3FRXA

Crystal structure of the yeast orthologue of rack1, asc1.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
315
structure length
309
Chain Sequence
NEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Direct link between RACK1 function and localization at the ribosome in vivo
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 79
structure length 309
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3frxA01
2AGWA 2QC5A 3J80g 4E54A 4YVDA 1B9XA 3K27A 5HYNB 5FXYA 3P4FA 5HQGA 3JZGA 1Q47A 3B7FA 4L3GD 4L1QD 4L9OA 4Y7RA 1N6FA 1R5MA 3PXTD 1MG2A 4PC0A 3MXXA 2XL2A 2CO0A 2Z2NA 3UKRC 5IJ8E 3J81g 3JAMg 3EI2A 3VGZA 2Q7QA 5CYKB 2W18A 3OKYA 3RFGA 2OJYA 4O3TB 3F3GA 4K3ID 5HE1B 3I7PA 2TRCB 5A2Qg 4IMMA 2AGZA 4ERYA 2GC4A 3I7KA 4QL1A 3SMRA 1PI6A 4QT8A 4R7AB 2OVQB 4E54B 4BUJC 1XIPA 4FAVD 1N6EA 1NEXB 2EBSA 3JRPA 2IWFA 4LGNA 2XL3A 4PBYA 3V7DB 5KDOB 4XYHA 3EWEA 3I8EA 2HJ4A 4CY1A 3KRXB 4J78A 2G9AA 3DWLC 2G99A 2YMUA 2GC7A 2QXVA 4A08B 3PXSD 3L4OD 2PM9B 3EI2B 3EI1B 4A0BA 3K26A 4ZN4A 3JPXA 2J55H 4ERQA 5EAPA 4CY5A 1SQ9A 1JOFA 2H14A 5B4WA 3C75H 4E5ZA 1GG2B 2OVPB 2YNNA 5C9ZB 2YB8B 1U4CA 2Z2OA 2I3TA 3NVNA 4J84A 5EMMB 3IIWA 4GM3A 4A11A 4X63B 4CY2A 3RSEC 2AGYA 3VA6A 4G56B 2I0SA 1B9YA 3RN1D 3SVWD 3RLMD 2OK6A 4PSWB 3SBPA 4J77A 5THAA 3RMZD 4H5IA 3HFQA 5GXIA 2XYIA 5FA5B 5IC7A 4L3HD 3SWSD 4BL0A 3A0FA 3OTTA 3RFHA 5CXBA 5FQDA 3RN0D 2H68A 4CI2A 4Z8LA 3OW8A 4J73A 4QRJA 2B5LA 3MMYA 5I5IA 3F3FA 4ZOYA 2CE9A 2YBAA 4IA9A 4FA1D 3AFCA 4J8BA 3MZKA 2J56H 1K8KC 1PBYB 3CIKB 4ESGA 5EMLB 4GGAA 3SJLD 2H9NA 4XEIC 1YFQA 3OKWA 3N0DA 5I5JA 3I8CA 5GSAA 3C5MA 4XYIA 3EI4B 4JT5C 4A0AB 3CFSB 3SN6B 3SLED 1JMZB 5I5MA 2HESX 4FHLA 4A7JA 4MK0B 1MG3A 1NR0A 1N6DA 5IJ7E 3AL8A 4JSXC 4O1QD 5H17A 4LG9A 3DXKC 3KRWB 3I2NA 3JROA 5AJAA 5SXMA 4GZ8A 4ZOZA 1FWXA 1TYQC 3SBQA 4CC9A 5FKTA 5FKRA 5EMKB 1A0RB 4J82A 3UVOA 5H1MA 2P9NC 3V9FA 4CI1A 2P9SC 5CXCA 4A09A 2BBKH 4GQ1A 4JD2C 2IUQA 3IKOA 3OL2A 4J79A 4FAND 1L0QA 1MDAH 3C9CA 1PGUA 2CO0C 2CNXA 3OKYB 2H6NA 5HE3B 2HKMA 4QQEA 4JSPC 2H6KA 3SBRA 4A2MA 5FLXg 4PBZA 4J81A 4PXWA 4CY3A 3MKQA 3IJCA 4J87A 4N14A 5EM2A 2P9LC 3PXWD 4JXMA 3EMHA 5EMJB 3N0EA 3CFVA 4O3UB 3U4YA 2AGXA 5EALA 4GGCA 4GQBB 4FA5D 4A0BB 4FB1D 4O9DA 3V5WB 5FKSA 2P9UC 5IGOA 2CE8A 5GMKn 5TEEA 3ZWLB 4J8GA 3UVNA 2B4EA 2HKRA 3FRXA 3OKTA 4E5ZB 2CN3A 2AH0A 5HE0B 3JB9L 4ERZA 2OK4A 4A11B 2IAAA 4JSNC 4HDJA 3I7HA 3I7OA 4OWRA 5CYKA 4ZOXA 1GOTB 4NSXA 3BWSA 1PEVA 4ES0A 5IT9g 3I89A 2HXCA 2UZYB 4ZOVA 3JZNA 1XKSA 5CXBB 1VYHC 3SHFA 5EAMA 3JZHA 4D6VA 2I3SA 2H9PA 2H47A 2Z2PA 1P22A 4X60B 2H9MA 2B5NA 4JT6C 2PM6B 4A08A 4K3JB 3DXMC 4TZ4A 2H13A 2PM9A 5TF2A 4CI3A 3UVLA 3UKUC 1SHYB 4AEZA 3EI1A 2MTAH 2OIZA 3GREA 4KFMB 4X3EA 5GXHA 1GP2B 4GM9A 3SCYA 2P9PC 1RI6A 3ODTA 4UI9R 4BH6A 3UR4A 2YNPA 1U2VC 5EARA 3NVXA 1XHMA 5HE2B 2B5MA 4CI8A 3AL8B 3ORVD 3DSMA 5FKQA 2AGLA 2HYEA 3IJ0A 2HJBA 5TEFA 2BCJB 3PSLA 2O9KA 5K1CC 3GFCA 4CZVA 2P9KC 4CZXA 1OLZA 2I0TA 2P9IC 4I79A 5C2WB 3PE7A 2H3XA 2PM7B 4OZUA 4GGDA 2XU7A 3AL9A 5CXCB 4A09B 1ERJA 4AOWA 2UZXB 3OL2B 4PSXB 4FWWA 3PSCB 1JJUB 3PVUB 3EI3A 3EU7A 2CN2A 4U1EI 4FA4D 4LG8A 1OMWB 3W15A 3VH0A 4J0WA 4J0XA 1K32A 2IUPA 1S4UX 4X61B 5JWZA 2I0RA 4H5JA 3FGBA 1JMXB 5AFU3 3ULEC 2AH1A 4EWRA 1SQJA 5H14A 4A2LA 2AQ5A 2H9LA 5TDHB 2IUVA 5C2VB 4JSVC 3MKSB 4PNKB 2J57G 4GQ2P 3PVWB 4GMBA 4GM8A 3L4MD 4O45A 5EM2B 3I7NA 2GNQA 2PBIB 3E0CA 2H6QA 5K19A 2IURA 3AH8B 3IIYA 3NVQA 3EI3B 1GXRA 3EI4A 5AMSA 3C99A 3IJ1A 4D0KA 4A0AA 3SXTD 4Y5RD 3MZLA 5IGQA 3BG0A 3FM0A 4J86A 3RRMC 3BG1A 1TBGA 3F3PA 4CZYA 2YNOA 3I7LA 3UVMA 3DM0A 4U7AA 2IWKA 3EG6A 1QNIA 3UVKA 3SFZA 2OVRB 4FA9D
chains in the Genus database with same CATH superfamily
2AGWA 2QC5A 4DNVA 3J80g 4E54A 4YVDA 1B9XA 1O6FA 3K27A 1VZ3A 1UOQA 5HYNB 5FXYA 3P4FA 5HQGA 3JZGA 3IUMA 1Q47A 3B7FA 4L3GD 4L1QD 4L9OA 4Y7RA 1VE6A 5FFOA 4Z7OA 1N6FA 1R5MA 3PXTD 1MG2A 4PC0A 4AMZA 3MXXA 2XL2A 3DDUA 2CO0A 2Z2NA 4O02A 3UKRC 5IJ8E 3J81g 2VDLA 3JAMg 3EI2A 3VGZA 2HU8A 2Q7QA 4UM9A 5CYKB 2W18A 3OKYA 3RFGA 1C9IA 2OJYA 4O3TB 3F3GA 4K3ID 5HE1B 3I7PA 2TRCB 3IVMA 1TYEA 5A2Qg 4IMMA 2AGZA 4ERYA 2GC4A 3I7KA 4QL1A 3NIDA 3SMRA 1PI6A 4QT8A 4R7AB 4G55A 2OVQB 4E54B 4BUJC 1XIPA 4FAVD 1N6EA 1NEXB 2EBSA 3JRPA 2IWFA 4LGNA 2XL3A 3O4GA 4PBYA 4NC4A 3V7DB 5KDOB 4XYHA 3EWEA 3I8EA 2HJ4A 4CY1A 3KRXB 4J78A 2G9AA 3DWLC 2G99A 2YMUA 2GC7A 2QXVA 4A08B 3PXSD 3L4OD 2PM9B 3ZDYA 1UOPA 3EI2B 3MUNA 3EI1B 3O4JA 4A0BA 4WK4A 3K26A 4ZN4A 3JPXA 2J55H 4ERQA 3ZE0A 5EAPA 4CY5A 1SQ9A 1JOFA 2H14A 4BP9A 5B4WA 3C75H 4E5ZA 1GG2B 2OVPB 2YNNA 2VDOA 5C9ZB 2YB8B 1U4CA 2Z2OA 2I3TA 3NVNA 1M1XA 4J84A 4JHPC 5E6SA 3IIWA 4GM3A 4A11A 4X63B 5EMMB 4CY2A 3RSEC 5FFGA 2AGYA 3MUOA 4G56B 3VA6A 2I0SA 1B9YA 3GC3B 3RN1D 3SVWD 3RLMD 2OK6A 4PSWB 3SBPA 4J77A 5THAA 3RMZD 4H5IA 3HFQA 5GXIA 2XYIA 3FCUA 5FA5B 5IC7A 4L3HD 3SWSD 4BL0A 3A0FA 3K71A 3OTTA 3RFHA 5CXBA 5FQDA 3IJEA 3RN0D 2H68A 4WK0A 4Z8LA 4CI2A 3OW8A 4J73A 4QRJA 2BKLA 1A12A 2B5LA 4DNUA 3MMYA 5I5IA 3F3FA 4ZOYA 2CE9A 3V4VA 2YBAA 4IA9A 4FA1D 1O6GA 3AFCA 4J8BA 3EQ9A 3MZKA 2J56H 1K8KC 3ZE1A 1PBYB 5C86A 3CIKB 1JTDB 4ESGA 1L5GA 5EMLB 4MMXA 4GGAA 3SJLD 1JV2A 2H9NA 4XEIC 4JHNA 3ZDXA 1YFQA 3OKWA 3N0DA 5I5JA 3I8CA 5GSAA 3C5MA 1K3IA 4XYIA 3EI4B 4JT5C 4A0AB 3CFSB 4NENA 3SN6B 3SLED 1JMZB 5I5MA 2HESX 4FHLA 3V4PA 4A7JA 4MK0B 2VDKA 4RE5A 1MG3A 1NR0A 1H2WA 1N6DA 5IJ7E 3AL8A 3NIGA 4JSXC 4O1QD 5H17A 4LG9A 3DXKC 3KRWB 3I2NA 3JROA 5AJAA 5SXMA 4GZ8A 4ZOZA 1FWXA 3O4HA 1TYQC 1E5TA 3SBQA 3FCSA 2XZGA 4CC9A 5FKTA 5FKRA 5EMKB 5M5SA 1A0RB 4J82A 3UVOA 3QI0A 4RE6A 2VZ3A 4BCBA 4NBMA 5H1MA 2P9NC 2QR5A 3V9FA 4CI1A 2P9SC 5CXCA 4A09A 2BBKH 4GQ1A 4JD2C 2IUQA 3IKOA 3OL2A 4J79A 4FAND 1L0QA 3K6SA 1MDAH 2VDPA 3C9CA 2VDMA 1PGUA 2CO0C 2CNXA 3EQ7A 3OKYB 2EIBA 2VDNA 2H6NA 3IUJA 5HE3B 2HKMA 4QQEA 3O4IA 4JSPC 2H6KA 3SBRA 4A2MA 5FLXg 4PBZA 1E8MA 4J81A 1H2XA 4L1MA 4PXWA 4CY3A 3MKQA 4G1EA 3IJCA 4J87A 4N14A 5EM2A 2P9LC 3PXWD 4JXMA 3EMHA 5EMJB 4MMYA 3N0EA 3CFVA 4DNWA 4O3UB 3U4YA 2AGXA 5EALA 4GGCA 4GQBB 4FA5D 4A0BB 4FB1D 4O9DA 3V5WB 4UM8A 5FKSA 2P9UC 5IGOA 2CE8A 5GMKn 5TEEA 3ZWLB 4J8GA 3UVNA 2B4EA 2HKRA 3FRXA 3OKTA 4E5ZB 1VZ2A 2CN3A 4O2WA 2AH0A 5HE0B 4BP8A 3JB9L 4ERZA 2OK4A 4A11B 2IAAA 3NIFA 4JSNC 4AMYA 3OF7A 3ZDZA 2VDRA 4HDJA 3I7HA 3I7OA 4OWRA 5CYKA 4ZOXA 2VZ1A 1GOGA 1GOTB 4NSXA 4D9SA 3BWSA 5M5UA 1PEVA 4ES0A 5IT9g 3I89A 2HXCA 2UZYB 4ZOVA 3JZNA 1XKSA 2HU7A 5CXBB 1VYHC 3SHFA 5EAMA 2XE4A 3JZHA 4D6VA 3IUQA 2I3SA 2H9PA 2H47A 2Z2PA 2XDWA 1P22A 4X60B 4MMZA 2H9MA 2B5NA 4JT6C 2WQ8A 2PM6B 4A08A 1C9LA 5E6RA 2EICA 4K3JB 3DXMC 3K72A 4TZ4A 2H13A 2PM9A 5TF2A 4CI3A 3UVLA 3UKUC 1SHYB 4AEZA 3EI1A 2MTAH 2OIZA 2VDQA 3GREA 4KFMB 4X3EA 5GXHA 1GP2B 4GM9A 4NAAA 2EIEA 3SCYA 2P9PC 1RI6A 1H2YA 3ODTA 4UI9R 1VE7A 4BH6A 3UR4A 1T2XA 2YNPA 1U2VC 1GOFA 5EARA 3T3PA 1GOHA 3NVXA 1XHMA 3KCIA 1QFMA 3MVDK 5HE2B 2B5MA 4WJKA 4CI8A 3AL8B 3ORVD 3DSMA 5FKQA 1BPOA 2AGLA 2HYEA 3IJ0A 2HJBA 3IURA 5TEFA 4BCDA 2BCJB 3PSLA 2O9KA 5K1CC 3GFCA 4CZVA 2P9KC 4CZXA 1OLZA 1I2MB 2I0TA 2P9IC 4I79A 5C2WB 3PE7A 2H3XA 2PM7B 4Z7NA 4OZUA 4GGDA 2XU7A 3AL9A 5CXCB 4A09B 1ERJA 3GD1I 4AOWA 2UZXB 3OL2B 3T3MA 4PSXB 4FWWA 3PSCB 1JJUB 4WK2A 3PVUB 3EI3A 3EU7A 2CN2A 4U1EI 3QHYB 4FA4D 4LG8A 1OMWB 3W15A 3VH0A 4J0WA 2QZPA 4J0XA 5C92A 1K32A 2IUPA 4QAMA 3ZE2A 1S4UX 3IULA 5HDBA 4X61B 5M5VA 5M5TA 2VC2A 5JWZA 2I0RA 4H5JA 1E8NA 3FGBA 1JMXB 3VI3A 5AFU3 3ULEC 2AH1A 2EIDA 4EWRA 5M5RA 1SQJA 5E6UA 5H14A 2JKXA 4A2LA 2AQ5A 3IUNA 2H9LA 5TDHB 2IUVA 5C2VB 4JSVC 3MKSB 4AX4A 4PNKB 2J57G 4GQ2P 3PVWB 4GMBA 4GM8A 3L4MD 4O45A 5EM2B 3I7NA 2GNQA 1H2ZA 1U8CA 2PBIB 4BCCA 3EQ8A 3E0CA 1QFSA 2H6QA 5K19A 2IURA 3AH8B 4IRZA 4Z7QA 3IIYA 3NVQA 3EI3B 1GXRA 3EI4A 5AMSA 3C99A 3IJ1A 4AN0A 4D0KA 4A0AA 3SXTD 4Y5RD 2HU5A 3MZLA 5IGQA 3BG0A 3FM0A 1UOOA 4J86A 3RRMC 3BG1A 1TBGA 3F3PA 4CZYA 1UTCA 2YNOA 5M61A 3I7LA 3UVMA 3DM0A 4U7AA 1YR2A 4G1MA 2IWKA 3EG6A 3VI4A 1QNIA 3UVKA 3SFZA 2OVRB 4FA9D 4AN1A
chains in the Genus database with same CATH topology
2AGWA 2QC5A 3J80g 4E54A 4YVDA 1B9XA 3K27A 5HYNB 5FXYA 3P4FA 5HQGA 3JZGA 1Q47A 3B7FA 4L3GD 4L1QD 4L9OA 4Y7RA 1N6FA 1R5MA 3PXTD 1MG2A 4PC0A 3MXXA 2XL2A 2CO0A 2Z2NA 3UKRC 5IJ8E 3J81g 3JAMg 3EI2A 3VGZA 2Q7QA 5CYKB 2W18A 3OKYA 3RFGA 2OJYA 4O3TB 3F3GA 4K3ID 5HE1B 3I7PA 2TRCB 5A2Qg 4IMMA 2AGZA 4ERYA 2GC4A 3I7KA 4QL1A 3SMRA 1PI6A 4QT8A 4R7AB 2OVQB 4E54B 4BUJC 1XIPA 4FAVD 1N6EA 1NEXB 2EBSA 3JRPA 2IWFA 4LGNA 2XL3A 4PBYA 3V7DB 5KDOB 4XYHA 3EWEA 3I8EA 2HJ4A 4CY1A 3KRXB 4J78A 2G9AA 3DWLC 2G99A 2YMUA 2GC7A 2QXVA 4A08B 3PXSD 3L4OD 2PM9B 3EI2B 3EI1B 4A0BA 3K26A 4ZN4A 3JPXA 2J55H 4ERQA 5EAPA 4CY5A 1SQ9A 1JOFA 2H14A 5B4WA 3C75H 4E5ZA 1GG2B 2OVPB 2YNNA 5C9ZB 2YB8B 1U4CA 2Z2OA 2I3TA 3NVNA 4J84A 5EMMB 3IIWA 4GM3A 4A11A 4X63B 4CY2A 3RSEC 2AGYA 3VA6A 4G56B 2I0SA 1B9YA 3RN1D 3SVWD 3RLMD 2OK6A 4PSWB 3SBPA 4J77A 5THAA 3RMZD 4H5IA 3HFQA 5GXIA 2XYIA 5FA5B 5IC7A 4L3HD 3SWSD 4BL0A 3A0FA 3OTTA 3RFHA 5CXBA 5FQDA 3RN0D 2H68A 4CI2A 4Z8LA 3OW8A 4J73A 4QRJA 2B5LA 3MMYA 5I5IA 3F3FA 4ZOYA 2CE9A 2YBAA 4IA9A 4FA1D 3AFCA 4J8BA 3MZKA 2J56H 1K8KC 1PBYB 3CIKB 4ESGA 5EMLB 4GGAA 3SJLD 2H9NA 4XEIC 1YFQA 3OKWA 3N0DA 5I5JA 3I8CA 5GSAA 3C5MA 4XYIA 3EI4B 4JT5C 4A0AB 3CFSB 3SN6B 3SLED 1JMZB 5I5MA 2HESX 4FHLA 4A7JA 4MK0B 1MG3A 1NR0A 1N6DA 5IJ7E 3AL8A 4JSXC 4O1QD 5H17A 4LG9A 3DXKC 3KRWB 3I2NA 3JROA 5AJAA 5SXMA 4GZ8A 4ZOZA 1FWXA 1TYQC 3SBQA 4CC9A 5FKTA 5FKRA 5EMKB 1A0RB 4J82A 3UVOA 5H1MA 2P9NC 3V9FA 4CI1A 2P9SC 5CXCA 4A09A 2BBKH 4GQ1A 4JD2C 2IUQA 3IKOA 3OL2A 4J79A 4FAND 1L0QA 1MDAH 3C9CA 1PGUA 2CO0C 2CNXA 3OKYB 2H6NA 5HE3B 2HKMA 4QQEA 4JSPC 2H6KA 3SBRA 4A2MA 5FLXg 4PBZA 4J81A 4PXWA 4CY3A 3MKQA 3IJCA 4J87A 4N14A 5EM2A 2P9LC 3PXWD 4JXMA 3EMHA 5EMJB 3N0EA 3CFVA 4O3UB 3U4YA 2AGXA 5EALA 4GGCA 4GQBB 4FA5D 4A0BB 4FB1D 4O9DA 3V5WB 5FKSA 2P9UC 5IGOA 2CE8A 5GMKn 5TEEA 3ZWLB 4J8GA 3UVNA 2B4EA 2HKRA 3FRXA 3OKTA 4E5ZB 2CN3A 2AH0A 5HE0B 3JB9L 4ERZA 2OK4A 4A11B 2IAAA 4JSNC 4HDJA 3I7HA 3I7OA 4OWRA 5CYKA 4ZOXA 1GOTB 4NSXA 3BWSA 1PEVA 4ES0A 5IT9g 3I89A 2HXCA 2UZYB 4ZOVA 3JZNA 1XKSA 5CXBB 1VYHC 3SHFA 5EAMA 3JZHA 4D6VA 2I3SA 2H9PA 2H47A 2Z2PA 1P22A 4X60B 2H9MA 2B5NA 4JT6C 2PM6B 4A08A 4K3JB 3DXMC 4TZ4A 2H13A 2PM9A 5TF2A 4CI3A 3UVLA 3UKUC 1SHYB 4AEZA 3EI1A 2MTAH 2OIZA 3GREA 4KFMB 4X3EA 5GXHA 1GP2B 4GM9A 3SCYA 2P9PC 1RI6A 3ODTA 4UI9R 4BH6A 3UR4A 2YNPA 1U2VC 5EARA 3NVXA 1XHMA 5HE2B 2B5MA 4CI8A 3AL8B 3ORVD 3DSMA 5FKQA 2AGLA 2HYEA 3IJ0A 2HJBA 5TEFA 2BCJB 3PSLA 2O9KA 5K1CC 3GFCA 4CZVA 2P9KC 4CZXA 1OLZA 2I0TA 2P9IC 4I79A 5C2WB 3PE7A 2H3XA 2PM7B 4OZUA 4GGDA 2XU7A 3AL9A 5CXCB 4A09B 1ERJA 4AOWA 2UZXB 3OL2B 4PSXB 4FWWA 3PSCB 1JJUB 3PVUB 3EI3A 3EU7A 2CN2A 4U1EI 4FA4D 4LG8A 1OMWB 3W15A 3VH0A 4J0WA 4J0XA 1K32A 2IUPA 1S4UX 4X61B 5JWZA 2I0RA 4H5JA 3FGBA 1JMXB 5AFU3 3ULEC 2AH1A 4EWRA 1SQJA 5H14A 4A2LA 2AQ5A 2H9LA 5TDHB 2IUVA 5C2VB 4JSVC 3MKSB 4PNKB 2J57G 4GQ2P 3PVWB 4GMBA 4GM8A 3L4MD 4O45A 5EM2B 3I7NA 2GNQA 2PBIB 3E0CA 2H6QA 5K19A 2IURA 3AH8B 3IIYA 3NVQA 3EI3B 1GXRA 3EI4A 5AMSA 3C99A 3IJ1A 4D0KA 4A0AA 3SXTD 4Y5RD 3MZLA 5IGQA 3BG0A 3FM0A 4J86A 3RRMC 3BG1A 1TBGA 3F3PA 4CZYA 2YNOA 3I7LA 3UVMA 3DM0A 4U7AA 2IWKA 3EG6A 1QNIA 3UVKA 3SFZA 2OVRB 4FA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  2QC5 A;  3J80 g;  4E54 A;  4YVD A;  1B9X A;  3K27 A;  5HYN B;  5FXY A;  3P4F A;  5HQG A;  3JZG A;  1Q47 A;  3B7F A;  4L3G D;  4L1Q D;  4L9O A;  4Y7R A;  1N6F A;  1R5M A;  3PXT D;  1MG2 A;  4PC0 A;  3MXX A;  2XL2 A;  2CO0 A;  2Z2N A;  3UKR C;  5IJ8 E;  3J81 g;  3JAM g;  3EI2 A;  3VGZ A;  2Q7Q A;  5CYK B;  2W18 A;  3OKY A;  3RFG A;  2OJY A;  4O3T B;  3F3G A;  4K3I D;  5HE1 B;  3I7P A;  2TRC B;  5A2Q g;  4IMM A;  2AGZ A;  4ERY A;  2GC4 A;  3I7K A;  4QL1 A;  3SMR A;  1PI6 A;  4QT8 A;  4R7A B;  2OVQ B;  4E54 B;  4BUJ C;  1XIP A;  4FAV D;  1N6E A;  1NEX B;  2EBS A;  3JRP A;  2IWF A;  4LGN A;  2XL3 A;  4PBY A;  3V7D B;  5KDO B;  4XYH A;  3EWE A;  3I8E A;  2HJ4 A;  4CY1 A;  3KRX B;  4J78 A;  2G9A A;  3DWL C;  2G99 A;  2YMU A;  2GC7 A;  2QXV A;  4A08 B;  3PXS D;  3L4O D;  2PM9 B;  3EI2 B;  3EI1 B;  4A0B A;  3K26 A;  4ZN4 A;  3JPX A;  2J55 H;  4ERQ A;  5EAP A;  4CY5 A;  1SQ9 A;  1JOF A;  2H14 A;  5B4W A;  3C75 H;  4E5Z A;  1GG2 B;  2OVP B;  2YNN A;  5C9Z B;  2YB8 B;  1U4C A;  2Z2O A;  2I3T A;  3NVN A;  4J84 A;  5EMM B;  3IIW A;  4GM3 A;  4A11 A;  4X63 B;  4CY2 A;  3RSE C;  2AGY A;  3VA6 A;  4G56 B;  2I0S A;  1B9Y A;  3RN1 D;  3SVW D;  3RLM D;  2OK6 A;  4PSW B;  3SBP A;  4J77 A;  5THA A;  3RMZ D;  4H5I A;  3HFQ A;  5GXI A;  2XYI A;  5FA5 B;  5IC7 A;  4L3H D;  3SWS D;  4BL0 A;  3A0F A;  3OTT A;  3RFH A;  5CXB A;  5FQD A;  3RN0 D;  2H68 A;  4CI2 A;  4Z8L A;  3OW8 A;  4J73 A;  4QRJ A;  2B5L A;  3MMY A;  5I5I A;  3F3F A;  4ZOY A;  2CE9 A;  2YBA A;  4IA9 A;  4FA1 D;  3AFC A;  4J8B A;  3MZK A;  2J56 H;  1K8K C;  1PBY B;  3CIK B;  4ESG A;  5EML B;  4GGA A;  3SJL D;  2H9N A;  4XEI C;  1YFQ A;  3OKW A;  3N0D A;  5I5J A;  3I8C A;  5GSA A;  3C5M A;  4XYI A;  3EI4 B;  4JT5 C;  4A0A B;  3CFS B;  3SN6 B;  3SLE D;  1JMZ B;  5I5M A;  2HES X;  4FHL A;  4A7J A;  4MK0 B;  1MG3 A;  1NR0 A;  1N6D A;  5IJ7 E;  3AL8 A;  4JSX C;  4O1Q D;  5H17 A;  4LG9 A;  3DXK C;  3KRW B;  3I2N A;  3JRO A;  5AJA A;  5SXM A;  4GZ8 A;  4ZOZ A;  1FWX A;  1TYQ C;  3SBQ A;  4CC9 A;  5FKT A;  5FKR A;  5EMK B;  1A0R B;  4J82 A;  3UVO A;  5H1M A;  2P9N C;  3V9F A;  4CI1 A;  2P9S C;  5CXC A;  4A09 A;  2BBK H;  4GQ1 A;  4JD2 C;  2IUQ A;  3IKO A;  3OL2 A;  4J79 A;  4FAN D;  1L0Q A;  1MDA H;  3C9C A;  1PGU A;  2CO0 C;  2CNX A;  3OKY B;  2H6N A;  5HE3 B;  2HKM A;  4QQE A;  4JSP C;  2H6K A;  3SBR A;  4A2M A;  5FLX g;  4PBZ A;  4J81 A;  4PXW A;  4CY3 A;  3MKQ A;  3IJC A;  4J87 A;  4N14 A;  5EM2 A;  2P9L C;  3PXW D;  4JXM A;  3EMH A;  5EMJ B;  3N0E A;  3CFV A;  4O3U B;  3U4Y A;  2AGX A;  5EAL A;  4GGC A;  4GQB B;  4FA5 D;  4A0B B;  4FB1 D;  4O9D A;  3V5W B;  5FKS A;  2P9U C;  5IGO A;  2CE8 A;  5GMK n;  5TEE A;  3ZWL B;  4J8G A;  3UVN A;  2B4E A;  2HKR A;  3FRX A;  3OKT A;  4E5Z B;  2CN3 A;  2AH0 A;  5HE0 B;  3JB9 L;  4ERZ A;  2OK4 A;  4A11 B;  2IAA A;  4JSN C;  4HDJ A;  3I7H A;  3I7O A;  4OWR A;  5CYK A;  4ZOX A;  1GOT B;  4NSX A;  3BWS A;  1PEV A;  4ES0 A;  5IT9 g;  3I89 A;  2HXC A;  2UZY B;  4ZOV A;  3JZN A;  1XKS A;  5CXB B;  1VYH C;  3SHF A;  5EAM A;  3JZH A;  4D6V A;  2I3S A;  2H9P A;  2H47 A;  2Z2P A;  1P22 A;  4X60 B;  2H9M A;  2B5N A;  4JT6 C;  2PM6 B;  4A08 A;  4K3J B;  3DXM C;  4TZ4 A;  2H13 A;  2PM9 A;  5TF2 A;  4CI3 A;  3UVL A;  3UKU C;  1SHY B;  4AEZ A;  3EI1 A;  2MTA H;  2OIZ A;  3GRE A;  4KFM B;  4X3E A;  5GXH A;  1GP2 B;  4GM9 A;  3SCY A;  2P9P C;  1RI6 A;  3ODT A;  4UI9 R;  4BH6 A;  3UR4 A;  2YNP A;  1U2V C;  5EAR A;  3NVX A;  1XHM A;  5HE2 B;  2B5M A;  4CI8 A;  3AL8 B;  3ORV D;  3DSM A;  5FKQ A;  2AGL A;  2HYE A;  3IJ0 A;  2HJB A;  5TEF A;  2BCJ B;  3PSL A;  2O9K A;  5K1C C;  3GFC A;  4CZV A;  2P9K C;  4CZX A;  1OLZ A;  2I0T A;  2P9I C;  4I79 A;  5C2W B;  3PE7 A;  2H3X A;  2PM7 B;  4OZU A;  4GGD A;  2XU7 A;  3AL9 A;  5CXC B;  4A09 B;  1ERJ A;  4AOW A;  2UZX B;  3OL2 B;  4PSX B;  4FWW A;  3PSC B;  1JJU B;  3PVU B;  3EI3 A;  3EU7 A;  2CN2 A;  4U1E I;  4FA4 D;  4LG8 A;  1OMW B;  3W15 A;  3VH0 A;  4J0W A;  4J0X A;  1K32 A;  2IUP A;  1S4U X;  4X61 B;  5JWZ A;  2I0R A;  4H5J A;  3FGB A;  1JMX B;  5AFU 3;  3ULE C;  2AH1 A;  4EWR A;  1SQJ A;  5H14 A;  4A2L A;  2AQ5 A;  2H9L A;  5TDH B;  2IUV A;  5C2V B;  4JSV C;  3MKS B;  4PNK B;  2J57 G;  4GQ2 P;  3PVW B;  4GMB A;  4GM8 A;  3L4M D;  4O45 A;  5EM2 B;  3I7N A;  2GNQ A;  2PBI B;  3E0C A;  2H6Q A;  5K19 A;  2IUR A;  3AH8 B;  3IIY A;  3NVQ A;  3EI3 B;  1GXR A;  3EI4 A;  5AMS A;  3C99 A;  3IJ1 A;  4D0K A;  4A0A A;  3SXT D;  4Y5R D;  3MZL A;  5IGQ A;  3BG0 A;  3FM0 A;  4J86 A;  3RRM C;  3BG1 A;  1TBG A;  3F3P A;  4CZY A;  2YNO A;  3I7L A;  3UVM A;  3DM0 A;  4U7A A;  2IWK A;  3EG6 A;  1QNI A;  3UVK A;  3SFZ A;  2OVR B;  4FA9 D; 
#chains in the Genus database with same CATH topology
 2AGW A;  2QC5 A;  4DNV A;  3J80 g;  4E54 A;  4YVD A;  1B9X A;  1O6F A;  3K27 A;  1VZ3 A;  1UOQ A;  5HYN B;  5FXY A;  3P4F A;  5HQG A;  3JZG A;  3IUM A;  1Q47 A;  3B7F A;  4L3G D;  4L1Q D;  4L9O A;  4Y7R A;  1VE6 A;  5FFO A;  4Z7O A;  1N6F A;  1R5M A;  3PXT D;  1MG2 A;  4PC0 A;  4AMZ A;  3MXX A;  2XL2 A;  3DDU A;  2CO0 A;  2Z2N A;  4O02 A;  3UKR C;  5IJ8 E;  3J81 g;  2VDL A;  3JAM g;  3EI2 A;  3VGZ A;  2HU8 A;  2Q7Q A;  4UM9 A;  5CYK B;  2W18 A;  3OKY A;  3RFG A;  1C9I A;  2OJY A;  4O3T B;  3F3G A;  4K3I D;  5HE1 B;  3I7P A;  2TRC B;  3IVM A;  1TYE A;  5A2Q g;  4IMM A;  2AGZ A;  4ERY A;  2GC4 A;  3I7K A;  4QL1 A;  3NID A;  3SMR A;  1PI6 A;  4QT8 A;  4R7A B;  4G55 A;  2OVQ B;  4E54 B;  4BUJ C;  1XIP A;  4FAV D;  1N6E A;  1NEX B;  2EBS A;  3JRP A;  2IWF A;  4LGN A;  2XL3 A;  3O4G A;  4PBY A;  4NC4 A;  3V7D B;  5KDO B;  4XYH A;  3EWE A;  3I8E A;  2HJ4 A;  4CY1 A;  3KRX B;  4J78 A;  2G9A A;  3DWL C;  2G99 A;  2YMU A;  2GC7 A;  2QXV A;  4A08 B;  3PXS D;  3L4O D;  2PM9 B;  3ZDY A;  1UOP A;  3EI2 B;  3MUN A;  3EI1 B;  3O4J A;  4A0B A;  4WK4 A;  3K26 A;  4ZN4 A;  3JPX A;  2J55 H;  4ERQ A;  3ZE0 A;  5EAP A;  4CY5 A;  1SQ9 A;  1JOF A;  2H14 A;  4BP9 A;  5B4W A;  3C75 H;  4E5Z A;  1GG2 B;  2OVP B;  2YNN A;  2VDO A;  5C9Z B;  2YB8 B;  1U4C A;  2Z2O A;  2I3T A;  3NVN A;  1M1X A;  4J84 A;  4JHP C;  5E6S A;  3IIW A;  4GM3 A;  4A11 A;  4X63 B;  5EMM B;  4CY2 A;  3RSE C;  5FFG A;  2AGY A;  3MUO A;  4G56 B;  3VA6 A;  2I0S A;  1B9Y A;  3GC3 B;  3RN1 D;  3SVW D;  3RLM D;  2OK6 A;  4PSW B;  3SBP A;  4J77 A;  5THA A;  3RMZ D;  4H5I A;  3HFQ A;  5GXI A;  2XYI A;  3FCU A;  5FA5 B;  5IC7 A;  4L3H D;  3SWS D;  4BL0 A;  3A0F A;  3K71 A;  3OTT A;  3RFH A;  5CXB A;  5FQD A;  3IJE A;  3RN0 D;  2H68 A;  4WK0 A;  4Z8L A;  4CI2 A;  3OW8 A;  4J73 A;  4QRJ A;  2BKL A;  1A12 A;  2B5L A;  4DNU A;  3MMY A;  5I5I A;  3F3F A;  4ZOY A;  2CE9 A;  3V4V A;  2YBA A;  4IA9 A;  4FA1 D;  1O6G A;  3AFC A;  4J8B A;  3EQ9 A;  3MZK A;  2J56 H;  1K8K C;  3ZE1 A;  1PBY B;  5C86 A;  3CIK B;  1JTD B;  4ESG A;  1L5G A;  5EML B;  4MMX A;  4GGA A;  3SJL D;  1JV2 A;  2H9N A;  4XEI C;  4JHN A;  3ZDX A;  1YFQ A;  3OKW A;  3N0D A;  5I5J A;  3I8C A;  5GSA A;  3C5M A;  1K3I A;  4XYI A;  3EI4 B;  4JT5 C;  4A0A B;  3CFS B;  4NEN A;  3SN6 B;  3SLE D;  1JMZ B;  5I5M A;  2HES X;  4FHL A;  3V4P A;  4A7J A;  4MK0 B;  2VDK A;  4RE5 A;  1MG3 A;  1NR0 A;  1H2W A;  1N6D A;  5IJ7 E;  3AL8 A;  3NIG A;  4JSX C;  4O1Q D;  5H17 A;  4LG9 A;  3DXK C;  3KRW B;  3I2N A;  3JRO A;  5AJA A;  5SXM A;  4GZ8 A;  4ZOZ A;  1FWX A;  3O4H A;  1TYQ C;  1E5T A;  3SBQ A;  3FCS A;  2XZG A;  4CC9 A;  5FKT A;  5FKR A;  5EMK B;  5M5S A;  1A0R B;  4J82 A;  3UVO A;  3QI0 A;  4RE6 A;  2VZ3 A;  4BCB A;  4NBM A;  5H1M A;  2P9N C;  2QR5 A;  3V9F A;  4CI1 A;  2P9S C;  5CXC A;  4A09 A;  2BBK H;  4GQ1 A;  4JD2 C;  2IUQ A;  3IKO A;  3OL2 A;  4J79 A;  4FAN D;  1L0Q A;  3K6S A;  1MDA H;  2VDP A;  3C9C A;  2VDM A;  1PGU A;  2CO0 C;  2CNX A;  3EQ7 A;  3OKY B;  2EIB A;  2VDN A;  2H6N A;  3IUJ A;  5HE3 B;  2HKM A;  4QQE A;  3O4I A;  4JSP C;  2H6K A;  3SBR A;  4A2M A;  5FLX g;  4PBZ A;  1E8M A;  4J81 A;  1H2X A;  4L1M A;  4PXW A;  4CY3 A;  3MKQ A;  4G1E A;  3IJC A;  4J87 A;  4N14 A;  5EM2 A;  2P9L C;  3PXW D;  4JXM A;  3EMH A;  5EMJ B;  4MMY A;  3N0E A;  3CFV A;  4DNW A;  4O3U B;  3U4Y A;  2AGX A;  5EAL A;  4GGC A;  4GQB B;  4FA5 D;  4A0B B;  4FB1 D;  4O9D A;  3V5W B;  4UM8 A;  5FKS A;  2P9U C;  5IGO A;  2CE8 A;  5GMK n;  5TEE A;  3ZWL B;  4J8G A;  3UVN A;  2B4E A;  2HKR A;  3FRX A;  3OKT A;  4E5Z B;  1VZ2 A;  2CN3 A;  4O2W A;  2AH0 A;  5HE0 B;  4BP8 A;  3JB9 L;  4ERZ A;  2OK4 A;  4A11 B;  2IAA A;  3NIF A;  4JSN C;  4AMY A;  3OF7 A;  3ZDZ A;  2VDR A;  4HDJ A;  3I7H A;  3I7O A;  4OWR A;  5CYK A;  4ZOX A;  2VZ1 A;  1GOG A;  1GOT B;  4NSX A;  4D9S A;  3BWS A;  5M5U A;  1PEV A;  4ES0 A;  5IT9 g;  3I89 A;  2HXC A;  2UZY B;  4ZOV A;  3JZN A;  1XKS A;  2HU7 A;  5CXB B;  1VYH C;  3SHF A;  5EAM A;  2XE4 A;  3JZH A;  4D6V A;  3IUQ A;  2I3S A;  2H9P A;  2H47 A;  2Z2P A;  2XDW A;  1P22 A;  4X60 B;  4MMZ A;  2H9M A;  2B5N A;  4JT6 C;  2WQ8 A;  2PM6 B;  4A08 A;  1C9L A;  5E6R A;  2EIC A;  4K3J B;  3DXM C;  3K72 A;  4TZ4 A;  2H13 A;  2PM9 A;  5TF2 A;  4CI3 A;  3UVL A;  3UKU C;  1SHY B;  4AEZ A;  3EI1 A;  2MTA H;  2OIZ A;  2VDQ A;  3GRE A;  4KFM B;  4X3E A;  5GXH A;  1GP2 B;  4GM9 A;  4NAA A;  2EIE A;  3SCY A;  2P9P C;  1RI6 A;  1H2Y A;  3ODT A;  4UI9 R;  1VE7 A;  4BH6 A;  3UR4 A;  1T2X A;  2YNP A;  1U2V C;  1GOF A;  5EAR A;  3T3P A;  1GOH A;  3NVX A;  1XHM A;  3KCI A;  1QFM A;  3MVD K;  5HE2 B;  2B5M A;  4WJK A;  4CI8 A;  3AL8 B;  3ORV D;  3DSM A;  5FKQ A;  1BPO A;  2AGL A;  2HYE A;  3IJ0 A;  2HJB A;  3IUR A;  5TEF A;  4BCD A;  2BCJ B;  3PSL A;  2O9K A;  5K1C C;  3GFC A;  4CZV A;  2P9K C;  4CZX A;  1OLZ A;  1I2M B;  2I0T A;  2P9I C;  4I79 A;  5C2W B;  3PE7 A;  2H3X A;  2PM7 B;  4Z7N A;  4OZU A;  4GGD A;  2XU7 A;  3AL9 A;  5CXC B;  4A09 B;  1ERJ A;  3GD1 I;  4AOW A;  2UZX B;  3OL2 B;  3T3M A;  4PSX B;  4FWW A;  3PSC B;  1JJU B;  4WK2 A;  3PVU B;  3EI3 A;  3EU7 A;  2CN2 A;  4U1E I;  3QHY B;  4FA4 D;  4LG8 A;  1OMW B;  3W15 A;  3VH0 A;  4J0W A;  2QZP A;  4J0X A;  5C92 A;  1K32 A;  2IUP A;  4QAM A;  3ZE2 A;  1S4U X;  3IUL A;  5HDB A;  4X61 B;  5M5V A;  5M5T A;  2VC2 A;  5JWZ A;  2I0R A;  4H5J A;  1E8N A;  3FGB A;  1JMX B;  3VI3 A;  5AFU 3;  3ULE C;  2AH1 A;  2EID A;  4EWR A;  5M5R A;  1SQJ A;  5E6U A;  5H14 A;  2JKX A;  4A2L A;  2AQ5 A;  3IUN A;  2H9L A;  5TDH B;  2IUV A;  5C2V B;  4JSV C;  3MKS B;  4AX4 A;  4PNK B;  2J57 G;  4GQ2 P;  3PVW B;  4GMB A;  4GM8 A;  3L4M D;  4O45 A;  5EM2 B;  3I7N A;  2GNQ A;  1H2Z A;  1U8C A;  2PBI B;  4BCC A;  3EQ8 A;  3E0C A;  1QFS A;  2H6Q A;  5K19 A;  2IUR A;  3AH8 B;  4IRZ A;  4Z7Q A;  3IIY A;  3NVQ A;  3EI3 B;  1GXR A;  3EI4 A;  5AMS A;  3C99 A;  3IJ1 A;  4AN0 A;  4D0K A;  4A0A A;  3SXT D;  4Y5R D;  2HU5 A;  3MZL A;  5IGQ A;  3BG0 A;  3FM0 A;  1UOO A;  4J86 A;  3RRM C;  3BG1 A;  1TBG A;  3F3P A;  4CZY A;  1UTC A;  2YNO A;  5M61 A;  3I7L A;  3UVM A;  3DM0 A;  4U7A A;  1YR2 A;  4G1M A;  2IWK A;  3EG6 A;  3VI4 A;  1QNI A;  3UVK A;  3SFZ A;  2OVR B;  4FA9 D;  4AN1 A; 
#chains in the Genus database with same CATH homology
 2AGW A;  2QC5 A;  3J80 g;  4E54 A;  4YVD A;  1B9X A;  3K27 A;  5HYN B;  5FXY A;  3P4F A;  5HQG A;  3JZG A;  1Q47 A;  3B7F A;  4L3G D;  4L1Q D;  4L9O A;  4Y7R A;  1N6F A;  1R5M A;  3PXT D;  1MG2 A;  4PC0 A;  3MXX A;  2XL2 A;  2CO0 A;  2Z2N A;  3UKR C;  5IJ8 E;  3J81 g;  3JAM g;  3EI2 A;  3VGZ A;  2Q7Q A;  5CYK B;  2W18 A;  3OKY A;  3RFG A;  2OJY A;  4O3T B;  3F3G A;  4K3I D;  5HE1 B;  3I7P A;  2TRC B;  5A2Q g;  4IMM A;  2AGZ A;  4ERY A;  2GC4 A;  3I7K A;  4QL1 A;  3SMR A;  1PI6 A;  4QT8 A;  4R7A B;  2OVQ B;  4E54 B;  4BUJ C;  1XIP A;  4FAV D;  1N6E A;  1NEX B;  2EBS A;  3JRP A;  2IWF A;  4LGN A;  2XL3 A;  4PBY A;  3V7D B;  5KDO B;  4XYH A;  3EWE A;  3I8E A;  2HJ4 A;  4CY1 A;  3KRX B;  4J78 A;  2G9A A;  3DWL C;  2G99 A;  2YMU A;  2GC7 A;  2QXV A;  4A08 B;  3PXS D;  3L4O D;  2PM9 B;  3EI2 B;  3EI1 B;  4A0B A;  3K26 A;  4ZN4 A;  3JPX A;  2J55 H;  4ERQ A;  5EAP A;  4CY5 A;  1SQ9 A;  1JOF A;  2H14 A;  5B4W A;  3C75 H;  4E5Z A;  1GG2 B;  2OVP B;  2YNN A;  5C9Z B;  2YB8 B;  1U4C A;  2Z2O A;  2I3T A;  3NVN A;  4J84 A;  5EMM B;  3IIW A;  4GM3 A;  4A11 A;  4X63 B;  4CY2 A;  3RSE C;  2AGY A;  3VA6 A;  4G56 B;  2I0S A;  1B9Y A;  3RN1 D;  3SVW D;  3RLM D;  2OK6 A;  4PSW B;  3SBP A;  4J77 A;  5THA A;  3RMZ D;  4H5I A;  3HFQ A;  5GXI A;  2XYI A;  5FA5 B;  5IC7 A;  4L3H D;  3SWS D;  4BL0 A;  3A0F A;  3OTT A;  3RFH A;  5CXB A;  5FQD A;  3RN0 D;  2H68 A;  4CI2 A;  4Z8L A;  3OW8 A;  4J73 A;  4QRJ A;  2B5L A;  3MMY A;  5I5I A;  3F3F A;  4ZOY A;  2CE9 A;  2YBA A;  4IA9 A;  4FA1 D;  3AFC A;  4J8B A;  3MZK A;  2J56 H;  1K8K C;  1PBY B;  3CIK B;  4ESG A;  5EML B;  4GGA A;  3SJL D;  2H9N A;  4XEI C;  1YFQ A;  3OKW A;  3N0D A;  5I5J A;  3I8C A;  5GSA A;  3C5M A;  4XYI A;  3EI4 B;  4JT5 C;  4A0A B;  3CFS B;  3SN6 B;  3SLE D;  1JMZ B;  5I5M A;  2HES X;  4FHL A;  4A7J A;  4MK0 B;  1MG3 A;  1NR0 A;  1N6D A;  5IJ7 E;  3AL8 A;  4JSX C;  4O1Q D;  5H17 A;  4LG9 A;  3DXK C;  3KRW B;  3I2N A;  3JRO A;  5AJA A;  5SXM A;  4GZ8 A;  4ZOZ A;  1FWX A;  1TYQ C;  3SBQ A;  4CC9 A;  5FKT A;  5FKR A;  5EMK B;  1A0R B;  4J82 A;  3UVO A;  5H1M A;  2P9N C;  3V9F A;  4CI1 A;  2P9S C;  5CXC A;  4A09 A;  2BBK H;  4GQ1 A;  4JD2 C;  2IUQ A;  3IKO A;  3OL2 A;  4J79 A;  4FAN D;  1L0Q A;  1MDA H;  3C9C A;  1PGU A;  2CO0 C;  2CNX A;  3OKY B;  2H6N A;  5HE3 B;  2HKM A;  4QQE A;  4JSP C;  2H6K A;  3SBR A;  4A2M A;  5FLX g;  4PBZ A;  4J81 A;  4PXW A;  4CY3 A;  3MKQ A;  3IJC A;  4J87 A;  4N14 A;  5EM2 A;  2P9L C;  3PXW D;  4JXM A;  3EMH A;  5EMJ B;  3N0E A;  3CFV A;  4O3U B;  3U4Y A;  2AGX A;  5EAL A;  4GGC A;  4GQB B;  4FA5 D;  4A0B B;  4FB1 D;  4O9D A;  3V5W B;  5FKS A;  2P9U C;  5IGO A;  2CE8 A;  5GMK n;  5TEE A;  3ZWL B;  4J8G A;  3UVN A;  2B4E A;  2HKR A;  3FRX A;  3OKT A;  4E5Z B;  2CN3 A;  2AH0 A;  5HE0 B;  3JB9 L;  4ERZ A;  2OK4 A;  4A11 B;  2IAA A;  4JSN C;  4HDJ A;  3I7H A;  3I7O A;  4OWR A;  5CYK A;  4ZOX A;  1GOT B;  4NSX A;  3BWS A;  1PEV A;  4ES0 A;  5IT9 g;  3I89 A;  2HXC A;  2UZY B;  4ZOV A;  3JZN A;  1XKS A;  5CXB B;  1VYH C;  3SHF A;  5EAM A;  3JZH A;  4D6V A;  2I3S A;  2H9P A;  2H47 A;  2Z2P A;  1P22 A;  4X60 B;  2H9M A;  2B5N A;  4JT6 C;  2PM6 B;  4A08 A;  4K3J B;  3DXM C;  4TZ4 A;  2H13 A;  2PM9 A;  5TF2 A;  4CI3 A;  3UVL A;  3UKU C;  1SHY B;  4AEZ A;  3EI1 A;  2MTA H;  2OIZ A;  3GRE A;  4KFM B;  4X3E A;  5GXH A;  1GP2 B;  4GM9 A;  3SCY A;  2P9P C;  1RI6 A;  3ODT A;  4UI9 R;  4BH6 A;  3UR4 A;  2YNP A;  1U2V C;  5EAR A;  3NVX A;  1XHM A;  5HE2 B;  2B5M A;  4CI8 A;  3AL8 B;  3ORV D;  3DSM A;  5FKQ A;  2AGL A;  2HYE A;  3IJ0 A;  2HJB A;  5TEF A;  2BCJ B;  3PSL A;  2O9K A;  5K1C C;  3GFC A;  4CZV A;  2P9K C;  4CZX A;  1OLZ A;  2I0T A;  2P9I C;  4I79 A;  5C2W B;  3PE7 A;  2H3X A;  2PM7 B;  4OZU A;  4GGD A;  2XU7 A;  3AL9 A;  5CXC B;  4A09 B;  1ERJ A;  4AOW A;  2UZX B;  3OL2 B;  4PSX B;  4FWW A;  3PSC B;  1JJU B;  3PVU B;  3EI3 A;  3EU7 A;  2CN2 A;  4U1E I;  4FA4 D;  4LG8 A;  1OMW B;  3W15 A;  3VH0 A;  4J0W A;  4J0X A;  1K32 A;  2IUP A;  1S4U X;  4X61 B;  5JWZ A;  2I0R A;  4H5J A;  3FGB A;  1JMX B;  5AFU 3;  3ULE C;  2AH1 A;  4EWR A;  1SQJ A;  5H14 A;  4A2L A;  2AQ5 A;  2H9L A;  5TDH B;  2IUV A;  5C2V B;  4JSV C;  3MKS B;  4PNK B;  2J57 G;  4GQ2 P;  3PVW B;  4GMB A;  4GM8 A;  3L4M D;  4O45 A;  5EM2 B;  3I7N A;  2GNQ A;  2PBI B;  3E0C A;  2H6Q A;  5K19 A;  2IUR A;  3AH8 B;  3IIY A;  3NVQ A;  3EI3 B;  1GXR A;  3EI4 A;  5AMS A;  3C99 A;  3IJ1 A;  4D0K A;  4A0A A;  3SXT D;  4Y5R D;  3MZL A;  5IGQ A;  3BG0 A;  3FM0 A;  4J86 A;  3RRM C;  3BG1 A;  1TBG A;  3F3P A;  4CZY A;  2YNO A;  3I7L A;  3UVM A;  3DM0 A;  4U7A A;  2IWK A;  3EG6 A;  1QNI A;  3UVK A;  3SFZ A;  2OVR B;  4FA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...