;  2P9N C;  4XYI A;  5EAR A;  2IUR A;  4JT6 C;  5GMK n;  1E8M A;  4JSP C;  1B9X A;  3DXM C;  5EMK B;  3JPX A;  3PXT D;  4RE6 A;  5A2Q g;  1GOG A;  3JRO A;  5CXB A;  4FWW A;  4LG8 A;  1OLZ A;  4BCD A;  4J8G A;  3SCY A;  3NIF A;  3JZH A;  3KRX B;  3FCU A;  4J81 A;  1T2X A;  3ORV D;  3RFG A;  4GGC A;  3OKY B;  3EI4 A;  4GQB B;  2I3S A;  1L5G A;  2CO0 C;  3N0D A;  4CI1 A;  2CE8 A;  3UVL A;  3SHF A;  3SLE D;  2VZ1 A;  4A2M A;  4PBZ A;  3UVO A;  2OIZ A;  4PBY A;  4MMY A;  3ZWL B;  3IKO A;  2HKM A;  5M61 A;  3UR4 A;  5IT9 g;  2CNX A;  5GSA A;  5AJA A;  3PXS D;  3JRP A;  4ES0 A;  2H14 A;  5IJ7 E;  3VI3 A;  4HDJ A;  2YNP A;  2VDL A;  5H14 A;  5IGO A;  4NC4 A;  3AL9 A;  3K6S A;  3AL8 B;  4XEI C;  3J80 g;  2Q7Q A;  3JAM g;  2H9N A;  3ODT A;  3CIK B;  4L9O A;  4J86 A;  3V4P A;  2HYE A;  3OKW A;  4K3J B;  3SBR A;  2B5N A;  2J57 G;  4Z8L A;  3JZN A;  4EWR A;  4ERQ A;  4J8B A;  2QC5 A;  5SXM A;  3EI1 B;  1VYH C;  2CN2 A;  1MG2 A;  3F3P A;  3BWS A;  3OF7 A;  3EI2 B;  2UZY B;  1SQ9 A;  2J56 H;  3I7P A;  3EG6 A;  3DM0 A;  2UZX B;  3I7N A;  5C92 A;  3AFC A;  4J78 A;  1GG2 B;  1Q47 A;  4QL1 A;  3MUO A;  3I7H A;  2GC7 A;  5C2W B;  5M5S A;  4WJK A;  4L3G D;  4WK4 A;  1QFS A;  1M1X A;  2P9L C;  4GQ2 P;  1RI6 A;  4A0B B;  3FGB A;  1JJU B;  2H9M A;  4A08 A;  3V4V A;  2H9L A;  5AFU 3;  4LG9 A;  4E54 A;  4CY2 A;  1BPO A;  2P9K C;  2W18 A;  3L4M D;  2VDO A;  2BBK H;  5EAM A;  3T3P A;  1PBY B;  4A11 B;  1FWX A;  4CY5 A;  2AGX A;  3NVQ A;  5E6R A;  4FA9 D;  1TYE A;  5JWZ A;  4O3T B;  5CYK B;  4O02 A;  1N6D A;  4JSN C;  4PSX B;  2WQ8 A;  3UVK A;  4FA1 D;  4JHP C;  4ZOY A;  3ZDY A;  2G9A A;  3K71 A;  5FLX g;  1VE6 A;  3DDU A;  3FRX A;  4WK0 A;  4A09 A;  1GOF A;  2OVP B;  5TEF A;  3UKR C;  5E6S A;  1H2Y A;  2GC4 A;  4GQ1 A;  1I2M B;  2XL3 A;  2O9K A;  3A0F A;  2XDW A;  3OW8 A;  2Z2P A;  1MDA H;  1MG3 A;  1O6F A;  3CFS B;  4BUJ C;  1E8N A;  1UTC A;  2VDK A;  3VA6 A;  3AH8 B;  3U4Y A;  3NVN A;  4J82 A;  2H13 A;  4O9D A;  3ZE1 A;  4GMB A;  3P4F A;  4PC0 A;  3O4I A;  3OL2 A;  5FFO A;  2P9S C;  4ERY A;  4GM9 A;  3IJ1 A;  5C2V B;  4O1Q D;  3EI3 B;  1QNI A;  3EQ7 A;  5K19 A;  3T3M A;  3F3F A;  5CXB B;  4X60 B;  4J77 A;  4TZ4 A;  5IC7 A;  2HKR A;  2TRC B;  3PSL A;  4D0K A;  3O4G A;  3E0C A;  4MK0 B;  3PVW B;  1L0Q A;  4N14 A;  2PM9 A;  4Y7R A;  3K72 A;  5FQD A;  5THA A;  1K3I A;  4U7A A;  3EI4 B;  3ULE C;  1K8K C;  1XKS A;  4X3E A;  4YVD A;  3IIW A;  1JMZ B;  1SQJ A;  1GOT B;  4QT8 A;  5C9Z B;  2AGW A;  2AGZ A;  1UOO A;  3GRE A;  5FKR A;  3SMR A;  4CI8 A;  4BCC A;  2XE4 A;  4FB1 D;  2QXV A;  2H68 A;  2CE9 A;  4FAN D;  3I2N A;  5EML B;  1PI6 A;  3FM0 A;  4G1E A;  4BL0 A;  4O3U B;  2I0R A;  5TF2 A;  2AGY A;  2VC2 A;  3O4H A;  4XYH A;  2YNN A;  1VZ2 A;  3MMY A;  2B5M A;  4AMZ A;  5AMS A;  4AMY A;  4D6V A;  2QR5 A;  1PEV A;  3C99 A;  4RE5 A;  1C9L A;  4AN1 A;  3PVU B;  2OK4 A;  2OJY A;  4I79 A;  3OTT A;  1A12 A;  1UOQ A;  4UM8 A;  2YB8 B;  3HFQ A;  3IVM A;  1U4C A;  2B5L A;  4CI2 A;  5HE0 B;  4E5Z A;  4MMZ A;  3BG1 A;  4DNW A;  4L3H D;  4OWR A;  1VE7 A;  2XYI A;  3DXK C;  2AGL A;  4BP9 A;  4WK2 A;  4AOW A;  1K32 A;  2P9I C;  3EQ9 A;  4PXW A;  4Z7O A;  2EIB A;  5CXC A;  4J0X A;  3IUM A;  5H17 A;  4PNK B;  4IRZ A;  4LGN A;  3DSM A;  1SHY B;  3N0E A;  4A2L A;  3OKT A;  3SVW D;  2VZ3 A;  3IUL A;  3UVN A;  4A08 B;  3NIG A;  3V7D B;  5FKQ A;  5TDH B;  5E6U A;  4A0A A;  5B4W A;  3EU7 A;  4AX4 A;  3I7K A;  2HJB A;  3V9F A;  4ESG A;  4G56 B;  4A7J A;  4Z7N A;  1XIP A;  2Z2N A;  2VDN A;  3MXX A;  2YNO A;  4GGA A;  3PE7 A;  4JXM A;  4CY1 A;  5H1M A;  4K3I D;  2B4E A;  2OK6 A;  3MZL A;  4CC9 A;  4ZN4 A;  2IWF A;  3RSE C;  1YFQ A;  1H2W A;  1N6E A;  4JD2 C;  5HE3 B;  1TBG A;  3C5M A;  4GM3 A;  5EM2 A;  5FA5 B;  3KRW B; 
#chains in the Genus database with same CATH homology
 3B7F A;  5EMM B;  3PXW D;  3RN0 D;  4A09 B;  4GZ8 A;  5K1C C;  2BCJ B;  2IUP A;  5IGQ A;  3RRM C;  5FKT A;  2Z2O A;  4OZU A;  3K27 A;  4L1Q D;  4ZOV A;  2IUQ A;  1JOF A;  1S4U X;  3UKU C;  2H3X A;  4UI9 R;  4J87 A;  5EMJ B;  3SBQ A;  5GXI A;  1TYQ C;  4CZY A;  4QQE A;  2HES X;  1U2V C;  3NVX A;  4CI3 A;  4X63 B;  2P9U C;  3DWL C;  4J84 A;  2H47 A;  3SXT D;  2IAA A;  2PM9 B;  4IMM A;  2OVR B;  2AQ5 A;  3RFH A;  3JZG A;  2G99 A;  5TEE A;  3EI3 A;  3UVM A;  4H5I A;  4IA9 A;  4FHL A;  3W15 A;  4FA5 D;  1JMX B;  2J55 H;  1A0R B;  3VH0 A;  2YMU A;  3OKY A;  4NSX A;  4Y5R D;  2IUV A;  2GNQ A;  5I5M A;  3J81 g;  5HE1 B;  4GM8 A;  4CZV A;  1ERJ A;  2IWK A;  5IJ8 E;  3F3G A;  2AH1 A;  2I0T A;  5HE2 B;  3BG0 A;  3V5W B;  5KDO B;  5EAL A;  2H9P A;  4E5Z B;  2AH0 A;  2H6N A;  4H5J A;  1P22 A;  4R7A B;  2CN3 A;  3AL8 A;  4JSV C;  4X61 B;  5HQG A;  3RN1 D;  4U1E I;  3SBP A;  1PGU A;  5CXC B;  2YBA A;  2H6K A;  3I7O A;  3EI1 A;  2PM7 B;  2HXC A;  1XHM A;  3L4O D;  3EI2 A;  4CY3 A;  3IIY A;  3PSC B;  4J73 A;  3I89 A;  2MTA H;  3EMH A;  1GP2 B;  2H6Q A;  4E54 B;  4A0A B;  4ZOX A;  2P9P C;  5I5I A;  3JB9 L;  4KFM B;  5HYN B;  3RLM D;  3RMZ D;  2I3T A;  4A0B A;  3I7L A;  3MZK A;  2CO0 A;  4J0W A;  3MKQ A;  5EM2 B;  3I8E A;  3CFV A;  2EBS A;  4FAV D;  2OVQ B;  4A11 A;  1B9Y A;  4J79 A;  4FA4 D;  3SN6 B;  4ERZ A;  3I8C A;  4BH6 A;  3SJL D;  3C9C A;  5CYK A;  5FKS A;  5FXY A;  5GXH A;  3IJ0 A;  4JSX C;  4ZOZ A;  1R5M A;  3EWE A;  3IJC A;  1N6F A;  1NR0 A;  4QRJ A;  4AEZ A;  4JT5 C;  4CZX A;  3GFC A;  1GXR A;  3C75 H;  3OL2 B;  5EAP A;  4O45 A;  2HJ4 A;  3VGZ A;  5I5J A;  3MKS B;  4GGD A;  2PM6 B;  1OMW B;  1NEX B;  3SWS D;  2XL2 A;  4PSW B;  2PBI B;  3K26 A;  2I0S A;  3SFZ A;  2XU7 A;  2P9N C;  4XYI A;  5EAR A;  2IUR A;  4JT6 C;  5GMK n;  4JSP C;  1B9X A;  3DXM C;  5EMK B;  3JPX A;  3PXT D;  5A2Q g;  3JRO A;  5CXB A;  4FWW A;  4LG8 A;  1OLZ A;  4J8G A;  3SCY A;  3JZH A;  3KRX B;  4J81 A;  3RFG A;  3ORV D;  4GGC A;  3OKY B;  3EI4 A;  4GQB B;  2I3S A;  2CO0 C;  3N0D A;  4CI1 A;  2CE8 A;  3UVL A;  3SHF A;  3SLE D;  4A2M A;  4PBZ A;  3UVO A;  2OIZ A;  4PBY A;  3ZWL B;  3IKO A;  2HKM A;  3UR4 A;  5IT9 g;  2CNX A;  5GSA A;  5AJA A;  3PXS D;  3JRP A;  4ES0 A;  2H14 A;  5IJ7 E;  4HDJ A;  2YNP A;  5H14 A;  5IGO A;  3AL9 A;  3AL8 B;  4XEI C;  3J80 g;  2Q7Q A;  3JAM g;  2H9N A;  3ODT A;  3CIK B;  4L9O A;  4J86 A;  2HYE A;  3OKW A;  4K3J B;  3SBR A;  2B5N A;  2J57 G;  4Z8L A;  3JZN A;  4EWR A;  4ERQ A;  4J8B A;  2QC5 A;  5SXM A;  3EI1 B;  1VYH C;  2CN2 A;  1MG2 A;  3F3P A;  3BWS A;  3EI2 B;  2UZY B;  1SQ9 A;  2J56 H;  3I7P A;  3EG6 A;  3DM0 A;  2UZX B;  3I7N A;  3AFC A;  4J78 A;  1GG2 B;  1Q47 A;  4QL1 A;  3I7H A;  2GC7 A;  5C2W B;  4L3G D;  2P9L C;  4GQ2 P;  1RI6 A;  4A0B B;  3FGB A;  1JJU B;  2H9M A;  4A08 A;  2H9L A;  5AFU 3;  4LG9 A;  4E54 A;  4CY2 A;  2P9K C;  2W18 A;  3L4M D;  2BBK H;  5EAM A;  1PBY B;  4A11 B;  1FWX A;  4CY5 A;  2AGX A;  3NVQ A;  4FA9 D;  5JWZ A;  4O3T B;  5CYK B;  1N6D A;  4JSN C;  4PSX B;  3UVK A;  4FA1 D;  4ZOY A;  2G9A A;  5FLX g;  3FRX A;  4A09 A;  2OVP B;  5TEF A;  3UKR C;  2GC4 A;  4GQ1 A;  2XL3 A;  2O9K A;  3A0F A;  3OW8 A;  2Z2P A;  1MDA H;  1MG3 A;  3CFS B;  4BUJ C;  3VA6 A;  3AH8 B;  3U4Y A;  3NVN A;  4J82 A;  2H13 A;  4O9D A;  4GMB A;  3P4F A;  4PC0 A;  3OL2 A;  4ERY A;  2P9S C;  4GM9 A;  3IJ1 A;  5C2V B;  4O1Q D;  3EI3 B;  1QNI A;  5K19 A;  3F3F A;  5CXB B;  4X60 B;  4J77 A;  4TZ4 A;  5IC7 A;  2HKR A;  2TRC B;  3PSL A;  4D0K A;  3E0C A;  4MK0 B;  3PVW B;  1L0Q A;  4N14 A;  2PM9 A;  4Y7R A;  5FQD A;  5THA A;  4U7A A;  3EI4 B;  3ULE C;  1K8K C;  1XKS A;  4X3E A;  4YVD A;  3IIW A;  1JMZ B;  1SQJ A;  1GOT B;  4QT8 A;  5C9Z B;  2AGW A;  2AGZ A;  3GRE A;  5FKR A;  3SMR A;  4CI8 A;  4FB1 D;  2QXV A;  2H68 A;  2CE9 A;  4FAN D;  3I2N A;  5EML B;  1PI6 A;  3FM0 A;  4BL0 A;  4O3U B;  2I0R A;  5TF2 A;  2AGY A;  4XYH A;  2YNN A;  3MMY A;  2B5M A;  5AMS A;  4D6V A;  1PEV A;  3C99 A;  3PVU B;  2OK4 A;  2OJY A;  4I79 A;  3OTT A;  2YB8 B;  3HFQ A;  1U4C A;  2B5L A;  4CI2 A;  5HE0 B;  4E5Z A;  3BG1 A;  4L3H D;  4OWR A;  2XYI A;  3DXK C;  2AGL A;  4AOW A;  1K32 A;  2P9I C;  4PXW A;  5CXC A;  4J0X A;  5H17 A;  4PNK B;  4LGN A;  3DSM A;  1SHY B;  3N0E A;  4A2L A;  3OKT A;  3SVW D;  3UVN A;  4A08 B;  3V7D B;  5FKQ A;  5TDH B;  4A0A A;  5B4W A;  3EU7 A;  4ESG A;  3I7K A;  2HJB A;  3V9F A;  4G56 B;  4A7J A;  1XIP A;  2Z2N A;  3MXX A;  2YNO A;  4GGA A;  3PE7 A;  4JXM A;  4CY1 A;  5H1M A;  4K3I D;  2B4E A;  2OK6 A;  3MZL A;  4CC9 A;  4ZN4 A;  2IWF A;  3RSE C;  1YFQ A;  1N6E A;  4JD2 C;  5HE3 B;  1TBG A;  3C5M A;  4GM3 A;  5EM2 A;  5FA5 B;  3KRW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...