3ORVD

Crystal structure of the y294h-maug/pre-methylamine dehydrogenase complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title Functional Importance of Tyrosine 294 and the Catalytic Selectivity for the Bis-Fe(IV) State of MauG Revealed by Replacement of This Axial Heme Ligand with Histidine .
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 99
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3orvD00
3IJ1A 4FA9D 2EBSA 1RI6A 4FB1D 5I5IA 4A08B 3MKSB 4J0XA 3KRXB 4GGAA 4L1QD 4R7AB 4FA4D 5TDHB 5I5MA 2H3XA 2G99A 1TBGA 5EAMA 2IAAA 5SXMA 4MK0B 1SQ9A 3DXMC 5EMMB 3GREA 5FKRA 4ZOZA 2AGZA 2CO0A 3ZWLB 4IA9A 1JMXB 3FM0A 4A0AB 4J87A 2Q7QA 1L0QA 3A0FA 4A0BB 4JT6C 3PXWD 1YFQA 3SCYA 1GG2B 4I79A 3L4OD 2XU7A 5FKSA 1Q47A 3UVKA 4CI3A 4GZ8A 5B4WA 3EI3A 4NSXA 2H13A 3PSLA 2CE9A 3AL9A 3UKUC 4E54A 2IWFA 4XYHA 3FRXA 3U4YA 3RN0D 5IGQA 3I7HA 3J81g 5EMJB 5CYKB 3MMYA 3UVOA 3J80g 3N0DA 4ERZA 2OJYA 2J56H 3HFQA 4GQ2P 2P9KC 2XL2A 1GP2B 4QRJA 3OW8A 4LGNA 4CZXA 4CI2A 4GM8A 4D6VA 3SHFA 1VYHC 4A2MA 1U2VC 3EI4B 2Z2NA 2J55H 4L3HD 2OK4A 4A08A 3JZGA 2YNPA 3AL8B 2AGXA 2BBKH 4J86A 4ESGA 2P9UC 4A7JA 3F3FA 5HYNB 1MG3A 3SWSD 3JZNA 2I0SA 2PM9B 5EMKB 4A0AA 2GC7A 3ORVD 2H6NA 4GQBB 1A0RB 2OIZA 2P9SC 3EG6A 3P4FA 3V7DB 5HE2B 2P9LC 3FGBA 1JOFA 1K32A 1B9XA 3OL2B 3EI2B 4H5JA 5THAA 3SVWD 5GMKn 1PGUA 2AGYA 5TEEA 4JSNC 3NVXA 3F3PA 4CI8A 1SQJA 3PSCB 3CIKB 2I0TA 2B5LA 2QC5A 4GM9A 5CYKA 3VH0A 4O1QD 5H14A 2AGLA 4A11B 2BCJB 4X63B 3OTTA 4QL1A 3I7LA 1FWXA 2HKRA 2IURA 3F3GA 5IJ7E 4PXWA 1N6FA 4PSXB 2PBIB 5EALA 4ZOYA 4ERYA 4X61B 3L4MD 2CN3A 1MG2A 1OLZA 3C5MA 3PVWB 3EI4A 5FXYA 5CXCA 4A09B 4FWWA 3K27A 3AL8A 5FA5B 3EI1B 2CN2A 2UZXB 4N14A 3MXXA 4TZ4A 3KRWB 2HYEA 3RSEC 3JPXA 4YVDA 2PM6B 4JSVC 3UKRC 4CY5A 4BL0A 4D0KA 3V9FA 4XYIA 4J73A 3RN1D 4L3GD 2PM9A 4GM3A 3BWSA 4FHLA 2YMUA 4CZVA 2GNQA 5JWZA 4O3UB 4CY1A 2AH1A 2OK6A 2IUVA 2OVRB 2AQ5A 4ZOXA 4FA1D 4PBZA 5EMLB 4ERQA 1XIPA 1QNIA 4K3JB 5K1CC 4J77A 3OL2A 5K19A 3UVMA 3EI2A 3SFZA 3JAMg 4FAND 5GXHA 3NVNA 2YNOA 4E5ZA 1MDAH 3I7KA 5I5JA 5FKTA 3SLED 3B7FA 1JJUB 3PXSD 2H9MA 4CC9A 1U4CA 3AH8B 4LG8A 3BG1A 5FLXg 2HESX 3IJ0A 1XKSA 4A11A 2CE8A 4CY3A 5HQGA 4EWRA 4J8GA 1PBYB 2CO0C 4PBYA 4UI9R 4L9OA 3W15A 4J78A 3MZKA 4J84A 3RLMD 3IIWA 3NVQA 3RMZD 2QXVA 3GFCA 4A2LA 1P22A 2XL3A 5CXBB 4A09A 4A0BA 3E0CA 5IJ8E 3DXKC 3EI1A 2HJBA 2TRCB 5AFU3 5KDOB 2H14A 5C9ZB 2Z2OA 4Y5RD 5A2Qg 2B5NA 2OVPB 4GGCA 2MTAH 5HE3B 5FKQA 3PE7A 3EWEA 4J81A 4OWRA 2O9KA 4X60B 3JROA 3I8EA 4ES0A 3DSMA 2Z2PA 3I2NA 1PEVA 4Y7RA 2W18A 3I7OA 5FQDA 2H6KA 1S4UX 5EM2B 4O45A 4J0WA 1GXRA 4XEIC 3ODTA 2P9PC 3SBPA 1NEXB 5H17A 4JSPC 4LG9A 2G9AA 4O3TB 1R5MA 5GSAA 4U7AA 3C99A 3SXTD 1K8KC 2H47A 4JD2C 2H68A 5HE0B 1TYQC 5IC7A 2XYIA 2YNNA 4BUJC 2B4EA 4J79A 2P9IC 3VGZA 3PVUB 3C75H 1SHYB 5HE1B 5GXIA 4K3ID 2HKMA 1N6DA 3I7PA 5C2VB 4X3EA 2H9PA 3SJLD 3DWLC 4OZUA 3I89A 2HXCA 3SBQA 2AGWA 5CXBA 2GC4A 3I7NA 3SMRA 4KFMB 3OKWA 3SBRA 4CZYA 2PM7B 2UZYB 3OKYB 3N0EA 2B5MA 4IMMA 2IUQA 3IKOA 2P9NC 5TEFA 3V5WB 5EARA 4JT5C 2IWKA 5EM2A 3CFSB 2H9NA 4ZOVA 4PSWB 1OMWB 2YBAA 4Z8LA 1ERJA 3JRPA 3SN6B 2J57G 4ZN4A 4O9DA 4G56B 3UVLA 3DM0A 3RFHA 1JMZB 4PC0A 3K26A 4GMBA 3IJCA 4FA5D 4GQ1A 3ULEC 3RRMC 3VA6A 5AMSA 5CXCB 3MZLA 1B9YA 2IUPA 4JSXC 3EMHA 2I0RA 2H9LA 3C9CA 1GOTB 5IGOA 3EI3B 1XHMA 3EU7A 3MKQA 2H6QA 2I3TA 4J82A 3PXTD 4H5IA 5H1MA 4FAVD 4E54B 1PI6A 3IIYA 4HDJA 5EAPA 1NR0A 5IT9g 2AH0A 2I3SA 2CNXA 4AEZA 3JB9L 3BG0A 3UVNA 3JZHA 4PNKB 1N6EA 3CFVA 4U1EI 5AJAA 5TF2A 4BH6A 2OVQB 3RFGA 4QT8A 4CI1A 2YB8B 3OKTA 4JXMA 3OKYA 4E5ZB 4CY2A 4GGDA 4QQEA 3I8CA 3AFCA 4J8BA 3UR4A 5C2WB 2HJ4A 4AOWA
chains in the Genus database with same CATH superfamily
3IJ1A 4FA9D 3IJEA 2EBSA 4MMYA 5E6SA 1RI6A 4FB1D 5I5IA 4A08B 3MKSB 4J0XA 3KRXB 4GGAA 4L1QD 1UOPA 1VZ3A 4R7AB 4FA4D 2HU7A 5TDHB 5I5MA 2H3XA 3IVMA 2G99A 3O4GA 1TBGA 5EAMA 2IAAA 5SXMA 4MK0B 1SQ9A 3DXMC 5EMMB 3GREA 4BP9A 5FKRA 4ZOZA 2AGZA 2CO0A 3ZWLB 4IA9A 1JMXB 3FM0A 3ZE0A 4A0AB 4J87A 2Q7QA 1L0QA 3A0FA 4A0BB 4JT6C 3PXWD 5E6RA 2QR5A 1YFQA 3SCYA 1GG2B 4I79A 3MUNA 3L4OD 2XU7A 1BPOA 1QFSA 5FKSA 1Q47A 3UVKA 4CI3A 4GZ8A 4UM8A 5B4WA 2VDMA 2VDLA 3EI3A 4NSXA 2VDRA 2H13A 1C9LA 3PSLA 2CE9A 3AL9A 3UKUC 1O6FA 4E54A 2IWFA 1JTDB 4XYHA 5FFGA 3FRXA 3U4YA 3RN0D 5IGQA 3I7HA 3DDUA 3J81g 4AN1A 5C92A 4Z7NA 3NIFA 5EMJB 4NENA 5CYKB 3MMYA 3UVOA 3J80g 3N0DA 4O2WA 2EICA 4ERZA 2OJYA 1H2WA 2J56H 3HFQA 4MMXA 3IUNA 4NAAA 4GQ2P 2P9KC 2XL2A 1GP2B 2XE4A 4QRJA 3OW8A 4LGNA 4CZXA 4CI2A 4BCBA 4GM8A 4D6VA 3K6SA 3SHFA 1GOGA 1VYHC 4A2MA 1U2VC 3EI4B 2Z2NA 2J55H 4L3HD 3ZDZA 2OK4A 4A08A 3JZGA 2YNPA 3AL8B 1VZ2A 2AGXA 2BBKH 4J86A 3ZDXA 4ESGA 3K72A 2P9UC 2EIDA 4A7JA 3F3FA 5HYNB 1MG3A 3SWSD 3JZNA 2I0SA 2PM9B 5EMKB 4A0AA 2GC7A 2H6NA 3ORVD 1K3IA 4GQBB 1UOOA 1A0RB 2OIZA 2P9SC 4AMZA 3EG6A 3P4FA 4IRZA 2XZGA 3V7DB 3ZE1A 5HE2B 2XDWA 2P9LC 3FGBA 2QZPA 1JOFA 1K32A 1B9XA 3OL2B 3EI2B 4H5JA 5THAA 3SVWD 5GMKn 1PGUA 2AGYA 1C9IA 5TEEA 5M5UA 4JSNC 1VE6A 3NVXA 3F3PA 4CI8A 1SQJA 4RE5A 3PSCB 3CIKB 2I0TA 2B5LA 2QC5A 4GM9A 5CYKA 3VH0A 4O1QD 5H14A 2AGLA 2EIBA 4NBMA 4A11B 2VDKA 2BCJB 4X63B 3OTTA 4QL1A 3I7LA 1FWXA 1L5GA 3NIGA 2HKRA 2IURA 3F3GA 5IJ7E 4PXWA 1N6FA 4PSXB 2PBIB 3EQ9A 5EALA 4ZOYA 4ERYA 4X61B 3L4MD 2CN3A 1H2XA 1MG2A 1OLZA 3O4JA 3T3PA 3C5MA 3PVWB 3EI4A 5FXYA 1A12A 5CXCA 4A09B 2WQ8A 4FWWA 3K27A 3O4HA 3AL8A 5FA5B 3EI1B 2CN2A 2UZXB 4N14A 3MXXA 4TZ4A 3KRWB 2HYEA 3RSEC 3JPXA 4YVDA 2PM6B 4JSVC 3UKRC 4CY5A 3QI0A 4BL0A 4D0KA 3V9FA 4XYIA 4J73A 3RN1D 4L3GD 2PM9A 4GM3A 3BWSA 4RE6A 4FHLA 2YMUA 4CZVA 2GNQA 5JWZA 3V4VA 4O3UB 4CY1A 2VDPA 2AH1A 2OK6A 3T3MA 2IUVA 2OVRB 2AQ5A 4ZOXA 4FA1D 2BKLA 4PBZA 5EMLB 4ERQA 3IUMA 1XIPA 1QNIA 4K3JB 5K1CC 3MUOA 4J77A 3KCIA 3OL2A 5K19A 3UVMA 3EI2A 3SFZA 3JAMg 4G55A 4AMYA 4FAND 4AX4A 5GXHA 3NVNA 2YNOA 4E5ZA 1MDAH 3I7KA 5I5JA 1E8MA 5FKTA 3SLED 3B7FA 3IUQA 1JJUB 3PXSD 2H9MA 4CC9A 1U4CA 3AH8B 4LG8A 3BG1A 5FLXg 2HESX 3IJ0A 1XKSA 4A11A 2CE8A 4CY3A 4JHNA 4DNUA 5HQGA 2EIEA 4EWRA 4Z7OA 4J8GA 4O02A 1PBYB 5M61A 2CO0C 4PBYA 1QFMA 4UI9R 4L9OA 3W15A 4J78A 3MZKA 4J84A 3RLMD 2VDQA 3IIWA 3NVQA 3NIDA 3RMZD 2QXVA 3ZE2A 3GFCA 4A2LA 4DNVA 5C86A 1P22A 2XL3A 5CXBB 4A09A 4A0BA 3OF7A 4AN0A 3E0CA 4BCDA 5IJ8E 3DXKC 5M5RA 4BP8A 3EI1A 2HU5A 2HJBA 2TRCB 5AFU3 5KDOB 2H14A 5C9ZB 3FCUA 2Z2OA 4Y5RD 5A2Qg 2B5NA 2OVPB 4GGCA 2MTAH 2VC2A 1GOFA 5HE3B 5FKQA 3PE7A 3V4PA 3EWEA 1GOHA 4J81A 2O9KA 4OWRA 3JROA 4X60B 3I8EA 4ES0A 3IUJA 3DSMA 2Z2PA 5M5SA 3I2NA 1PEVA 4Y7RA 2W18A 3I7OA 5FQDA 2H6KA 4QAMA 1S4UX 5EM2B 4O45A 4WK4A 4WK2A 4J0WA 1H2ZA 1GXRA 4XEIC 3ODTA 4G1MA 1E8NA 4Z7QA 2P9PC 3SBPA 1NEXB 5H17A 3IULA 4JSPC 4LG9A 2G9AA 4O3TB 1R5MA 1YR2A 5GSAA 4U7AA 3C99A 3SXTD 3K71A 1K8KC 2H47A 4JD2C 1JV2A 2H68A 5HE0B 1TYQC 1E5TA 4WJKA 5IC7A 3ZDYA 2XYIA 2YNNA 4BUJC 2B4EA 4J79A 2P9IC 3VGZA 3PVUB 3C75H 5FFOA 2HU8A 1SHYB 5HE1B 5GXIA 4K3ID 2HKMA 1N6DA 3I7PA 5C2VB 4X3EA 2H9PA 3SJLD 3DWLC 4OZUA 3I89A 4WK0A 2HXCA 3SBQA 2AGWA 5CXBA 2GC4A 2VDOA 3I7NA 3SMRA 4KFMB 3OKWA 3SBRA 4NC4A 4CZYA 5E6UA 2PM7B 1VE7A 3EQ7A 2UZYB 3OKYB 3N0EA 2B5MA 4MMZA 4IMMA 3O4IA 1UOQA 2IUQA 3IKOA 2P9NC 3QHYB 5TEFA 3V5WB 3MVDK 5EARA 4D9SA 4JT5C 2IWKA 5EM2A 3CFSB 2H9NA 4ZOVA 4PSWB 1OMWB 2YBAA 3VI4A 4Z8LA 4JHPC 1ERJA 1UTCA 3JRPA 5HDBA 5M5TA 3SN6B 1H2YA 2J57G 4ZN4A 4O9DA 4G56B 3UVLA 3DM0A 3RFHA 1JMZB 3FCSA 4PC0A 3K26A 4GMBA 3IJCA 1M1XA 4FA5D 4GQ1A 3ULEC 4L1MA 3RRMC 3VA6A 2VDNA 5AMSA 5CXCB 3GD1I 4UM9A 3MZLA 1B9YA 5M5VA 2JKXA 4G1EA 2IUPA 4JSXC 3EMHA 2I0RA 4BCCA 2H9LA 3C9CA 1GOTB 5IGOA 3EI3B 1XHMA 3EU7A 3MKQA 2H6QA 1I2MB 2I3TA 3EQ8A 4J82A 3PXTD 4H5IA 5H1MA 3IURA 4FAVD 4E54B 1PI6A 3IIYA 4HDJA 4DNWA 3GC3B 5EAPA 1NR0A 5IT9g 2AH0A 2I3SA 2CNXA 1TYEA 4AEZA 3BG0A 3JB9L 3UVNA 3JZHA 4PNKB 1T2XA 1N6EA 3CFVA 4U1EI 5AJAA 5TF2A 4BH6A 2OVQB 3RFGA 1U8CA 4QT8A 4CI1A 2YB8B 3OKTA 4JXMA 2VZ1A 3OKYA 4E5ZB 3VI3A 2VZ3A 4CY2A 4GGDA 4QQEA 3I8CA 3AFCA 4J8BA 3UR4A 5C2WB 1O6GA 2HJ4A 4AOWA
chains in the Genus database with same CATH topology
3IJ1A 4FA9D 2EBSA 1RI6A 4FB1D 5I5IA 4A08B 3MKSB 4J0XA 3KRXB 4GGAA 4L1QD 4R7AB 4FA4D 5TDHB 5I5MA 2H3XA 2G99A 1TBGA 5EAMA 2IAAA 5SXMA 4MK0B 1SQ9A 3DXMC 5EMMB 3GREA 5FKRA 4ZOZA 2AGZA 2CO0A 3ZWLB 4IA9A 1JMXB 3FM0A 4A0AB 4J87A 2Q7QA 1L0QA 3A0FA 4A0BB 4JT6C 3PXWD 1YFQA 3SCYA 1GG2B 4I79A 3L4OD 2XU7A 5FKSA 1Q47A 3UVKA 4CI3A 4GZ8A 5B4WA 3EI3A 4NSXA 2H13A 3PSLA 2CE9A 3AL9A 3UKUC 4E54A 2IWFA 4XYHA 3FRXA 3U4YA 3RN0D 5IGQA 3I7HA 3J81g 5EMJB 5CYKB 3MMYA 3UVOA 3J80g 3N0DA 4ERZA 2OJYA 2J56H 3HFQA 4GQ2P 2P9KC 2XL2A 1GP2B 4QRJA 3OW8A 4LGNA 4CZXA 4CI2A 4GM8A 4D6VA 3SHFA 1VYHC 4A2MA 1U2VC 3EI4B 2Z2NA 2J55H 4L3HD 2OK4A 4A08A 3JZGA 2YNPA 3AL8B 2AGXA 2BBKH 4J86A 4ESGA 2P9UC 4A7JA 3F3FA 5HYNB 1MG3A 3SWSD 3JZNA 2I0SA 2PM9B 5EMKB 4A0AA 2GC7A 3ORVD 2H6NA 4GQBB 1A0RB 2OIZA 2P9SC 3EG6A 3P4FA 3V7DB 5HE2B 2P9LC 3FGBA 1JOFA 1K32A 1B9XA 3OL2B 3EI2B 4H5JA 5THAA 3SVWD 5GMKn 1PGUA 2AGYA 5TEEA 4JSNC 3NVXA 3F3PA 4CI8A 1SQJA 3PSCB 3CIKB 2I0TA 2B5LA 2QC5A 4GM9A 5CYKA 3VH0A 4O1QD 5H14A 2AGLA 4A11B 2BCJB 4X63B 3OTTA 4QL1A 3I7LA 1FWXA 2HKRA 2IURA 3F3GA 5IJ7E 4PXWA 1N6FA 4PSXB 2PBIB 5EALA 4ZOYA 4ERYA 4X61B 3L4MD 2CN3A 1MG2A 1OLZA 3C5MA 3PVWB 3EI4A 5FXYA 5CXCA 4A09B 4FWWA 3K27A 3AL8A 5FA5B 3EI1B 2CN2A 2UZXB 4N14A 3MXXA 4TZ4A 3KRWB 2HYEA 3RSEC 3JPXA 4YVDA 2PM6B 4JSVC 3UKRC 4CY5A 4BL0A 4D0KA 3V9FA 4XYIA 4J73A 3RN1D 4L3GD 2PM9A 4GM3A 3BWSA 4FHLA 2YMUA 4CZVA 2GNQA 5JWZA 4O3UB 4CY1A 2AH1A 2OK6A 2IUVA 2OVRB 2AQ5A 4ZOXA 4FA1D 4PBZA 5EMLB 4ERQA 1XIPA 1QNIA 4K3JB 5K1CC 4J77A 3OL2A 5K19A 3UVMA 3EI2A 3SFZA 3JAMg 4FAND 5GXHA 3NVNA 2YNOA 4E5ZA 1MDAH 3I7KA 5I5JA 5FKTA 3SLED 3B7FA 1JJUB 3PXSD 2H9MA 4CC9A 1U4CA 3AH8B 4LG8A 3BG1A 5FLXg 2HESX 3IJ0A 1XKSA 4A11A 2CE8A 4CY3A 5HQGA 4EWRA 4J8GA 1PBYB 2CO0C 4PBYA 4UI9R 4L9OA 3W15A 4J78A 3MZKA 4J84A 3RLMD 3IIWA 3NVQA 3RMZD 2QXVA 3GFCA 4A2LA 1P22A 2XL3A 5CXBB 4A09A 4A0BA 3E0CA 5IJ8E 3DXKC 3EI1A 2HJBA 2TRCB 5AFU3 5KDOB 2H14A 5C9ZB 2Z2OA 4Y5RD 5A2Qg 2B5NA 2OVPB 4GGCA 2MTAH 5HE3B 5FKQA 3PE7A 3EWEA 4J81A 4OWRA 2O9KA 4X60B 3JROA 3I8EA 4ES0A 3DSMA 2Z2PA 3I2NA 1PEVA 4Y7RA 2W18A 3I7OA 5FQDA 2H6KA 1S4UX 5EM2B 4O45A 4J0WA 1GXRA 4XEIC 3ODTA 2P9PC 3SBPA 1NEXB 5H17A 4JSPC 4LG9A 2G9AA 4O3TB 1R5MA 5GSAA 4U7AA 3C99A 3SXTD 1K8KC 2H47A 4JD2C 2H68A 5HE0B 1TYQC 5IC7A 2XYIA 2YNNA 4BUJC 2B4EA 4J79A 2P9IC 3VGZA 3PVUB 3C75H 1SHYB 5HE1B 5GXIA 4K3ID 2HKMA 1N6DA 3I7PA 5C2VB 4X3EA 2H9PA 3SJLD 3DWLC 4OZUA 3I89A 2HXCA 3SBQA 2AGWA 5CXBA 2GC4A 3I7NA 3SMRA 4KFMB 3OKWA 3SBRA 4CZYA 2PM7B 2UZYB 3OKYB 3N0EA 2B5MA 4IMMA 2IUQA 3IKOA 2P9NC 5TEFA 3V5WB 5EARA 4JT5C 2IWKA 5EM2A 3CFSB 2H9NA 4ZOVA 4PSWB 1OMWB 2YBAA 4Z8LA 1ERJA 3JRPA 3SN6B 2J57G 4ZN4A 4O9DA 4G56B 3UVLA 3DM0A 3RFHA 1JMZB 4PC0A 3K26A 4GMBA 3IJCA 4FA5D 4GQ1A 3ULEC 3RRMC 3VA6A 5AMSA 5CXCB 3MZLA 1B9YA 2IUPA 4JSXC 3EMHA 2I0RA 2H9LA 3C9CA 1GOTB 5IGOA 3EI3B 1XHMA 3EU7A 3MKQA 2H6QA 2I3TA 4J82A 3PXTD 4H5IA 5H1MA 4FAVD 4E54B 1PI6A 3IIYA 4HDJA 5EAPA 1NR0A 5IT9g 2AH0A 2I3SA 2CNXA 4AEZA 3JB9L 3BG0A 3UVNA 3JZHA 4PNKB 1N6EA 3CFVA 4U1EI 5AJAA 5TF2A 4BH6A 2OVQB 3RFGA 4QT8A 4CI1A 2YB8B 3OKTA 4JXMA 3OKYA 4E5ZB 4CY2A 4GGDA 4QQEA 3I8CA 3AFCA 4J8BA 3UR4A 5C2WB 2HJ4A 4AOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ1 A;  4FA9 D;  2EBS A;  1RI6 A;  4FB1 D;  5I5I A;  4A08 B;  3MKS B;  4J0X A;  3KRX B;  4GGA A;  4L1Q D;  4R7A B;  4FA4 D;  5TDH B;  5I5M A;  2H3X A;  2G99 A;  1TBG A;  5EAM A;  2IAA A;  5SXM A;  4MK0 B;  1SQ9 A;  3DXM C;  5EMM B;  3GRE A;  5FKR A;  4ZOZ A;  2AGZ A;  2CO0 A;  3ZWL B;  4IA9 A;  1JMX B;  3FM0 A;  4A0A B;  4J87 A;  2Q7Q A;  1L0Q A;  3A0F A;  4A0B B;  4JT6 C;  3PXW D;  1YFQ A;  3SCY A;  1GG2 B;  4I79 A;  3L4O D;  2XU7 A;  5FKS A;  1Q47 A;  3UVK A;  4CI3 A;  4GZ8 A;  5B4W A;  3EI3 A;  4NSX A;  2H13 A;  3PSL A;  2CE9 A;  3AL9 A;  3UKU C;  4E54 A;  2IWF A;  4XYH A;  3FRX A;  3U4Y A;  3RN0 D;  5IGQ A;  3I7H A;  3J81 g;  5EMJ B;  5CYK B;  3MMY A;  3UVO A;  3J80 g;  3N0D A;  4ERZ A;  2OJY A;  2J56 H;  3HFQ A;  4GQ2 P;  2P9K C;  2XL2 A;  1GP2 B;  4QRJ A;  3OW8 A;  4LGN A;  4CZX A;  4CI2 A;  4GM8 A;  4D6V A;  3SHF A;  1VYH C;  4A2M A;  1U2V C;  3EI4 B;  2Z2N A;  2J55 H;  4L3H D;  2OK4 A;  4A08 A;  3JZG A;  2YNP A;  3AL8 B;  2AGX A;  2BBK H;  4J86 A;  4ESG A;  2P9U C;  4A7J A;  3F3F A;  5HYN B;  1MG3 A;  3SWS D;  3JZN A;  2I0S A;  2PM9 B;  5EMK B;  4A0A A;  2GC7 A;  3ORV D;  2H6N A;  4GQB B;  1A0R B;  2OIZ A;  2P9S C;  3EG6 A;  3P4F A;  3V7D B;  5HE2 B;  2P9L C;  3FGB A;  1JOF A;  1K32 A;  1B9X A;  3OL2 B;  3EI2 B;  4H5J A;  5THA A;  3SVW D;  5GMK n;  1PGU A;  2AGY A;  5TEE A;  4JSN C;  3NVX A;  3F3P A;  4CI8 A;  1SQJ A;  3PSC B;  3CIK B;  2I0T A;  2B5L A;  2QC5 A;  4GM9 A;  5CYK A;  3VH0 A;  4O1Q D;  5H14 A;  2AGL A;  4A11 B;  2BCJ B;  4X63 B;  3OTT A;  4QL1 A;  3I7L A;  1FWX A;  2HKR A;  2IUR A;  3F3G A;  5IJ7 E;  4PXW A;  1N6F A;  4PSX B;  2PBI B;  5EAL A;  4ZOY A;  4ERY A;  4X61 B;  3L4M D;  2CN3 A;  1MG2 A;  1OLZ A;  3C5M A;  3PVW B;  3EI4 A;  5FXY A;  5CXC A;  4A09 B;  4FWW A;  3K27 A;  3AL8 A;  5FA5 B;  3EI1 B;  2CN2 A;  2UZX B;  4N14 A;  3MXX A;  4TZ4 A;  3KRW B;  2HYE A;  3RSE C;  3JPX A;  4YVD A;  2PM6 B;  4JSV C;  3UKR C;  4CY5 A;  4BL0 A;  4D0K A;  3V9F A;  4XYI A;  4J73 A;  3RN1 D;  4L3G D;  2PM9 A;  4GM3 A;  3BWS A;  4FHL A;  2YMU A;  4CZV A;  2GNQ A;  5JWZ A;  4O3U B;  4CY1 A;  2AH1 A;  2OK6 A;  2IUV A;  2OVR B;  2AQ5 A;  4ZOX A;  4FA1 D;  4PBZ A;  5EML B;  4ERQ A;  1XIP A;  1QNI A;  4K3J B;  5K1C C;  4J77 A;  3OL2 A;  5K19 A;  3UVM A;  3EI2 A;  3SFZ A;  3JAM g;  4FAN D;  5GXH A;  3NVN A;  2YNO A;  4E5Z A;  1MDA H;  3I7K A;  5I5J A;  5FKT A;  3SLE D;  3B7F A;  1JJU B;  3PXS D;  2H9M A;  4CC9 A;  1U4C A;  3AH8 B;  4LG8 A;  3BG1 A;  5FLX g;  2HES X;  3IJ0 A;  1XKS A;  4A11 A;  2CE8 A;  4CY3 A;  5HQG A;  4EWR A;  4J8G A;  1PBY B;  2CO0 C;  4PBY A;  4UI9 R;  4L9O A;  3W15 A;  4J78 A;  3MZK A;  4J84 A;  3RLM D;  3IIW A;  3NVQ A;  3RMZ D;  2QXV A;  3GFC A;  4A2L A;  1P22 A;  2XL3 A;  5CXB B;  4A09 A;  4A0B A;  3E0C A;  5IJ8 E;  3DXK C;  3EI1 A;  2HJB A;  2TRC B;  5AFU 3;  5KDO B;  2H14 A;  5C9Z B;  2Z2O A;  4Y5R D;  5A2Q g;  2B5N A;  2OVP B;  4GGC A;  2MTA H;  5HE3 B;  5FKQ A;  3PE7 A;  3EWE A;  4J81 A;  4OWR A;  2O9K A;  4X60 B;  3JRO A;  3I8E A;  4ES0 A;  3DSM A;  2Z2P A;  3I2N A;  1PEV A;  4Y7R A;  2W18 A;  3I7O A;  5FQD A;  2H6K A;  1S4U X;  5EM2 B;  4O45 A;  4J0W A;  1GXR A;  4XEI C;  3ODT A;  2P9P C;  3SBP A;  1NEX B;  5H17 A;  4JSP C;  4LG9 A;  2G9A A;  4O3T B;  1R5M A;  5GSA A;  4U7A A;  3C99 A;  3SXT D;  1K8K C;  2H47 A;  4JD2 C;  2H68 A;  5HE0 B;  1TYQ C;  5IC7 A;  2XYI A;  2YNN A;  4BUJ C;  2B4E A;  4J79 A;  2P9I C;  3VGZ A;  3PVU B;  3C75 H;  1SHY B;  5HE1 B;  5GXI A;  4K3I D;  2HKM A;  1N6D A;  3I7P A;  5C2V B;  4X3E A;  2H9P A;  3SJL D;  3DWL C;  4OZU A;  3I89 A;  2HXC A;  3SBQ A;  2AGW A;  5CXB A;  2GC4 A;  3I7N A;  3SMR A;  4KFM B;  3OKW A;  3SBR A;  4CZY A;  2PM7 B;  2UZY B;  3OKY B;  3N0E A;  2B5M A;  4IMM A;  2IUQ A;  3IKO A;  2P9N C;  5TEF A;  3V5W B;  5EAR A;  4JT5 C;  2IWK A;  5EM2 A;  3CFS B;  2H9N A;  4ZOV A;  4PSW B;  1OMW B;  2YBA A;  4Z8L A;  1ERJ A;  3JRP A;  3SN6 B;  2J57 G;  4ZN4 A;  4O9D A;  4G56 B;  3UVL A;  3DM0 A;  3RFH A;  1JMZ B;  4PC0 A;  3K26 A;  4GMB A;  3IJC A;  4FA5 D;  4GQ1 A;  3ULE C;  3RRM C;  3VA6 A;  5AMS A;  5CXC B;  3MZL A;  1B9Y A;  2IUP A;  4JSX C;  3EMH A;  2I0R A;  2H9L A;  3C9C A;  1GOT B;  5IGO A;  3EI3 B;  1XHM A;  3EU7 A;  3MKQ A;  2H6Q A;  2I3T A;  4J82 A;  3PXT D;  4H5I A;  5H1M A;  4FAV D;  4E54 B;  1PI6 A;  3IIY A;  4HDJ A;  5EAP A;  1NR0 A;  5IT9 g;  2AH0 A;  2I3S A;  2CNX A;  4AEZ A;  3JB9 L;  3BG0 A;  3UVN A;  3JZH A;  4PNK B;  1N6E A;  3CFV A;  4U1E I;  5AJA A;  5TF2 A;  4BH6 A;  2OVQ B;  3RFG A;  4QT8 A;  4CI1 A;  2YB8 B;  3OKT A;  4JXM A;  3OKY A;  4E5Z B;  4CY2 A;  4GGD A;  4QQE A;  3I8C A;  3AFC A;  4J8B A;  3UR4 A;  5C2W B;  2HJ4 A;  4AOW A; 
#chains in the Genus database with same CATH topology
 3IJ1 A;  4FA9 D;  3IJE A;  2EBS A;  4MMY A;  5E6S A;  1RI6 A;  4FB1 D;  5I5I A;  4A08 B;  3MKS B;  4J0X A;  3KRX B;  4GGA A;  4L1Q D;  1UOP A;  1VZ3 A;  4R7A B;  4FA4 D;  2HU7 A;  5TDH B;  5I5M A;  2H3X A;  3IVM A;  2G99 A;  3O4G A;  1TBG A;  5EAM A;  2IAA A;  5SXM A;  4MK0 B;  1SQ9 A;  3DXM C;  5EMM B;  3GRE A;  4BP9 A;  5FKR A;  4ZOZ A;  2AGZ A;  2CO0 A;  3ZWL B;  4IA9 A;  1JMX B;  3FM0 A;  3ZE0 A;  4A0A B;  4J87 A;  2Q7Q A;  1L0Q A;  3A0F A;  4A0B B;  4JT6 C;  3PXW D;  5E6R A;  2QR5 A;  1YFQ A;  3SCY A;  1GG2 B;  4I79 A;  3MUN A;  3L4O D;  2XU7 A;  1BPO A;  1QFS A;  5FKS A;  1Q47 A;  3UVK A;  4CI3 A;  4GZ8 A;  4UM8 A;  5B4W A;  2VDM A;  2VDL A;  3EI3 A;  4NSX A;  2VDR A;  2H13 A;  1C9L A;  3PSL A;  2CE9 A;  3AL9 A;  3UKU C;  1O6F A;  4E54 A;  2IWF A;  1JTD B;  4XYH A;  5FFG A;  3FRX A;  3U4Y A;  3RN0 D;  5IGQ A;  3I7H A;  3DDU A;  3J81 g;  4AN1 A;  5C92 A;  4Z7N A;  3NIF A;  5EMJ B;  4NEN A;  5CYK B;  3MMY A;  3UVO A;  3J80 g;  3N0D A;  4O2W A;  2EIC A;  4ERZ A;  2OJY A;  1H2W A;  2J56 H;  3HFQ A;  4MMX A;  3IUN A;  4NAA A;  4GQ2 P;  2P9K C;  2XL2 A;  1GP2 B;  2XE4 A;  4QRJ A;  3OW8 A;  4LGN A;  4CZX A;  4CI2 A;  4BCB A;  4GM8 A;  4D6V A;  3K6S A;  3SHF A;  1GOG A;  1VYH C;  4A2M A;  1U2V C;  3EI4 B;  2Z2N A;  2J55 H;  4L3H D;  3ZDZ A;  2OK4 A;  4A08 A;  3JZG A;  2YNP A;  3AL8 B;  1VZ2 A;  2AGX A;  2BBK H;  4J86 A;  3ZDX A;  4ESG A;  3K72 A;  2P9U C;  2EID A;  4A7J A;  3F3F A;  5HYN B;  1MG3 A;  3SWS D;  3JZN A;  2I0S A;  2PM9 B;  5EMK B;  4A0A A;  2GC7 A;  2H6N A;  3ORV D;  1K3I A;  4GQB B;  1UOO A;  1A0R B;  2OIZ A;  2P9S C;  4AMZ A;  3EG6 A;  3P4F A;  4IRZ A;  2XZG A;  3V7D B;  3ZE1 A;  5HE2 B;  2XDW A;  2P9L C;  3FGB A;  2QZP A;  1JOF A;  1K32 A;  1B9X A;  3OL2 B;  3EI2 B;  4H5J A;  5THA A;  3SVW D;  5GMK n;  1PGU A;  2AGY A;  1C9I A;  5TEE A;  5M5U A;  4JSN C;  1VE6 A;  3NVX A;  3F3P A;  4CI8 A;  1SQJ A;  4RE5 A;  3PSC B;  3CIK B;  2I0T A;  2B5L A;  2QC5 A;  4GM9 A;  5CYK A;  3VH0 A;  4O1Q D;  5H14 A;  2AGL A;  2EIB A;  4NBM A;  4A11 B;  2VDK A;  2BCJ B;  4X63 B;  3OTT A;  4QL1 A;  3I7L A;  1FWX A;  1L5G A;  3NIG A;  2HKR A;  2IUR A;  3F3G A;  5IJ7 E;  4PXW A;  1N6F A;  4PSX B;  2PBI B;  3EQ9 A;  5EAL A;  4ZOY A;  4ERY A;  4X61 B;  3L4M D;  2CN3 A;  1H2X A;  1MG2 A;  1OLZ A;  3O4J A;  3T3P A;  3C5M A;  3PVW B;  3EI4 A;  5FXY A;  1A12 A;  5CXC A;  4A09 B;  2WQ8 A;  4FWW A;  3K27 A;  3O4H A;  3AL8 A;  5FA5 B;  3EI1 B;  2CN2 A;  2UZX B;  4N14 A;  3MXX A;  4TZ4 A;  3KRW B;  2HYE A;  3RSE C;  3JPX A;  4YVD A;  2PM6 B;  4JSV C;  3UKR C;  4CY5 A;  3QI0 A;  4BL0 A;  4D0K A;  3V9F A;  4XYI A;  4J73 A;  3RN1 D;  4L3G D;  2PM9 A;  4GM3 A;  3BWS A;  4RE6 A;  4FHL A;  2YMU A;  4CZV A;  2GNQ A;  5JWZ A;  3V4V A;  4O3U B;  4CY1 A;  2VDP A;  2AH1 A;  2OK6 A;  3T3M A;  2IUV A;  2OVR B;  2AQ5 A;  4ZOX A;  4FA1 D;  2BKL A;  4PBZ A;  5EML B;  4ERQ A;  3IUM A;  1XIP A;  1QNI A;  4K3J B;  5K1C C;  3MUO A;  4J77 A;  3KCI A;  3OL2 A;  5K19 A;  3UVM A;  3EI2 A;  3SFZ A;  3JAM g;  4G55 A;  4AMY A;  4FAN D;  4AX4 A;  5GXH A;  3NVN A;  2YNO A;  4E5Z A;  1MDA H;  3I7K A;  5I5J A;  1E8M A;  5FKT A;  3SLE D;  3B7F A;  3IUQ A;  1JJU B;  3PXS D;  2H9M A;  4CC9 A;  1U4C A;  3AH8 B;  4LG8 A;  3BG1 A;  5FLX g;  2HES X;  3IJ0 A;  1XKS A;  4A11 A;  2CE8 A;  4CY3 A;  4JHN A;  4DNU A;  5HQG A;  2EIE A;  4EWR A;  4Z7O A;  4J8G A;  4O02 A;  1PBY B;  5M61 A;  2CO0 C;  4PBY A;  1QFM A;  4UI9 R;  4L9O A;  3W15 A;  4J78 A;  3MZK A;  4J84 A;  3RLM D;  2VDQ A;  3IIW A;  3NVQ A;  3NID A;  3RMZ D;  2QXV A;  3ZE2 A;  3GFC A;  4A2L A;  4DNV A;  5C86 A;  1P22 A;  2XL3 A;  5CXB B;  4A09 A;  4A0B A;  3OF7 A;  4AN0 A;  3E0C A;  4BCD A;  5IJ8 E;  3DXK C;  5M5R A;  4BP8 A;  3EI1 A;  2HU5 A;  2HJB A;  2TRC B;  5AFU 3;  5KDO B;  2H14 A;  5C9Z B;  3FCU A;  2Z2O A;  4Y5R D;  5A2Q g;  2B5N A;  2OVP B;  4GGC A;  2MTA H;  2VC2 A;  1GOF A;  5HE3 B;  5FKQ A;  3PE7 A;  3V4P A;  3EWE A;  1GOH A;  4J81 A;  2O9K A;  4OWR A;  3JRO A;  4X60 B;  3I8E A;  4ES0 A;  3IUJ A;  3DSM A;  2Z2P A;  5M5S A;  3I2N A;  1PEV A;  4Y7R A;  2W18 A;  3I7O A;  5FQD A;  2H6K A;  4QAM A;  1S4U X;  5EM2 B;  4O45 A;  4WK4 A;  4WK2 A;  4J0W A;  1H2Z A;  1GXR A;  4XEI C;  3ODT A;  4G1M A;  1E8N A;  4Z7Q A;  2P9P C;  3SBP A;  1NEX B;  5H17 A;  3IUL A;  4JSP C;  4LG9 A;  2G9A A;  4O3T B;  1R5M A;  1YR2 A;  5GSA A;  4U7A A;  3C99 A;  3SXT D;  3K71 A;  1K8K C;  2H47 A;  4JD2 C;  1JV2 A;  2H68 A;  5HE0 B;  1TYQ C;  1E5T A;  4WJK A;  5IC7 A;  3ZDY A;  2XYI A;  2YNN A;  4BUJ C;  2B4E A;  4J79 A;  2P9I C;  3VGZ A;  3PVU B;  3C75 H;  5FFO A;  2HU8 A;  1SHY B;  5HE1 B;  5GXI A;  4K3I D;  2HKM A;  1N6D A;  3I7P A;  5C2V B;  4X3E A;  2H9P A;  3SJL D;  3DWL C;  4OZU A;  3I89 A;  4WK0 A;  2HXC A;  3SBQ A;  2AGW A;  5CXB A;  2GC4 A;  2VDO A;  3I7N A;  3SMR A;  4KFM B;  3OKW A;  3SBR A;  4NC4 A;  4CZY A;  5E6U A;  2PM7 B;  1VE7 A;  3EQ7 A;  2UZY B;  3OKY B;  3N0E A;  2B5M A;  4MMZ A;  4IMM A;  3O4I A;  1UOQ A;  2IUQ A;  3IKO A;  2P9N C;  3QHY B;  5TEF A;  3V5W B;  3MVD K;  5EAR A;  4D9S A;  4JT5 C;  2IWK A;  5EM2 A;  3CFS B;  2H9N A;  4ZOV A;  4PSW B;  1OMW B;  2YBA A;  3VI4 A;  4Z8L A;  4JHP C;  1ERJ A;  1UTC A;  3JRP A;  5HDB A;  5M5T A;  3SN6 B;  1H2Y A;  2J57 G;  4ZN4 A;  4O9D A;  4G56 B;  3UVL A;  3DM0 A;  3RFH A;  1JMZ B;  3FCS A;  4PC0 A;  3K26 A;  4GMB A;  3IJC A;  1M1X A;  4FA5 D;  4GQ1 A;  3ULE C;  4L1M A;  3RRM C;  3VA6 A;  2VDN A;  5AMS A;  5CXC B;  3GD1 I;  4UM9 A;  3MZL A;  1B9Y A;  5M5V A;  2JKX A;  4G1E A;  2IUP A;  4JSX C;  3EMH A;  2I0R A;  4BCC A;  2H9L A;  3C9C A;  1GOT B;  5IGO A;  3EI3 B;  1XHM A;  3EU7 A;  3MKQ A;  2H6Q A;  1I2M B;  2I3T A;  3EQ8 A;  4J82 A;  3PXT D;  4H5I A;  5H1M A;  3IUR A;  4FAV D;  4E54 B;  1PI6 A;  3IIY A;  4HDJ A;  4DNW A;  3GC3 B;  5EAP A;  1NR0 A;  5IT9 g;  2AH0 A;  2I3S A;  2CNX A;  1TYE A;  4AEZ A;  3BG0 A;  3JB9 L;  3UVN A;  3JZH A;  4PNK B;  1T2X A;  1N6E A;  3CFV A;  4U1E I;  5AJA A;  5TF2 A;  4BH6 A;  2OVQ B;  3RFG A;  1U8C A;  4QT8 A;  4CI1 A;  2YB8 B;  3OKT A;  4JXM A;  2VZ1 A;  3OKY A;  4E5Z B;  3VI3 A;  2VZ3 A;  4CY2 A;  4GGD A;  4QQE A;  3I8C A;  3AFC A;  4J8B A;  3UR4 A;  5C2W B;  1O6G A;  2HJ4 A;  4AOW A; 
#chains in the Genus database with same CATH homology
 3IJ1 A;  4FA9 D;  2EBS A;  1RI6 A;  4FB1 D;  5I5I A;  4A08 B;  3MKS B;  4J0X A;  3KRX B;  4GGA A;  4L1Q D;  4R7A B;  4FA4 D;  5TDH B;  5I5M A;  2H3X A;  2G99 A;  1TBG A;  5EAM A;  2IAA A;  5SXM A;  4MK0 B;  1SQ9 A;  3DXM C;  5EMM B;  3GRE A;  5FKR A;  4ZOZ A;  2AGZ A;  2CO0 A;  3ZWL B;  4IA9 A;  1JMX B;  3FM0 A;  4A0A B;  4J87 A;  2Q7Q A;  1L0Q A;  3A0F A;  4A0B B;  4JT6 C;  3PXW D;  1YFQ A;  3SCY A;  1GG2 B;  4I79 A;  3L4O D;  2XU7 A;  5FKS A;  1Q47 A;  3UVK A;  4CI3 A;  4GZ8 A;  5B4W A;  3EI3 A;  4NSX A;  2H13 A;  3PSL A;  2CE9 A;  3AL9 A;  3UKU C;  4E54 A;  2IWF A;  4XYH A;  3FRX A;  3U4Y A;  3RN0 D;  5IGQ A;  3I7H A;  3J81 g;  5EMJ B;  5CYK B;  3MMY A;  3UVO A;  3J80 g;  3N0D A;  4ERZ A;  2OJY A;  2J56 H;  3HFQ A;  4GQ2 P;  2P9K C;  2XL2 A;  1GP2 B;  4QRJ A;  3OW8 A;  4LGN A;  4CZX A;  4CI2 A;  4GM8 A;  4D6V A;  3SHF A;  1VYH C;  4A2M A;  1U2V C;  3EI4 B;  2Z2N A;  2J55 H;  4L3H D;  2OK4 A;  4A08 A;  3JZG A;  2YNP A;  3AL8 B;  2AGX A;  2BBK H;  4J86 A;  4ESG A;  2P9U C;  4A7J A;  3F3F A;  5HYN B;  1MG3 A;  3SWS D;  3JZN A;  2I0S A;  2PM9 B;  5EMK B;  4A0A A;  2GC7 A;  3ORV D;  2H6N A;  4GQB B;  1A0R B;  2OIZ A;  2P9S C;  3EG6 A;  3P4F A;  3V7D B;  5HE2 B;  2P9L C;  3FGB A;  1JOF A;  1K32 A;  1B9X A;  3OL2 B;  3EI2 B;  4H5J A;  5THA A;  3SVW D;  5GMK n;  1PGU A;  2AGY A;  5TEE A;  4JSN C;  3NVX A;  3F3P A;  4CI8 A;  1SQJ A;  3PSC B;  3CIK B;  2I0T A;  2B5L A;  2QC5 A;  4GM9 A;  5CYK A;  3VH0 A;  4O1Q D;  5H14 A;  2AGL A;  4A11 B;  2BCJ B;  4X63 B;  3OTT A;  4QL1 A;  3I7L A;  1FWX A;  2HKR A;  2IUR A;  3F3G A;  5IJ7 E;  4PXW A;  1N6F A;  4PSX B;  2PBI B;  5EAL A;  4ZOY A;  4ERY A;  4X61 B;  3L4M D;  2CN3 A;  1MG2 A;  1OLZ A;  3C5M A;  3PVW B;  3EI4 A;  5FXY A;  5CXC A;  4A09 B;  4FWW A;  3K27 A;  3AL8 A;  5FA5 B;  3EI1 B;  2CN2 A;  2UZX B;  4N14 A;  3MXX A;  4TZ4 A;  3KRW B;  2HYE A;  3RSE C;  3JPX A;  4YVD A;  2PM6 B;  4JSV C;  3UKR C;  4CY5 A;  4BL0 A;  4D0K A;  3V9F A;  4XYI A;  4J73 A;  3RN1 D;  4L3G D;  2PM9 A;  4GM3 A;  3BWS A;  4FHL A;  2YMU A;  4CZV A;  2GNQ A;  5JWZ A;  4O3U B;  4CY1 A;  2AH1 A;  2OK6 A;  2IUV A;  2OVR B;  2AQ5 A;  4ZOX A;  4FA1 D;  4PBZ A;  5EML B;  4ERQ A;  1XIP A;  1QNI A;  4K3J B;  5K1C C;  4J77 A;  3OL2 A;  5K19 A;  3UVM A;  3EI2 A;  3SFZ A;  3JAM g;  4FAN D;  5GXH A;  3NVN A;  2YNO A;  4E5Z A;  1MDA H;  3I7K A;  5I5J A;  5FKT A;  3SLE D;  3B7F A;  1JJU B;  3PXS D;  2H9M A;  4CC9 A;  1U4C A;  3AH8 B;  4LG8 A;  3BG1 A;  5FLX g;  2HES X;  3IJ0 A;  1XKS A;  4A11 A;  2CE8 A;  4CY3 A;  5HQG A;  4EWR A;  4J8G A;  1PBY B;  2CO0 C;  4PBY A;  4UI9 R;  4L9O A;  3W15 A;  4J78 A;  3MZK A;  4J84 A;  3RLM D;  3IIW A;  3NVQ A;  3RMZ D;  2QXV A;  3GFC A;  4A2L A;  1P22 A;  2XL3 A;  5CXB B;  4A09 A;  4A0B A;  3E0C A;  5IJ8 E;  3DXK C;  3EI1 A;  2HJB A;  2TRC B;  5AFU 3;  5KDO B;  2H14 A;  5C9Z B;  2Z2O A;  4Y5R D;  5A2Q g;  2B5N A;  2OVP B;  4GGC A;  2MTA H;  5HE3 B;  5FKQ A;  3PE7 A;  3EWE A;  4J81 A;  4OWR A;  2O9K A;  4X60 B;  3JRO A;  3I8E A;  4ES0 A;  3DSM A;  2Z2P A;  3I2N A;  1PEV A;  4Y7R A;  2W18 A;  3I7O A;  5FQD A;  2H6K A;  1S4U X;  5EM2 B;  4O45 A;  4J0W A;  1GXR A;  4XEI C;  3ODT A;  2P9P C;  3SBP A;  1NEX B;  5H17 A;  4JSP C;  4LG9 A;  2G9A A;  4O3T B;  1R5M A;  5GSA A;  4U7A A;  3C99 A;  3SXT D;  1K8K C;  2H47 A;  4JD2 C;  2H68 A;  5HE0 B;  1TYQ C;  5IC7 A;  2XYI A;  2YNN A;  4BUJ C;  2B4E A;  4J79 A;  2P9I C;  3VGZ A;  3PVU B;  3C75 H;  1SHY B;  5HE1 B;  5GXI A;  4K3I D;  2HKM A;  1N6D A;  3I7P A;  5C2V B;  4X3E A;  2H9P A;  3SJL D;  3DWL C;  4OZU A;  3I89 A;  2HXC A;  3SBQ A;  2AGW A;  5CXB A;  2GC4 A;  3I7N A;  3SMR A;  4KFM B;  3OKW A;  3SBR A;  4CZY A;  2PM7 B;  2UZY B;  3OKY B;  3N0E A;  2B5M A;  4IMM A;  2IUQ A;  3IKO A;  2P9N C;  5TEF A;  3V5W B;  5EAR A;  4JT5 C;  2IWK A;  5EM2 A;  3CFS B;  2H9N A;  4ZOV A;  4PSW B;  1OMW B;  2YBA A;  4Z8L A;  1ERJ A;  3JRP A;  3SN6 B;  2J57 G;  4ZN4 A;  4O9D A;  4G56 B;  3UVL A;  3DM0 A;  3RFH A;  1JMZ B;  4PC0 A;  3K26 A;  4GMB A;  3IJC A;  4FA5 D;  4GQ1 A;  3ULE C;  3RRM C;  3VA6 A;  5AMS A;  5CXC B;  3MZL A;  1B9Y A;  2IUP A;  4JSX C;  3EMH A;  2I0R A;  2H9L A;  3C9C A;  1GOT B;  5IGO A;  3EI3 B;  1XHM A;  3EU7 A;  3MKQ A;  2H6Q A;  2I3T A;  4J82 A;  3PXT D;  4H5I A;  5H1M A;  4FAV D;  4E54 B;  1PI6 A;  3IIY A;  4HDJ A;  5EAP A;  1NR0 A;  5IT9 g;  2AH0 A;  2I3S A;  2CNX A;  4AEZ A;  3JB9 L;  3BG0 A;  3UVN A;  3JZH A;  4PNK B;  1N6E A;  3CFV A;  4U1E I;  5AJA A;  5TF2 A;  4BH6 A;  2OVQ B;  3RFG A;  4QT8 A;  4CI1 A;  2YB8 B;  3OKT A;  4JXM A;  3OKY A;  4E5Z B;  4CY2 A;  4GGD A;  4QQE A;  3I8C A;  3AFC A;  4J8B A;  3UR4 A;  5C2W B;  2HJ4 A;  4AOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...