3FRXA

Crystal structure of the yeast orthologue of rack1, asc1.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
315
structure length
309
Chain Sequence
NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Direct link between RACK1 function and localization at the ribosome in vivo
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 309
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3frxA01
3DSMA 2YNPA 3MMYA 2H14A 3IJCA 2AGXA 5IJ7E 3SWSD 2OVPB 4JD2C 3ZWLB 3L4OD 3RN1D 2CO0A 3N0DA 1U2VC 3VGZA 3OW8A 2UZXB 4JXMA 4ZOZA 4Z8LA 3EI3A 2P9IC 2OIZA 2IUPA 4E54B 4CI3A 4ZOVA 3GREA 2IUVA 1R5MA 4GQBB 4A0AB 2H9LA 2W18A 3EG6A 4L9OA 2EBSA 5GMKn 2Z2OA 4GM9A 4ERZA 1JJUB 2I0RA 4EWRA 3CFSB 3SHFA 1SQJA 5HE3B 4J86A 3AFCA 4GGCA 1OLZA 4CZYA 1GP2B 5I5JA 2QXVA 4XYHA 3EI4A 1P22A 3BWSA 2MTAH 5CXBA 2B5NA 3VH0A 2H47A 2Z2PA 4CY3A 3E0CA 3U4YA 2GNQA 4A0AA 5EMMB 5TEEA 4JSVC 3J81g 2YMUA 2CE8A 4O3TB 4Y5RD 4AEZA 5TEFA 5EMJB 4U7AA 1TYQC 2CN3A 5GXHA 4NSXA 4E5ZB 1PBYB 3SBQA 4LG9A 4CI2A 2HESX 1SQ9A 3HFQA 2H9MA 4GMBA 4XEIC 1N6EA 2YB8B 3L4MD 2H9PA 1MDAH 4A7JA 3OKTA 1PGUA 5FKTA 3UVMA 1GXRA 1YFQA 2H6QA 1N6DA 4JSNC 4OZUA 1PI6A 3SFZA 3EI2A 4ERYA 5I5MA 2HXCA 3VA6A 3NVQA 3SBRA 3FGBA 4J82A 5GXIA 3RFHA 2PBIB 4BH6A 4A2LA 4JT6C 5HE2B 2CNXA 2TRCB 5FQDA 3F3PA 3K26A 3C5MA 5I5IA 4QT8A 3RLMD 3SMRA 1NR0A 5SXMA 5FLXg 3DWLC 5K1CC 3I7OA 5IT9g 4J8GA 5EMKB 2J55H 4J78A 5JWZA 3RRMC 4QRJA 2OK6A 4A11B 1MG3A 3A0FA 4CZXA 5IJ8E 2I0SA 2B5MA 5THAA 4CZVA 3F3FA 2OVRB 1ERJA 1K32A 1QNIA 2Q7QA 3RN0D 2B5LA 4J87A 4JSXC 4QL1A 5FKRA 4H5IA 3MKSB 3EI4B 4FA9D 2O9KA 3KRXB 2PM9B 3PSCB 3J80g 4JT5C 5CXBB 5EARA 2I3TA 5CYKA 3JAMg 3I2NA 2P9PC 3MXXA 3JRPA 4BL0A 5KDOB 3V5WB 2AGYA 4A11A 3NVXA 4I79A 4PC0A 2UZYB 4J84A 3N0EA 5TF2A 5H17A 3JZNA 3JB9L 2P9UC 4J77A 3I8EA 3I89A 2OK4A 3K27A 4PXWA 2H6KA 5CXCB 2HJBA 3SXTD 3V7DB 2PM9A 4FHLA 3W15A 4J81A 1OMWB 2J57G 3SBPA 2CO0C 5H14A 2GC4A 4CI8A 1XKSA 3DM0A 3EI2B 2IWFA 5HYNB 3GFCA 2Z2NA 2BCJB 1JMXB 5EAMA 2XL2A 4Y7RA 4UI9R 5A2Qg 4J79A 3SCYA 4AOWA 4O9DA 4CC9A 1JMZB 5CXCA 3I8CA 4BUJC 3PXTD 2XU7A 3AH8B 5EALA 1NEXB 4N14A 4IA9A 3F3GA 4MK0B 3RSEC 4GM3A 3EI1A 2H68A 5FKSA 5HQGA 3BG0A 3SN6B 2G99A 4L1QD 3I7HA 4PNKB 2CN2A 4A2MA 4GZ8A 4X63B 5HE1B 3ODTA 5AMSA 2AGZA 4CI1A 4FB1D 5TDHB 1B9YA 2AGWA 3IJ0A 4O3UB 5K19A 3FM0A 4U1EI 4FWWA 5CYKB 2IURA 5GSAA 1S4UX 1FWXA 5IGOA 4A08B 5AFU3 2XYIA 2AQ5A 4PBYA 1TBGA 1L0QA 5H1MA 3JPXA 2PM6B 5C2WB 2PM7B 4FAND 5IGQA 1GOTB 2IAAA 2B4EA 3AL9A 4A09A 3MZLA 3I7PA 3C99A 4K3JB 4J0WA 4J8BA 3UVLA 3PVUB 3EWEA 2YNOA 2CE9A 2XL3A 3BG1A 3OKYA 5FA5B 4A08A 4FA5D 2P9SC 1B9XA 4J73A 5B4WA 4ZOXA 4PSXB 3MZKA 3MKQA 1U4CA 3OKWA 5EAPA 1RI6A 4ZN4A 3AL8B 3KRWB 3SVWD 4PSWB 5FKQA 2IWKA 3NVNA 1SHYB 3OL2A 4H5JA 5FXYA 4IMMA 4A0BB 4D6VA 5C2VB 2BBKH 2HJ4A 2H13A 2HYEA 4L3GD 2J56H 3DXKC 3EU7A 2P9LC 2G9AA 3PVWB 4ZOYA 5EM2B 4L3HD 4QQEA 3UKUC 4D0KA 3EI1B 2OJYA 2GC7A 1XIPA 2P9KC 3IJ1A 2AH0A 3AL8A 4K3ID 4E54A 3CFVA 5EMLB 1A0RB 4GGAA 3I7NA 3CIKB 2I0TA 3IIWA 4FAVD 3C9CA 4CY5A 4TZ4A 5HE0B 4G56B 3UVOA 2HKRA 1JOFA 4X3EA 3JZGA 4CY2A 4A0BA 3PE7A 4R7AB 4X60B 3V9FA 2YBAA 3IKOA 4CY1A 2H6NA 4XYIA 2OVQB 3P4FA 3UKRC 3DXMC 3I7KA 2AH1A 5EM2A 5AJAA 1VYHC 3PXSD 4GQ1A 5C9ZB 4HDJA 3FRXA 4FA1D 4J0XA 3EMHA 2I3SA 4GGDA 1MG2A 4JSPC 1GG2B 4ESGA 4O1QD 4PBZA 4LGNA 3OTTA 3ULEC 4YVDA 4ERQA 3UR4A 4A09B 1K8KC 4GM8A 2P9NC 3JZHA 3UVNA 3PXWD 4KFMB 1Q47A 3C75H 3OKYB 2AGLA 4O45A 1XHMA 4X61B 4OWRA 3IIYA 2H9NA 4E5ZA 1PEVA 5IC7A 3UVKA 3B7FA 4ES0A 2HKMA 1N6FA 3EI3B 3RFGA 3RMZD 4LG8A 3PSLA 2QC5A 3SJLD 3SLED 2YNNA 2IUQA 3ORVD 3OL2B 2H3XA 3I7LA 3JROA 4GQ2P 4FA4D
chains in the Genus database with same CATH superfamily
3DSMA 2VDMA 2YNPA 4BCBA 3MMYA 2H14A 3IJCA 2AGXA 5IJ7E 3SWSD 4AX4A 1A12A 3IUNA 2OVPB 4JD2C 3ZWLB 3L4OD 3RN1D 2CO0A 3N0DA 1U2VC 3VGZA 3OW8A 2UZXB 4JXMA 4ZOZA 4Z8LA 3EI3A 2P9IC 2OIZA 2IUPA 4E54B 2WQ8A 4CI3A 4ZOVA 3MUOA 3GREA 3ZDZA 1H2YA 4G1EA 2XE4A 2IUVA 1R5MA 4GQBB 4WK0A 4A0AB 2H9LA 2W18A 3EG6A 4L9OA 2EBSA 5GMKn 2Z2OA 4GM9A 5C86A 4ERZA 1JJUB 1UTCA 2I0RA 4EWRA 4WK4A 3CFSB 3SHFA 1SQJA 5HE3B 3QHYB 4J86A 3AFCA 4GGCA 1OLZA 4CZYA 1GP2B 5I5JA 2QXVA 4XYHA 3EI4A 4MMYA 1P22A 3BWSA 1C9IA 1H2XA 2MTAH 5CXBA 2B5NA 3VH0A 5HDBA 2H47A 2Z2PA 4CY3A 3E0CA 3IUMA 3U4YA 1E5TA 1UOPA 2GNQA 4A0AA 3T3PA 5EMMB 3IUQA 4JSVC 5TEEA 3J81g 4G1MA 2YMUA 2CE8A 4O3TB 4Y5RD 3IVMA 4AEZA 5TEFA 5EMJB 3ZE2A 4BP8A 4U7AA 1YR2A 3NIGA 1TYQC 2CN3A 5GXHA 4NSXA 3EQ8A 4E5ZB 3O4JA 1PBYB 3SBQA 1E8NA 4LG9A 4CI2A 2HESX 1SQ9A 3HFQA 2H9MA 4GMBA 4QAMA 4XEIC 1U8CA 3FCSA 1N6EA 2YB8B 3L4MD 2H9PA 4NENA 1MDAH 4A7JA 3OKTA 1PGUA 2EIBA 5FKTA 3UVMA 1GXRA 4IRZA 1YFQA 3OF7A 2H6QA 1N6DA 4JSNC 4OZUA 1PI6A 3SFZA 3EI2A 4ERYA 5I5MA 2HXCA 3VA6A 1C9LA 3NVQA 2VDQA 3FGBA 3SBRA 4J82A 5GXIA 3RFHA 2EIEA 2PBIB 4BH6A 2BKLA 4NBMA 4A2LA 4JT6C 5HE2B 1UOOA 2CNXA 2TRCB 5FQDA 5M5UA 3F3PA 3K26A 3C5MA 5I5IA 4QT8A 3RLMD 3EQ9A 3SMRA 1NR0A 5SXMA 5FLXg 3DWLC 3K71A 5K1CC 3I7OA 5IT9g 4J8GA 5EMKB 2J55H 4J78A 5JWZA 3RRMC 4QRJA 2OK6A 4A11B 1VZ2A 1MG3A 3A0FA 4CZXA 5IJ8E 2I0SA 2B5MA 5THAA 3ZE1A 3F3FA 4CZVA 2OVRB 1ERJA 1K32A 1QNIA 2Q7QA 3RN0D 2B5LA 4J87A 4JSXC 4QL1A 4UM8A 5FKRA 4DNUA 4H5IA 3MKSB 4BCDA 3EI4B 4FA9D 2O9KA 5M5RA 3KRXB 2PM9B 3NIDA 3PSCB 3J80g 4JT5C 5CXBB 5M5SA 5EARA 2I3TA 5CYKA 3JAMg 3I2NA 2P9PC 3MXXA 3JRPA 4BL0A 1E8MA 3IJEA 5KDOB 2VDPA 3V5WB 2AGYA 4A11A 3NVXA 4I79A 4PC0A 2UZYB 4J84A 5M5VA 3N0EA 1BPOA 5H17A 5TF2A 4AMYA 3JZNA 3JB9L 2P9UC 4J77A 3I8EA 4Z7OA 3I89A 2OK4A 4G55A 3K27A 4PXWA 2H6KA 5CXCB 2HJBA 1O6FA 3IURA 3SXTD 3V7DB 2PM9A 4FHLA 3W15A 4J81A 1OMWB 2J57G 3SBPA 2CO0C 4RE5A 5H14A 3O4GA 2GC4A 4Z7NA 4CI8A 1XKSA 3DM0A 1K3IA 5E6UA 3EI2B 2IWFA 5HYNB 3GFCA 2Z2NA 2BCJB 1JMXB 5EAMA 2XL2A 1H2ZA 4O02A 1VE6A 4Y7RA 4UI9R 2XDWA 5A2Qg 3NIFA 4J79A 1M1XA 3SCYA 4AOWA 2VZ3A 4O9DA 2EIDA 4CC9A 1JMZB 5CXCA 3FCUA 3I8CA 4BUJC 3PXTD 2XU7A 1JV2A 3AH8B 5EALA 1NEXB 1VE7A 4N14A 3K6SA 3V4PA 4IA9A 3F3GA 4MK0B 3RSEC 4GM3A 3ZDYA 1O6GA 3EI1A 2H68A 5FKSA 5HQGA 3BG0A 3SN6B 2G99A 4L1QD 3I7HA 4PNKB 4NC4A 2CN2A 4A2MA 4GZ8A 4X63B 5HE1B 3ODTA 5AMSA 2AGZA 4CI1A 4FB1D 5TDHB 1B9YA 1L5GA 2AGWA 4JHNA 3IJ0A 4O3UB 5K19A 3FM0A 3GD1I 1QFMA 1QFSA 3DDUA 4U1EI 4FWWA 5CYKB 2IURA 5GSAA 1S4UX 1FWXA 3MUNA 1GOFA 5IGOA 4A08B 5AFU3 2XYIA 2AQ5A 1TYEA 4PBYA 1TBGA 1L0QA 1UOQA 5H1MA 3JPXA 2PM6B 4MMXA 5C2WB 2PM7B 5E6RA 4Z7QA 4FAND 5IGQA 1GOTB 2IAAA 2B4EA 3ZE0A 3AL9A 4A09A 3MZLA 3I7PA 3C99A 1I2MB 4K3JB 4J0WA 2VDOA 4J8BA 3UVLA 3PVUB 4AMZA 3EWEA 4WJKA 2YNOA 4AN0A 2CE9A 2XL3A 3BG1A 3OKYA 5FA5B 4AN1A 3QI0A 4A08A 4MMZA 5M61A 4BCCA 2P9SC 1B9XA 4FA5D 4J73A 5B4WA 4ZOXA 4PSXB 5E6SA 3MZKA 2HU5A 3MKQA 1U4CA 3OKWA 5EAPA 1RI6A 4ZN4A 3AL8B 1GOGA 3KRWB 3SVWD 4PSWB 2VDRA 5FKQA 3IUJA 2IWKA 3NVNA 1SHYB 3OL2A 4H5JA 2QZPA 5FXYA 4IMMA 4A0BB 4D6VA 5FFOA 5C2VB 2BBKH 1GOHA 2HJ4A 3O4HA 2H13A 2JKXA 2HYEA 4L3GD 2J56H 3DXKC 3EU7A 2P9LC 2G9AA 3PVWB 4ZOYA 5EM2B 4L3HD 4QQEA 4WK2A 3UKUC 4D0KA 3EI1B 2VC2A 5FFGA 2OJYA 3O4IA 2GC7A 2EICA 5M5TA 1XIPA 2P9KC 3IJ1A 2AH0A 3AL8A 4K3ID 4UM9A 4E54A 3CFVA 5EMLB 1A0RB 4GGAA 3I7NA 3CIKB 1T2XA 2I0TA 2HU7A 3IIWA 4FAVD 3C9CA 4CY5A 4TZ4A 5HE0B 4G56B 3UVOA 4DNVA 2HKRA 1JOFA 4X3EA 3JZGA 4CY2A 4A0BA 3PE7A 5C92A 4R7AB 4X60B 3V9FA 2YBAA 3IKOA 3EQ7A 3ZDXA 4CY1A 2H6NA 4XYIA 3K72A 1VZ3A 2OVQB 3P4FA 2VDNA 3UKRC 3DXMC 3I7KA 2AH1A 2XZGA 3GC3B 5EM2A 5AJAA 1VYHC 3PXSD 4GQ1A 4RE6A 4JHPC 5C9ZB 1H2WA 4HDJA 3FRXA 4L1MA 4FA1D 4J0XA 2VZ1A 3EMHA 2I3SA 4GGDA 1MG2A 4JSPC 1GG2B 4ESGA 3T3MA 4O1QD 4PBZA 4LGNA 3OTTA 3ULEC 4YVDA 2VDLA 4ERQA 3UR4A 4A09B 2HU8A 4D9SA 1K8KC 4GM8A 2P9NC 3JZHA 4DNWA 3UVNA 3PXWD 4KFMB 1Q47A 3V4VA 3C75H 1JTDB 3OKYB 4BP9A 2AGLA 4O45A 1XHMA 4X61B 4OWRA 3IIYA 2H9NA 2VDKA 4E5ZA 1PEVA 5IC7A 2QR5A 3UVKA 3B7FA 4ES0A 2HKMA 3IULA 1N6FA 3EI3B 3RFGA 3RMZD 3KCIA 4LG8A 3PSLA 2QC5A 3MVDK 4NAAA 3SJLD 3SLED 2YNNA 2IUQA 3ORVD 3OL2B 2H3XA 3I7LA 4O2WA 3VI4A 3JROA 4GQ2P 3VI3A 4FA4D
chains in the Genus database with same CATH topology
3DSMA 2YNPA 3MMYA 2H14A 3IJCA 2AGXA 5IJ7E 3SWSD 2OVPB 4JD2C 3ZWLB 3L4OD 3RN1D 2CO0A 3N0DA 1U2VC 3VGZA 3OW8A 2UZXB 4JXMA 4ZOZA 4Z8LA 3EI3A 2P9IC 2OIZA 2IUPA 4E54B 4CI3A 4ZOVA 3GREA 2IUVA 1R5MA 4GQBB 4A0AB 2H9LA 2W18A 3EG6A 4L9OA 2EBSA 5GMKn 2Z2OA 4GM9A 4ERZA 1JJUB 2I0RA 4EWRA 3CFSB 3SHFA 1SQJA 5HE3B 4J86A 3AFCA 4GGCA 1OLZA 4CZYA 1GP2B 5I5JA 2QXVA 4XYHA 3EI4A 1P22A 3BWSA 2MTAH 5CXBA 2B5NA 3VH0A 2H47A 2Z2PA 4CY3A 3E0CA 3U4YA 2GNQA 4A0AA 5EMMB 5TEEA 4JSVC 3J81g 2YMUA 2CE8A 4O3TB 4Y5RD 4AEZA 5TEFA 5EMJB 4U7AA 1TYQC 2CN3A 5GXHA 4NSXA 4E5ZB 1PBYB 3SBQA 4LG9A 4CI2A 2HESX 1SQ9A 3HFQA 2H9MA 4GMBA 4XEIC 1N6EA 2YB8B 3L4MD 2H9PA 1MDAH 4A7JA 3OKTA 1PGUA 5FKTA 3UVMA 1GXRA 1YFQA 2H6QA 1N6DA 4JSNC 4OZUA 1PI6A 3SFZA 3EI2A 4ERYA 5I5MA 2HXCA 3VA6A 3NVQA 3SBRA 3FGBA 4J82A 5GXIA 3RFHA 2PBIB 4BH6A 4A2LA 4JT6C 5HE2B 2CNXA 2TRCB 5FQDA 3F3PA 3K26A 3C5MA 5I5IA 4QT8A 3RLMD 3SMRA 1NR0A 5SXMA 5FLXg 3DWLC 5K1CC 3I7OA 5IT9g 4J8GA 5EMKB 2J55H 4J78A 5JWZA 3RRMC 4QRJA 2OK6A 4A11B 1MG3A 3A0FA 4CZXA 5IJ8E 2I0SA 2B5MA 5THAA 4CZVA 3F3FA 2OVRB 1ERJA 1K32A 1QNIA 2Q7QA 3RN0D 2B5LA 4J87A 4JSXC 4QL1A 5FKRA 4H5IA 3MKSB 3EI4B 4FA9D 2O9KA 3KRXB 2PM9B 3PSCB 3J80g 4JT5C 5CXBB 5EARA 2I3TA 5CYKA 3JAMg 3I2NA 2P9PC 3MXXA 3JRPA 4BL0A 5KDOB 3V5WB 2AGYA 4A11A 3NVXA 4I79A 4PC0A 2UZYB 4J84A 3N0EA 5TF2A 5H17A 3JZNA 3JB9L 2P9UC 4J77A 3I8EA 3I89A 2OK4A 3K27A 4PXWA 2H6KA 5CXCB 2HJBA 3SXTD 3V7DB 2PM9A 4FHLA 3W15A 4J81A 1OMWB 2J57G 3SBPA 2CO0C 5H14A 2GC4A 4CI8A 1XKSA 3DM0A 3EI2B 2IWFA 5HYNB 3GFCA 2Z2NA 2BCJB 1JMXB 5EAMA 2XL2A 4Y7RA 4UI9R 5A2Qg 4J79A 3SCYA 4AOWA 4O9DA 4CC9A 1JMZB 5CXCA 3I8CA 4BUJC 3PXTD 2XU7A 3AH8B 5EALA 1NEXB 4N14A 4IA9A 3F3GA 4MK0B 3RSEC 4GM3A 3EI1A 2H68A 5FKSA 5HQGA 3BG0A 3SN6B 2G99A 4L1QD 3I7HA 4PNKB 2CN2A 4A2MA 4GZ8A 4X63B 5HE1B 3ODTA 5AMSA 2AGZA 4CI1A 4FB1D 5TDHB 1B9YA 2AGWA 3IJ0A 4O3UB 5K19A 3FM0A 4U1EI 4FWWA 5CYKB 2IURA 5GSAA 1S4UX 1FWXA 5IGOA 4A08B 5AFU3 2XYIA 2AQ5A 4PBYA 1TBGA 1L0QA 5H1MA 3JPXA 2PM6B 5C2WB 2PM7B 4FAND 5IGQA 1GOTB 2IAAA 2B4EA 3AL9A 4A09A 3MZLA 3I7PA 3C99A 4K3JB 4J0WA 4J8BA 3UVLA 3PVUB 3EWEA 2YNOA 2CE9A 2XL3A 3BG1A 3OKYA 5FA5B 4A08A 4FA5D 2P9SC 1B9XA 4J73A 5B4WA 4ZOXA 4PSXB 3MZKA 3MKQA 1U4CA 3OKWA 5EAPA 1RI6A 4ZN4A 3AL8B 3KRWB 3SVWD 4PSWB 5FKQA 2IWKA 3NVNA 1SHYB 3OL2A 4H5JA 5FXYA 4IMMA 4A0BB 4D6VA 5C2VB 2BBKH 2HJ4A 2H13A 2HYEA 4L3GD 2J56H 3DXKC 3EU7A 2P9LC 2G9AA 3PVWB 4ZOYA 5EM2B 4L3HD 4QQEA 3UKUC 4D0KA 3EI1B 2OJYA 2GC7A 1XIPA 2P9KC 3IJ1A 2AH0A 3AL8A 4K3ID 4E54A 3CFVA 5EMLB 1A0RB 4GGAA 3I7NA 3CIKB 2I0TA 3IIWA 4FAVD 3C9CA 4CY5A 4TZ4A 5HE0B 4G56B 3UVOA 2HKRA 1JOFA 4X3EA 3JZGA 4CY2A 4A0BA 3PE7A 4R7AB 4X60B 3V9FA 2YBAA 3IKOA 4CY1A 2H6NA 4XYIA 2OVQB 3P4FA 3UKRC 3DXMC 3I7KA 2AH1A 5EM2A 5AJAA 1VYHC 3PXSD 4GQ1A 5C9ZB 4HDJA 3FRXA 4FA1D 4J0XA 3EMHA 2I3SA 4GGDA 1MG2A 4JSPC 1GG2B 4ESGA 4O1QD 4PBZA 4LGNA 3OTTA 3ULEC 4YVDA 4ERQA 3UR4A 4A09B 1K8KC 4GM8A 2P9NC 3JZHA 3UVNA 3PXWD 4KFMB 1Q47A 3C75H 3OKYB 2AGLA 4O45A 1XHMA 4X61B 4OWRA 3IIYA 2H9NA 4E5ZA 1PEVA 5IC7A 3UVKA 3B7FA 4ES0A 2HKMA 1N6FA 3EI3B 3RFGA 3RMZD 4LG8A 3PSLA 2QC5A 3SJLD 3SLED 2YNNA 2IUQA 3ORVD 3OL2B 2H3XA 3I7LA 3JROA 4GQ2P 4FA4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSM A;  2YNP A;  3MMY A;  2H14 A;  3IJC A;  2AGX A;  5IJ7 E;  3SWS D;  2OVP B;  4JD2 C;  3ZWL B;  3L4O D;  3RN1 D;  2CO0 A;  3N0D A;  1U2V C;  3VGZ A;  3OW8 A;  2UZX B;  4JXM A;  4ZOZ A;  4Z8L A;  3EI3 A;  2P9I C;  2OIZ A;  2IUP A;  4E54 B;  4CI3 A;  4ZOV A;  3GRE A;  2IUV A;  1R5M A;  4GQB B;  4A0A B;  2H9L A;  2W18 A;  3EG6 A;  4L9O A;  2EBS A;  5GMK n;  2Z2O A;  4GM9 A;  4ERZ A;  1JJU B;  2I0R A;  4EWR A;  3CFS B;  3SHF A;  1SQJ A;  5HE3 B;  4J86 A;  3AFC A;  4GGC A;  1OLZ A;  4CZY A;  1GP2 B;  5I5J A;  2QXV A;  4XYH A;  3EI4 A;  1P22 A;  3BWS A;  2MTA H;  5CXB A;  2B5N A;  3VH0 A;  2H47 A;  2Z2P A;  4CY3 A;  3E0C A;  3U4Y A;  2GNQ A;  4A0A A;  5EMM B;  5TEE A;  4JSV C;  3J81 g;  2YMU A;  2CE8 A;  4O3T B;  4Y5R D;  4AEZ A;  5TEF A;  5EMJ B;  4U7A A;  1TYQ C;  2CN3 A;  5GXH A;  4NSX A;  4E5Z B;  1PBY B;  3SBQ A;  4LG9 A;  4CI2 A;  2HES X;  1SQ9 A;  3HFQ A;  2H9M A;  4GMB A;  4XEI C;  1N6E A;  2YB8 B;  3L4M D;  2H9P A;  1MDA H;  4A7J A;  3OKT A;  1PGU A;  5FKT A;  3UVM A;  1GXR A;  1YFQ A;  2H6Q A;  1N6D A;  4JSN C;  4OZU A;  1PI6 A;  3SFZ A;  3EI2 A;  4ERY A;  5I5M A;  2HXC A;  3VA6 A;  3NVQ A;  3SBR A;  3FGB A;  4J82 A;  5GXI A;  3RFH A;  2PBI B;  4BH6 A;  4A2L A;  4JT6 C;  5HE2 B;  2CNX A;  2TRC B;  5FQD A;  3F3P A;  3K26 A;  3C5M A;  5I5I A;  4QT8 A;  3RLM D;  3SMR A;  1NR0 A;  5SXM A;  5FLX g;  3DWL C;  5K1C C;  3I7O A;  5IT9 g;  4J8G A;  5EMK B;  2J55 H;  4J78 A;  5JWZ A;  3RRM C;  4QRJ A;  2OK6 A;  4A11 B;  1MG3 A;  3A0F A;  4CZX A;  5IJ8 E;  2I0S A;  2B5M A;  5THA A;  4CZV A;  3F3F A;  2OVR B;  1ERJ A;  1K32 A;  1QNI A;  2Q7Q A;  3RN0 D;  2B5L A;  4J87 A;  4JSX C;  4QL1 A;  5FKR A;  4H5I A;  3MKS B;  3EI4 B;  4FA9 D;  2O9K A;  3KRX B;  2PM9 B;  3PSC B;  3J80 g;  4JT5 C;  5CXB B;  5EAR A;  2I3T A;  5CYK A;  3JAM g;  3I2N A;  2P9P C;  3MXX A;  3JRP A;  4BL0 A;  5KDO B;  3V5W B;  2AGY A;  4A11 A;  3NVX A;  4I79 A;  4PC0 A;  2UZY B;  4J84 A;  3N0E A;  5TF2 A;  5H17 A;  3JZN A;  3JB9 L;  2P9U C;  4J77 A;  3I8E A;  3I89 A;  2OK4 A;  3K27 A;  4PXW A;  2H6K A;  5CXC B;  2HJB A;  3SXT D;  3V7D B;  2PM9 A;  4FHL A;  3W15 A;  4J81 A;  1OMW B;  2J57 G;  3SBP A;  2CO0 C;  5H14 A;  2GC4 A;  4CI8 A;  1XKS A;  3DM0 A;  3EI2 B;  2IWF A;  5HYN B;  3GFC A;  2Z2N A;  2BCJ B;  1JMX B;  5EAM A;  2XL2 A;  4Y7R A;  4UI9 R;  5A2Q g;  4J79 A;  3SCY A;  4AOW A;  4O9D A;  4CC9 A;  1JMZ B;  5CXC A;  3I8C A;  4BUJ C;  3PXT D;  2XU7 A;  3AH8 B;  5EAL A;  1NEX B;  4N14 A;  4IA9 A;  3F3G A;  4MK0 B;  3RSE C;  4GM3 A;  3EI1 A;  2H68 A;  5FKS A;  5HQG A;  3BG0 A;  3SN6 B;  2G99 A;  4L1Q D;  3I7H A;  4PNK B;  2CN2 A;  4A2M A;  4GZ8 A;  4X63 B;  5HE1 B;  3ODT A;  5AMS A;  2AGZ A;  4CI1 A;  4FB1 D;  5TDH B;  1B9Y A;  2AGW A;  3IJ0 A;  4O3U B;  5K19 A;  3FM0 A;  4U1E I;  4FWW A;  5CYK B;  2IUR A;  5GSA A;  1S4U X;  1FWX A;  5IGO A;  4A08 B;  5AFU 3;  2XYI A;  2AQ5 A;  4PBY A;  1TBG A;  1L0Q A;  5H1M A;  3JPX A;  2PM6 B;  5C2W B;  2PM7 B;  4FAN D;  5IGQ A;  1GOT B;  2IAA A;  2B4E A;  3AL9 A;  4A09 A;  3MZL A;  3I7P A;  3C99 A;  4K3J B;  4J0W A;  4J8B A;  3UVL A;  3PVU B;  3EWE A;  2YNO A;  2CE9 A;  2XL3 A;  3BG1 A;  3OKY A;  5FA5 B;  4A08 A;  4FA5 D;  2P9S C;  1B9X A;  4J73 A;  5B4W A;  4ZOX A;  4PSX B;  3MZK A;  3MKQ A;  1U4C A;  3OKW A;  5EAP A;  1RI6 A;  4ZN4 A;  3AL8 B;  3KRW B;  3SVW D;  4PSW B;  5FKQ A;  2IWK A;  3NVN A;  1SHY B;  3OL2 A;  4H5J A;  5FXY A;  4IMM A;  4A0B B;  4D6V A;  5C2V B;  2BBK H;  2HJ4 A;  2H13 A;  2HYE A;  4L3G D;  2J56 H;  3DXK C;  3EU7 A;  2P9L C;  2G9A A;  3PVW B;  4ZOY A;  5EM2 B;  4L3H D;  4QQE A;  3UKU C;  4D0K A;  3EI1 B;  2OJY A;  2GC7 A;  1XIP A;  2P9K C;  3IJ1 A;  2AH0 A;  3AL8 A;  4K3I D;  4E54 A;  3CFV A;  5EML B;  1A0R B;  4GGA A;  3I7N A;  3CIK B;  2I0T A;  3IIW A;  4FAV D;  3C9C A;  4CY5 A;  4TZ4 A;  5HE0 B;  4G56 B;  3UVO A;  2HKR A;  1JOF A;  4X3E A;  3JZG A;  4CY2 A;  4A0B A;  3PE7 A;  4R7A B;  4X60 B;  3V9F A;  2YBA A;  3IKO A;  4CY1 A;  2H6N A;  4XYI A;  2OVQ B;  3P4F A;  3UKR C;  3DXM C;  3I7K A;  2AH1 A;  5EM2 A;  5AJA A;  1VYH C;  3PXS D;  4GQ1 A;  5C9Z B;  4HDJ A;  3FRX A;  4FA1 D;  4J0X A;  3EMH A;  2I3S A;  4GGD A;  1MG2 A;  4JSP C;  1GG2 B;  4ESG A;  4O1Q D;  4PBZ A;  4LGN A;  3OTT A;  3ULE C;  4YVD A;  4ERQ A;  3UR4 A;  4A09 B;  1K8K C;  4GM8 A;  2P9N C;  3JZH A;  3UVN A;  3PXW D;  4KFM B;  1Q47 A;  3C75 H;  3OKY B;  2AGL A;  4O45 A;  1XHM A;  4X61 B;  4OWR A;  3IIY A;  2H9N A;  4E5Z A;  1PEV A;  5IC7 A;  3UVK A;  3B7F A;  4ES0 A;  2HKM A;  1N6F A;  3EI3 B;  3RFG A;  3RMZ D;  4LG8 A;  3PSL A;  2QC5 A;  3SJL D;  3SLE D;  2YNN A;  2IUQ A;  3ORV D;  3OL2 B;  2H3X A;  3I7L A;  3JRO A;  4GQ2 P;  4FA4 D; 
#chains in the Genus database with same CATH topology
 3DSM A;  2VDM A;  2YNP A;  4BCB A;  3MMY A;  2H14 A;  3IJC A;  2AGX A;  5IJ7 E;  3SWS D;  4AX4 A;  1A12 A;  3IUN A;  2OVP B;  4JD2 C;  3ZWL B;  3L4O D;  3RN1 D;  2CO0 A;  3N0D A;  1U2V C;  3VGZ A;  3OW8 A;  2UZX B;  4JXM A;  4ZOZ A;  4Z8L A;  3EI3 A;  2P9I C;  2OIZ A;  2IUP A;  4E54 B;  2WQ8 A;  4CI3 A;  4ZOV A;  3MUO A;  3GRE A;  3ZDZ A;  1H2Y A;  4G1E A;  2XE4 A;  2IUV A;  1R5M A;  4GQB B;  4WK0 A;  4A0A B;  2H9L A;  2W18 A;  3EG6 A;  4L9O A;  2EBS A;  5GMK n;  2Z2O A;  4GM9 A;  5C86 A;  4ERZ A;  1JJU B;  1UTC A;  2I0R A;  4EWR A;  4WK4 A;  3CFS B;  3SHF A;  1SQJ A;  5HE3 B;  3QHY B;  4J86 A;  3AFC A;  4GGC A;  1OLZ A;  4CZY A;  1GP2 B;  5I5J A;  2QXV A;  4XYH A;  3EI4 A;  4MMY A;  1P22 A;  3BWS A;  1C9I A;  1H2X A;  2MTA H;  5CXB A;  2B5N A;  3VH0 A;  5HDB A;  2H47 A;  2Z2P A;  4CY3 A;  3E0C A;  3IUM A;  3U4Y A;  1E5T A;  1UOP A;  2GNQ A;  4A0A A;  3T3P A;  5EMM B;  3IUQ A;  4JSV C;  5TEE A;  3J81 g;  4G1M A;  2YMU A;  2CE8 A;  4O3T B;  4Y5R D;  3IVM A;  4AEZ A;  5TEF A;  5EMJ B;  3ZE2 A;  4BP8 A;  4U7A A;  1YR2 A;  3NIG A;  1TYQ C;  2CN3 A;  5GXH A;  4NSX A;  3EQ8 A;  4E5Z B;  3O4J A;  1PBY B;  3SBQ A;  1E8N A;  4LG9 A;  4CI2 A;  2HES X;  1SQ9 A;  3HFQ A;  2H9M A;  4GMB A;  4QAM A;  4XEI C;  1U8C A;  3FCS A;  1N6E A;  2YB8 B;  3L4M D;  2H9P A;  4NEN A;  1MDA H;  4A7J A;  3OKT A;  1PGU A;  2EIB A;  5FKT A;  3UVM A;  1GXR A;  4IRZ A;  1YFQ A;  3OF7 A;  2H6Q A;  1N6D A;  4JSN C;  4OZU A;  1PI6 A;  3SFZ A;  3EI2 A;  4ERY A;  5I5M A;  2HXC A;  3VA6 A;  1C9L A;  3NVQ A;  2VDQ A;  3FGB A;  3SBR A;  4J82 A;  5GXI A;  3RFH A;  2EIE A;  2PBI B;  4BH6 A;  2BKL A;  4NBM A;  4A2L A;  4JT6 C;  5HE2 B;  1UOO A;  2CNX A;  2TRC B;  5FQD A;  5M5U A;  3F3P A;  3K26 A;  3C5M A;  5I5I A;  4QT8 A;  3RLM D;  3EQ9 A;  3SMR A;  1NR0 A;  5SXM A;  5FLX g;  3DWL C;  3K71 A;  5K1C C;  3I7O A;  5IT9 g;  4J8G A;  5EMK B;  2J55 H;  4J78 A;  5JWZ A;  3RRM C;  4QRJ A;  2OK6 A;  4A11 B;  1VZ2 A;  1MG3 A;  3A0F A;  4CZX A;  5IJ8 E;  2I0S A;  2B5M A;  5THA A;  3ZE1 A;  3F3F A;  4CZV A;  2OVR B;  1ERJ A;  1K32 A;  1QNI A;  2Q7Q A;  3RN0 D;  2B5L A;  4J87 A;  4JSX C;  4QL1 A;  4UM8 A;  5FKR A;  4DNU A;  4H5I A;  3MKS B;  4BCD A;  3EI4 B;  4FA9 D;  2O9K A;  5M5R A;  3KRX B;  2PM9 B;  3NID A;  3PSC B;  3J80 g;  4JT5 C;  5CXB B;  5M5S A;  5EAR A;  2I3T A;  5CYK A;  3JAM g;  3I2N A;  2P9P C;  3MXX A;  3JRP A;  4BL0 A;  1E8M A;  3IJE A;  5KDO B;  2VDP A;  3V5W B;  2AGY A;  4A11 A;  3NVX A;  4I79 A;  4PC0 A;  2UZY B;  4J84 A;  5M5V A;  3N0E A;  1BPO A;  5H17 A;  5TF2 A;  4AMY A;  3JZN A;  3JB9 L;  2P9U C;  4J77 A;  3I8E A;  4Z7O A;  3I89 A;  2OK4 A;  4G55 A;  3K27 A;  4PXW A;  2H6K A;  5CXC B;  2HJB A;  1O6F A;  3IUR A;  3SXT D;  3V7D B;  2PM9 A;  4FHL A;  3W15 A;  4J81 A;  1OMW B;  2J57 G;  3SBP A;  2CO0 C;  4RE5 A;  5H14 A;  3O4G A;  2GC4 A;  4Z7N A;  4CI8 A;  1XKS A;  3DM0 A;  1K3I A;  5E6U A;  3EI2 B;  2IWF A;  5HYN B;  3GFC A;  2Z2N A;  2BCJ B;  1JMX B;  5EAM A;  2XL2 A;  1H2Z A;  4O02 A;  1VE6 A;  4Y7R A;  4UI9 R;  2XDW A;  5A2Q g;  3NIF A;  4J79 A;  1M1X A;  3SCY A;  4AOW A;  2VZ3 A;  4O9D A;  2EID A;  4CC9 A;  1JMZ B;  5CXC A;  3FCU A;  3I8C A;  4BUJ C;  3PXT D;  2XU7 A;  1JV2 A;  3AH8 B;  5EAL A;  1NEX B;  1VE7 A;  4N14 A;  3K6S A;  3V4P A;  4IA9 A;  3F3G A;  4MK0 B;  3RSE C;  4GM3 A;  3ZDY A;  1O6G A;  3EI1 A;  2H68 A;  5FKS A;  5HQG A;  3BG0 A;  3SN6 B;  2G99 A;  4L1Q D;  3I7H A;  4PNK B;  4NC4 A;  2CN2 A;  4A2M A;  4GZ8 A;  4X63 B;  5HE1 B;  3ODT A;  5AMS A;  2AGZ A;  4CI1 A;  4FB1 D;  5TDH B;  1B9Y A;  1L5G A;  2AGW A;  4JHN A;  3IJ0 A;  4O3U B;  5K19 A;  3FM0 A;  3GD1 I;  1QFM A;  1QFS A;  3DDU A;  4U1E I;  4FWW A;  5CYK B;  2IUR A;  5GSA A;  1S4U X;  1FWX A;  3MUN A;  1GOF A;  5IGO A;  4A08 B;  5AFU 3;  2XYI A;  2AQ5 A;  1TYE A;  4PBY A;  1TBG A;  1L0Q A;  1UOQ A;  5H1M A;  3JPX A;  2PM6 B;  4MMX A;  5C2W B;  2PM7 B;  5E6R A;  4Z7Q A;  4FAN D;  5IGQ A;  1GOT B;  2IAA A;  2B4E A;  3ZE0 A;  3AL9 A;  4A09 A;  3MZL A;  3I7P A;  3C99 A;  1I2M B;  4K3J B;  4J0W A;  2VDO A;  4J8B A;  3UVL A;  3PVU B;  4AMZ A;  3EWE A;  4WJK A;  2YNO A;  4AN0 A;  2CE9 A;  2XL3 A;  3BG1 A;  3OKY A;  5FA5 B;  4AN1 A;  3QI0 A;  4A08 A;  4MMZ A;  5M61 A;  4BCC A;  2P9S C;  1B9X A;  4FA5 D;  4J73 A;  5B4W A;  4ZOX A;  4PSX B;  5E6S A;  3MZK A;  2HU5 A;  3MKQ A;  1U4C A;  3OKW A;  5EAP A;  1RI6 A;  4ZN4 A;  3AL8 B;  1GOG A;  3KRW B;  3SVW D;  4PSW B;  2VDR A;  5FKQ A;  3IUJ A;  2IWK A;  3NVN A;  1SHY B;  3OL2 A;  4H5J A;  2QZP A;  5FXY A;  4IMM A;  4A0B B;  4D6V A;  5FFO A;  5C2V B;  2BBK H;  1GOH A;  2HJ4 A;  3O4H A;  2H13 A;  2JKX A;  2HYE A;  4L3G D;  2J56 H;  3DXK C;  3EU7 A;  2P9L C;  2G9A A;  3PVW B;  4ZOY A;  5EM2 B;  4L3H D;  4QQE A;  4WK2 A;  3UKU C;  4D0K A;  3EI1 B;  2VC2 A;  5FFG A;  2OJY A;  3O4I A;  2GC7 A;  2EIC A;  5M5T A;  1XIP A;  2P9K C;  3IJ1 A;  2AH0 A;  3AL8 A;  4K3I D;  4UM9 A;  4E54 A;  3CFV A;  5EML B;  1A0R B;  4GGA A;  3I7N A;  3CIK B;  1T2X A;  2I0T A;  2HU7 A;  3IIW A;  4FAV D;  3C9C A;  4CY5 A;  4TZ4 A;  5HE0 B;  4G56 B;  3UVO A;  4DNV A;  2HKR A;  1JOF A;  4X3E A;  3JZG A;  4CY2 A;  4A0B A;  3PE7 A;  5C92 A;  4R7A B;  4X60 B;  3V9F A;  2YBA A;  3IKO A;  3EQ7 A;  3ZDX A;  4CY1 A;  2H6N A;  4XYI A;  3K72 A;  1VZ3 A;  2OVQ B;  3P4F A;  2VDN A;  3UKR C;  3DXM C;  3I7K A;  2AH1 A;  2XZG A;  3GC3 B;  5EM2 A;  5AJA A;  1VYH C;  3PXS D;  4GQ1 A;  4RE6 A;  4JHP C;  5C9Z B;  1H2W A;  4HDJ A;  3FRX A;  4L1M A;  4FA1 D;  4J0X A;  2VZ1 A;  3EMH A;  2I3S A;  4GGD A;  1MG2 A;  4JSP C;  1GG2 B;  4ESG A;  3T3M A;  4O1Q D;  4PBZ A;  4LGN A;  3OTT A;  3ULE C;  4YVD A;  2VDL A;  4ERQ A;  3UR4 A;  4A09 B;  2HU8 A;  4D9S A;  1K8K C;  4GM8 A;  2P9N C;  3JZH A;  4DNW A;  3UVN A;  3PXW D;  4KFM B;  1Q47 A;  3V4V A;  3C75 H;  1JTD B;  3OKY B;  4BP9 A;  2AGL A;  4O45 A;  1XHM A;  4X61 B;  4OWR A;  3IIY A;  2H9N A;  2VDK A;  4E5Z A;  1PEV A;  5IC7 A;  2QR5 A;  3UVK A;  3B7F A;  4ES0 A;  2HKM A;  3IUL A;  1N6F A;  3EI3 B;  3RFG A;  3RMZ D;  3KCI A;  4LG8 A;  3PSL A;  2QC5 A;  3MVD K;  4NAA A;  3SJL D;  3SLE D;  2YNN A;  2IUQ A;  3ORV D;  3OL2 B;  2H3X A;  3I7L A;  4O2W A;  3VI4 A;  3JRO A;  4GQ2 P;  3VI3 A;  4FA4 D; 
#chains in the Genus database with same CATH homology
 3DSM A;  2YNP A;  3MMY A;  2H14 A;  3IJC A;  2AGX A;  5IJ7 E;  3SWS D;  2OVP B;  4JD2 C;  3ZWL B;  3L4O D;  3RN1 D;  2CO0 A;  3N0D A;  1U2V C;  3VGZ A;  3OW8 A;  2UZX B;  4JXM A;  4ZOZ A;  4Z8L A;  3EI3 A;  2P9I C;  2OIZ A;  2IUP A;  4E54 B;  4CI3 A;  4ZOV A;  3GRE A;  2IUV A;  1R5M A;  4GQB B;  4A0A B;  2H9L A;  2W18 A;  3EG6 A;  4L9O A;  2EBS A;  5GMK n;  2Z2O A;  4GM9 A;  4ERZ A;  1JJU B;  2I0R A;  4EWR A;  3CFS B;  3SHF A;  1SQJ A;  5HE3 B;  4J86 A;  3AFC A;  4GGC A;  1OLZ A;  4CZY A;  1GP2 B;  5I5J A;  2QXV A;  4XYH A;  3EI4 A;  1P22 A;  3BWS A;  2MTA H;  5CXB A;  2B5N A;  3VH0 A;  2H47 A;  2Z2P A;  4CY3 A;  3E0C A;  3U4Y A;  2GNQ A;  4A0A A;  5EMM B;  5TEE A;  4JSV C;  3J81 g;  2YMU A;  2CE8 A;  4O3T B;  4Y5R D;  4AEZ A;  5TEF A;  5EMJ B;  4U7A A;  1TYQ C;  2CN3 A;  5GXH A;  4NSX A;  4E5Z B;  1PBY B;  3SBQ A;  4LG9 A;  4CI2 A;  2HES X;  1SQ9 A;  3HFQ A;  2H9M A;  4GMB A;  4XEI C;  1N6E A;  2YB8 B;  3L4M D;  2H9P A;  1MDA H;  4A7J A;  3OKT A;  1PGU A;  5FKT A;  3UVM A;  1GXR A;  1YFQ A;  2H6Q A;  1N6D A;  4JSN C;  4OZU A;  1PI6 A;  3SFZ A;  3EI2 A;  4ERY A;  5I5M A;  2HXC A;  3VA6 A;  3NVQ A;  3SBR A;  3FGB A;  4J82 A;  5GXI A;  3RFH A;  2PBI B;  4BH6 A;  4A2L A;  4JT6 C;  5HE2 B;  2CNX A;  2TRC B;  5FQD A;  3F3P A;  3K26 A;  3C5M A;  5I5I A;  4QT8 A;  3RLM D;  3SMR A;  1NR0 A;  5SXM A;  5FLX g;  3DWL C;  5K1C C;  3I7O A;  5IT9 g;  4J8G A;  5EMK B;  2J55 H;  4J78 A;  5JWZ A;  3RRM C;  4QRJ A;  2OK6 A;  4A11 B;  1MG3 A;  3A0F A;  4CZX A;  5IJ8 E;  2I0S A;  2B5M A;  5THA A;  4CZV A;  3F3F A;  2OVR B;  1ERJ A;  1K32 A;  1QNI A;  2Q7Q A;  3RN0 D;  2B5L A;  4J87 A;  4JSX C;  4QL1 A;  5FKR A;  4H5I A;  3MKS B;  3EI4 B;  4FA9 D;  2O9K A;  3KRX B;  2PM9 B;  3PSC B;  3J80 g;  4JT5 C;  5CXB B;  5EAR A;  2I3T A;  5CYK A;  3JAM g;  3I2N A;  2P9P C;  3MXX A;  3JRP A;  4BL0 A;  5KDO B;  3V5W B;  2AGY A;  4A11 A;  3NVX A;  4I79 A;  4PC0 A;  2UZY B;  4J84 A;  3N0E A;  5TF2 A;  5H17 A;  3JZN A;  3JB9 L;  2P9U C;  4J77 A;  3I8E A;  3I89 A;  2OK4 A;  3K27 A;  4PXW A;  2H6K A;  5CXC B;  2HJB A;  3SXT D;  3V7D B;  2PM9 A;  4FHL A;  3W15 A;  4J81 A;  1OMW B;  2J57 G;  3SBP A;  2CO0 C;  5H14 A;  2GC4 A;  4CI8 A;  1XKS A;  3DM0 A;  3EI2 B;  2IWF A;  5HYN B;  3GFC A;  2Z2N A;  2BCJ B;  1JMX B;  5EAM A;  2XL2 A;  4Y7R A;  4UI9 R;  5A2Q g;  4J79 A;  3SCY A;  4AOW A;  4O9D A;  4CC9 A;  1JMZ B;  5CXC A;  3I8C A;  4BUJ C;  3PXT D;  2XU7 A;  3AH8 B;  5EAL A;  1NEX B;  4N14 A;  4IA9 A;  3F3G A;  4MK0 B;  3RSE C;  4GM3 A;  3EI1 A;  2H68 A;  5FKS A;  5HQG A;  3BG0 A;  3SN6 B;  2G99 A;  4L1Q D;  3I7H A;  4PNK B;  2CN2 A;  4A2M A;  4GZ8 A;  4X63 B;  5HE1 B;  3ODT A;  5AMS A;  2AGZ A;  4CI1 A;  4FB1 D;  5TDH B;  1B9Y A;  2AGW A;  3IJ0 A;  4O3U B;  5K19 A;  3FM0 A;  4U1E I;  4FWW A;  5CYK B;  2IUR A;  5GSA A;  1S4U X;  1FWX A;  5IGO A;  4A08 B;  5AFU 3;  2XYI A;  2AQ5 A;  4PBY A;  1TBG A;  1L0Q A;  5H1M A;  3JPX A;  2PM6 B;  5C2W B;  2PM7 B;  4FAN D;  5IGQ A;  1GOT B;  2IAA A;  2B4E A;  3AL9 A;  4A09 A;  3MZL A;  3I7P A;  3C99 A;  4K3J B;  4J0W A;  4J8B A;  3UVL A;  3PVU B;  3EWE A;  2YNO A;  2CE9 A;  2XL3 A;  3BG1 A;  3OKY A;  5FA5 B;  4A08 A;  4FA5 D;  2P9S C;  1B9X A;  4J73 A;  5B4W A;  4ZOX A;  4PSX B;  3MZK A;  3MKQ A;  1U4C A;  3OKW A;  5EAP A;  1RI6 A;  4ZN4 A;  3AL8 B;  3KRW B;  3SVW D;  4PSW B;  5FKQ A;  2IWK A;  3NVN A;  1SHY B;  3OL2 A;  4H5J A;  5FXY A;  4IMM A;  4A0B B;  4D6V A;  5C2V B;  2BBK H;  2HJ4 A;  2H13 A;  2HYE A;  4L3G D;  2J56 H;  3DXK C;  3EU7 A;  2P9L C;  2G9A A;  3PVW B;  4ZOY A;  5EM2 B;  4L3H D;  4QQE A;  3UKU C;  4D0K A;  3EI1 B;  2OJY A;  2GC7 A;  1XIP A;  2P9K C;  3IJ1 A;  2AH0 A;  3AL8 A;  4K3I D;  4E54 A;  3CFV A;  5EML B;  1A0R B;  4GGA A;  3I7N A;  3CIK B;  2I0T A;  3IIW A;  4FAV D;  3C9C A;  4CY5 A;  4TZ4 A;  5HE0 B;  4G56 B;  3UVO A;  2HKR A;  1JOF A;  4X3E A;  3JZG A;  4CY2 A;  4A0B A;  3PE7 A;  4R7A B;  4X60 B;  3V9F A;  2YBA A;  3IKO A;  4CY1 A;  2H6N A;  4XYI A;  2OVQ B;  3P4F A;  3UKR C;  3DXM C;  3I7K A;  2AH1 A;  5EM2 A;  5AJA A;  1VYH C;  3PXS D;  4GQ1 A;  5C9Z B;  4HDJ A;  3FRX A;  4FA1 D;  4J0X A;  3EMH A;  2I3S A;  4GGD A;  1MG2 A;  4JSP C;  1GG2 B;  4ESG A;  4O1Q D;  4PBZ A;  4LGN A;  3OTT A;  3ULE C;  4YVD A;  4ERQ A;  3UR4 A;  4A09 B;  1K8K C;  4GM8 A;  2P9N C;  3JZH A;  3UVN A;  3PXW D;  4KFM B;  1Q47 A;  3C75 H;  3OKY B;  2AGL A;  4O45 A;  1XHM A;  4X61 B;  4OWR A;  3IIY A;  2H9N A;  4E5Z A;  1PEV A;  5IC7 A;  3UVK A;  3B7F A;  4ES0 A;  2HKM A;  1N6F A;  3EI3 B;  3RFG A;  3RMZ D;  4LG8 A;  3PSL A;  2QC5 A;  3SJL D;  3SLE D;  2YNN A;  2IUQ A;  3ORV D;  3OL2 B;  2H3X A;  3I7L A;  3JRO A;  4GQ2 P;  4FA4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...