4CZVA

Structure of the neurospora crassa pan2 wd40 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
324
structure length
324
Chain Sequence
b'PHMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
total genus 76
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czvA00
2P9IC 2HXCA 4J8BA 4J0XA 4JD2C 5CXBA 4XEIC 2CN2A 3OL2A 4CY2A 2AGLA 1GOTB 2GC7A 3VGZA 4N14A 3EI1B 5I5MA 2IWFA 4O3UB 4Y7RA 3JZGA 4U1EI 3AL8A 5CYKA 4J79A 3UVMA 3NVQA 3GFCA 1XHMA 2P9PC 1L0QA 3NVNA 1P22A 4CY3A 4J84A 1NR0A 3BWSA 4CI8A 4X3EA 3PXWD 2H13A 1S4UX 4PSXB 5K19A 4E5ZB 5C2WB 2H9MA 2Z2OA 1TYQC 2H6KA 1R5MA 2Q7QA 5FXYA 3EI3A 4A0AA 1MDAH 5TDHB 3I7LA 4IA9A 4OZUA 5AFU3 3L4OD 4FB1D 3F3FA 5IJ8E 5HE2B 2AH1A 3V5WB 1N6EA 1GXRA 4K3JB 2MTAH 3PE7A 2P9SC 2BBKH 3ODTA 5AMSA 2I0RA 2B5MA 4J73A 5TEEA 4A11B 3FM0A 2B5NA 4X63B 3N0EA 2Z2PA 4JT5C 3EI1A 1N6FA 5CXBB 3A0FA 3HFQA 3OL2B 5IGOA 4UI9R 1JMZB 5H1MA 2HJ4A 2H3XA 4Y5RD 5HQGA 3AL8B 4QQEA 5FLXg 3B7FA 3RN0D 4FWWA 3KRXB 2CE8A 2W18A 3RFHA 1VYHC 4FHLA 4J82A 1YFQA 1FWXA 5THAA 3UKUC 3JRPA 4CC9A 4CY5A 4X60B 4E5ZA 4AEZA 3UKRC 1RI6A 3IJCA 4BL0A 5AJAA 5GSAA 2OK4A 3BG0A 1SHYB 3OTTA 2I0TA 3V7DB 5GMKn 4JSVC 5EMJB 1K32A 3EI3B 4KFMB 4A2LA 5HE3B 4ZOVA 5EARA 4R7AB 5C2VB 2H9NA 3KRWB 5KDOB 2OK6A 1XKSA 4CZVA 5FA5B 4A11A 3OW8A 3GREA 3UVNA 3NVXA 2UZXB 4XYIA 4PSWB 3SMRA 2UZYB 4J0WA 4J86A 4QT8A 3ZWLB 2QC5A 2IUVA 3C5MA 3SXTD 4ESGA 4L1QD 5JWZA 5GXHA 5IJ7E 3MZLA 3PVWB 2CO0C 2PBIB 3E0CA 3I89A 3RFGA 5K1CC 2CE9A 2H6NA 2OVQB 1OLZA 4ERZA 5SXMA 3EWEA 4A09A 4CI2A 4GGDA 5A2Qg 3CFVA 1SQJA 4H5JA 4NSXA 2PM7B 2HESX 4MK0B 4GQ1A 3EI4B 3FRXA 5TEFA 5IGQA 4O1QD 2YNOA 3IJ1A 2P9NC 3DXKC 3OKYA 2H6QA 3IKOA 3OKTA 3I8EA 4AOWA 4FA9D 2IAAA 4L3HD 2IWKA 1MG2A 3RLMD 4TZ4A 4FA5D 5HYNB 2I0SA 5I5JA 5GXIA 4J77A 3UVLA 5B4WA 5C9ZB 3IIYA 4A08A 3PXSD 2YB8B 4CI1A 5CXCA 2OVPB 3RMZD 4ZOXA 5FKQA 1PI6A 3SHFA 3C9CA 3I7KA 4ZOZA 4A7JA 2IUPA 2HYEA 5HE1B 3DSMA 3UVOA 3UVKA 2HJBA 2AH0A 4H5IA 4JXMA 2BCJB 2AGYA 4EWRA 1PBYB 2B5LA 1Q47A 4J8GA 3JB9L 4GM3A 2HKMA 3EMHA 4JT6C 3DWLC 1JOFA 4GGAA 4LG8A 5EMLB 3VA6A 4A09B 3EI2A 2P9LC 3MZKA 1JJUB 1TBGA 4GQBB 3ULEC 2CNXA 4PBZA 3EI4A 2OJYA 3I7PA 2B4EA 3K27A 4J87A 4QL1A 3MMYA 1GG2B 3SCYA 2PM9B 3CFSB 2YNPA 5TF2A 4FAVD 3F3PA 4O45A 4JSXC 2J57G 4GM8A 1U2VC 5I5IA 3I2NA 2OVRB 3OKYB 2G99A 3ORVD 1SQ9A 1K8KC 5FQDA 4CI3A 5IT9g 4LG9A 3JPXA 3SWSD 4OWRA 2XU7A 1A0RB 1JMXB 2AGXA 5HE0B 3I7HA 3RN1D 4A08B 2AQ5A 1NEXB 2G9AA 3IJ0A 4FAND 5CXCB 4ZN4A 4D0KA 3SN6B 3SVWD 4L9OA 2IUQA 1U4CA 3EG6A 4GM9A 4PC0A 4IMMA 3W15A 4ERYA 3JAMg 2GC4A 4HDJA 4G56B 2CO0A 4D6VA 5EM2B 5H14A 1B9XA 3DM0A 3PSLA 3JZNA 2H9LA 3EI2B 3OKWA 3DXMC 2OIZA 4A0BA 2AGZA 2PM9A 4E54A 3SLED 4JSPC 2H68A 4O9DA 1B9YA 3MXXA 2H14A 2YBAA 2YNNA 3J81g 3AH8B 3C75H 5FKSA 4GGCA 4CY1A 3V9FA 4GQ2P 1MG3A 4YVDA 4FA4D 2XL3A 3CIKB 3EU7A 4A2MA 3BG1A 4O3TB 2I3SA 4J78A 3RSEC 3SBPA 3IIWA 5EAMA 4ERQA 2H47A 3AFCA 3MKSB 4CZXA 2TRCB 5EALA 2O9KA 5EMMB 3C99A 2IURA 4PNKB 1ERJA 4I79A 3SBQA 4U7AA 2J55H 2Z2NA 1PEVA 3MKQA 1XIPA 2P9UC 3I8CA 4QRJA 5EM2A 4CZYA 3N0DA 4BUJC 3J80g 3VH0A 1GP2B 1OMWB 2I3TA 4PBYA 3AL9A 3UR4A 3K26A 3F3GA 5FKTA 3SJLD 4JSNC 1QNIA 5CYKB 5IC7A 4A0BB 3FGBA 1N6DA 3I7NA 4PXWA 3SFZA 2P9KC 4GZ8A 4E54B 2EBSA 3I7OA 2QXVA 3PXTD 5H17A 5EAPA 3JROA 4Z8LA 5FKRA 5EMKB 4L3GD 3U4YA 2H9PA 2XL2A 4ES0A 3JZHA 2AGWA 2J56H 2XYIA 2CN3A 4BH6A 2HKRA 4ZOYA 4LGNA 4A0AB 4J81A 4GMBA 2PM6B 2YMUA 4X61B 4XYHA 3RRMC 4K3ID 2GNQA 3L4MD 3PVUB 3P4FA 4FA1D 3PSCB 1PGUA 3SBRA
chains in the Genus database with same CATH superfamily
2P9IC 4Z7OA 2EICA 2VDNA 4BP9A 2HXCA 4J8BA 4J0XA 3NIGA 4JD2C 5CXBA 4XEIC 2CN2A 3OL2A 5FFOA 4CY2A 2AGLA 1GOTB 2GC7A 3VGZA 4N14A 3EI1B 5I5MA 1K3IA 2IWFA 4O3UB 4Y7RA 3JZGA 1GOGA 4U1EI 3AL8A 4NENA 1JV2A 3OF7A 5CYKA 3VI3A 4J79A 5M5RA 3UVMA 3ZDXA 3QHYB 3NVQA 3GFCA 1E8MA 1XHMA 2P9PC 4Z7NA 1L0QA 4QAMA 3NVNA 4WK2A 1P22A 1QFSA 4J84A 2XDWA 4CY3A 3ZDYA 1NR0A 4AX4A 3BWSA 4CI8A 4X3EA 3PXWD 5M61A 2H13A 1S4UX 4PSXB 5K19A 4E5ZB 4JHPC 5C2WB 2H9MA 2Z2OA 1TYQC 2H6KA 1R5MA 2Q7QA 4MMXA 5FXYA 3EQ8A 3EI3A 4A0AA 1H2XA 1MDAH 5TDHB 3I7LA 4IA9A 5M5TA 4OZUA 5AFU3 3L4OD 4FB1D 3F3FA 5IJ8E 5HE2B 3O4HA 3V5WB 1N6EA 1GXRA 4K3JB 2MTAH 3PE7A 2P9SC 3ZE1A 2BBKH 3ODTA 5AMSA 1UTCA 2I0RA 2B5MA 4J73A 1U8CA 5TEEA 4A11B 3FM0A 1VE7A 4AN1A 3GC3B 2B5NA 5M5VA 4X63B 3N0EA 2Z2PA 4JT5C 2VDPA 3EI1A 1N6FA 5CXBB 3A0FA 3HFQA 3OL2B 1UOQA 5IGOA 4UI9R 1JMZB 5H1MA 3IUJA 3K72A 2HJ4A 4O2WA 2H3XA 2VZ3A 4Y5RD 5HQGA 3K71A 3AL8B 4QQEA 5FLXg 4NBMA 3B7FA 1A12A 3RN0D 4FWWA 2QR5A 3KRXB 2CE8A 2W18A 3RFHA 1VYHC 4FHLA 4J82A 1YFQA 1FWXA 4IRZA 5THAA 3UKUC 3JRPA 3IUMA 3EQ7A 4CC9A 4CY5A 1YR2A 4DNVA 4X60B 4E5ZA 4AEZA 3UKRC 4UM8A 1RI6A 4G1MA 3IJCA 4BL0A 5AJAA 5GSAA 2OK4A 3NIDA 3BG0A 1SHYB 3OTTA 2I0TA 3V7DB 5GMKn 4JSVC 5EMJB 4Z7QA 1I2MB 1K32A 3EI3B 4KFMB 4A2LA 5HE3B 4ZOVA 3EQ9A 4NC4A 5EARA 4R7AB 5C2VB 2H9NA 3FCUA 3KRWB 5KDOB 2OK6A 1XKSA 4CZVA 2VZ1A 5FA5B 4A11A 3OW8A 3GREA 3UVNA 3NVXA 2UZXB 4XYIA 4PSWB 3SMRA 5M5SA 2UZYB 4J0WA 4J86A 4QT8A 3ZWLB 2QC5A 2IUVA 3C5MA 3SXTD 4NAAA 4ESGA 4L1QD 5JWZA 5GXHA 3IVMA 3VI4A 5IJ7E 4BP8A 3MZLA 3PVWB 2CO0C 2PBIB 3E0CA 1JTDB 3I89A 3RFGA 5K1CC 2CE9A 2H6NA 3NIFA 3ZE2A 2OVQB 1OLZA 4ERZA 5SXMA 3EWEA 4A09A 4CI2A 4GGDA 4G55A 5A2Qg 3CFVA 1SQJA 4H5JA 4NSXA 2PM7B 2HESX 1M1XA 4MK0B 4GQ1A 3EI4B 3FRXA 5TEFA 5IGQA 4O1QD 2YNOA 3IJ1A 2P9NC 3DXKC 3OKYA 3IUQA 2H6QA 3IKOA 3OKTA 3DDUA 3I8EA 4AOWA 1L5GA 4FA9D 2IAAA 4L3HD 2IWKA 1MG2A 3RLMD 4TZ4A 4FA5D 5HYNB 5M5UA 2I0SA 1C9LA 5I5JA 5GXIA 2VDKA 2VDMA 4J77A 3UVLA 5B4WA 3V4PA 5C9ZB 3IIYA 4A08A 3PXSD 1VZ2A 2YB8B 2VDOA 4CI1A 5CXCA 3PSCB 1VZ3A 4AMZA 2OVPB 1GOFA 3RMZD 2VDLA 4ZOXA 5FKQA 2BKLA 1PI6A 3SHFA 1E8NA 3C9CA 3I7KA 4ZOZA 4A7JA 2IUPA 2HYEA 5HE1B 3DSMA 3UVOA 3UVKA 2VDRA 5FFGA 5C86A 2HJBA 4O02A 2AH0A 4H5IA 4JXMA 3T3MA 2BCJB 2AGYA 4EWRA 4BCDA 1PBYB 2B5LA 1Q47A 4J8GA 3JB9L 4GM3A 2HKMA 3IULA 3EMHA 4JT6C 3DWLC 1JOFA 1GOHA 4GGAA 4LG8A 5EMLB 3VA6A 4A09B 4MMZA 3QI0A 2P9LC 3EI2A 3MZKA 1JJUB 1TBGA 4GQBB 3ULEC 4BCCA 2CNXA 4PBZA 3EI4A 2OJYA 3I7PA 2B4EA 3K27A 4J87A 4QL1A 3MMYA 1GG2B 3SCYA 2PM9B 3CFSB 2YNPA 5TF2A 3ZDZA 4FAVD 3GD1I 3F3PA 5E6UA 1H2ZA 4JSXC 2J57G 4GM8A 4O45A 1U2VC 5I5IA 3I2NA 2OVRB 3OKYB 2G99A 3ORVD 1SQ9A 5E6SA 1O6GA 3IURA 1K8KC 5FQDA 2VC2A 4CI3A 5IT9g 2XZGA 4LG9A 3JPXA 3SWSD 4OWRA 2XU7A 1A0RB 1JMXB 2AGXA 5HE0B 3I7HA 3RN1D 4A08B 2AQ5A 1NEXB 3ZE0A 2G9AA 3KCIA 3IJ0A 4FAND 2JKXA 5CXCB 2WQ8A 4ZN4A 4D0KA 5E6RA 5C92A 3SN6B 3SVWD 2QZPA 4WK0A 4L9OA 2IUQA 1U4CA 3O4IA 2EIEA 3K6SA 3EG6A 2HU8A 4GM9A 4PC0A 4IMMA 3W15A 4ERYA 3JAMg 2GC4A 4G1EA 3V4VA 4HDJA 1O6FA 4G56B 2CO0A 4D6VA 5EM2B 5H14A 1B9XA 3DM0A 3PSLA 3JZNA 3MUOA 2H9LA 5HDBA 3EI2B 3OKWA 3DXMC 2OIZA 4A0BA 3O4JA 2AGZA 1UOPA 4RE6A 2PM9A 1C9IA 4E54A 3SLED 4JSPC 2H68A 4O9DA 3IUNA 1B9YA 3IJEA 3MXXA 2H14A 2YBAA 1H2YA 4WJKA 2YNNA 3J81g 3AH8B 3C75H 5FKSA 4GGCA 4CY1A 3V9FA 4GQ2P 1MG3A 4D9SA 4YVDA 4FA4D 2XE4A 2XL3A 1VE6A 3CIKB 3EU7A 4A2MA 4MMYA 3MUNA 3BG1A 4O3TB 2I3SA 4J78A 3RSEC 3SBPA 3IIWA 2EIDA 5EAMA 4ERQA 2H47A 3AFCA 3MKSB 4CZXA 4BCBA 1QFMA 2TRCB 5EALA 2O9KA 1TYEA 5EMMB 3C99A 2IURA 4PNKB 1ERJA 4I79A 3SBQA 4U7AA 2J55H 2Z2NA 3O4GA 1PEVA 4DNUA 3MKQA 1XIPA 3FCSA 4AMYA 2P9UC 3I8CA 4QRJA 5EM2A 4UM9A 1H2WA 2VDQA 4CZYA 3N0DA 4BUJC 3J80g 3VH0A 1UOOA 1GP2B 1OMWB 2I3TA 4PBYA 3AL9A 3UR4A 3K26A 2HU5A 3F3GA 5FKTA 1BPOA 4DNWA 3SJLD 4JSNC 1QNIA 5CYKB 5IC7A 4A0BB 3FGBA 1N6DA 3I7NA 4PXWA 3SFZA 2P9KC 4GZ8A 4E54B 2EBSA 3I7OA 2QXVA 3PXTD 5H17A 5EAPA 3JROA 4Z8LA 5FKRA 4AN0A 5EMKB 4L3GD 3U4YA 3MVDK 2H9PA 2XL2A 4ES0A 3JZHA 1T2XA 1E5TA 2AGWA 2EIBA 2J56H 2XYIA 2CN3A 3T3PA 4L1MA 4BH6A 4JHNA 2HKRA 4ZOYA 4LGNA 2HU7A 4A0AB 4J81A 4WK4A 4GMBA 2PM6B 4RE5A 2YMUA 4X61B 4XYHA 3RRMC 4K3ID 2GNQA 3L4MD 3PVUB 3P4FA 4FA1D 2AH1A 1PGUA 3SBRA
chains in the Genus database with same CATH topology
2P9IC 2HXCA 4J8BA 4J0XA 4JD2C 5CXBA 4XEIC 2CN2A 3OL2A 4CY2A 2AGLA 1GOTB 2GC7A 3VGZA 4N14A 3EI1B 5I5MA 2IWFA 4O3UB 4Y7RA 3JZGA 4U1EI 3AL8A 5CYKA 4J79A 3UVMA 3NVQA 3GFCA 1XHMA 2P9PC 1L0QA 3NVNA 1P22A 4CY3A 4J84A 1NR0A 3BWSA 4CI8A 4X3EA 3PXWD 2H13A 1S4UX 4PSXB 5K19A 4E5ZB 5C2WB 2H9MA 2Z2OA 1TYQC 2H6KA 1R5MA 2Q7QA 5FXYA 3EI3A 4A0AA 1MDAH 5TDHB 3I7LA 4IA9A 4OZUA 5AFU3 3L4OD 4FB1D 3F3FA 5IJ8E 5HE2B 2AH1A 3V5WB 1N6EA 1GXRA 4K3JB 2MTAH 3PE7A 2P9SC 2BBKH 3ODTA 5AMSA 2I0RA 2B5MA 4J73A 5TEEA 4A11B 3FM0A 2B5NA 4X63B 3N0EA 2Z2PA 4JT5C 3EI1A 1N6FA 5CXBB 3A0FA 3HFQA 3OL2B 5IGOA 4UI9R 1JMZB 5H1MA 2HJ4A 2H3XA 4Y5RD 5HQGA 3AL8B 4QQEA 5FLXg 3B7FA 3RN0D 4FWWA 3KRXB 2CE8A 2W18A 3RFHA 1VYHC 4FHLA 4J82A 1YFQA 1FWXA 5THAA 3UKUC 3JRPA 4CC9A 4CY5A 4X60B 4E5ZA 4AEZA 3UKRC 1RI6A 3IJCA 4BL0A 5AJAA 5GSAA 2OK4A 3BG0A 1SHYB 3OTTA 2I0TA 3V7DB 5GMKn 4JSVC 5EMJB 1K32A 3EI3B 4KFMB 4A2LA 5HE3B 4ZOVA 5EARA 4R7AB 5C2VB 2H9NA 3KRWB 5KDOB 2OK6A 1XKSA 4CZVA 5FA5B 4A11A 3OW8A 3GREA 3UVNA 3NVXA 2UZXB 4XYIA 4PSWB 3SMRA 2UZYB 4J0WA 4J86A 4QT8A 3ZWLB 2QC5A 2IUVA 3C5MA 3SXTD 4ESGA 4L1QD 5JWZA 5GXHA 5IJ7E 3MZLA 3PVWB 2CO0C 2PBIB 3E0CA 3I89A 3RFGA 5K1CC 2CE9A 2H6NA 2OVQB 1OLZA 4ERZA 5SXMA 3EWEA 4A09A 4CI2A 4GGDA 5A2Qg 3CFVA 1SQJA 4H5JA 4NSXA 2PM7B 2HESX 4MK0B 4GQ1A 3EI4B 3FRXA 5TEFA 5IGQA 4O1QD 2YNOA 3IJ1A 2P9NC 3DXKC 3OKYA 2H6QA 3IKOA 3OKTA 3I8EA 4AOWA 4FA9D 2IAAA 4L3HD 2IWKA 1MG2A 3RLMD 4TZ4A 4FA5D 5HYNB 2I0SA 5I5JA 5GXIA 4J77A 3UVLA 5B4WA 5C9ZB 3IIYA 4A08A 3PXSD 2YB8B 4CI1A 5CXCA 2OVPB 3RMZD 4ZOXA 5FKQA 1PI6A 3SHFA 3C9CA 3I7KA 4ZOZA 4A7JA 2IUPA 2HYEA 5HE1B 3DSMA 3UVOA 3UVKA 2HJBA 2AH0A 4H5IA 4JXMA 2BCJB 2AGYA 4EWRA 1PBYB 2B5LA 1Q47A 4J8GA 3JB9L 4GM3A 2HKMA 3EMHA 4JT6C 3DWLC 1JOFA 4GGAA 4LG8A 5EMLB 3VA6A 4A09B 3EI2A 2P9LC 3MZKA 1JJUB 1TBGA 4GQBB 3ULEC 2CNXA 4PBZA 3EI4A 2OJYA 3I7PA 2B4EA 3K27A 4J87A 4QL1A 3MMYA 1GG2B 3SCYA 2PM9B 3CFSB 2YNPA 5TF2A 4FAVD 3F3PA 4O45A 4JSXC 2J57G 4GM8A 1U2VC 5I5IA 3I2NA 2OVRB 3OKYB 2G99A 3ORVD 1SQ9A 1K8KC 5FQDA 4CI3A 5IT9g 4LG9A 3JPXA 3SWSD 4OWRA 2XU7A 1A0RB 1JMXB 2AGXA 5HE0B 3I7HA 3RN1D 4A08B 2AQ5A 1NEXB 2G9AA 3IJ0A 4FAND 5CXCB 4ZN4A 4D0KA 3SN6B 3SVWD 4L9OA 2IUQA 1U4CA 3EG6A 4GM9A 4PC0A 4IMMA 3W15A 4ERYA 3JAMg 2GC4A 4HDJA 4G56B 2CO0A 4D6VA 5EM2B 5H14A 1B9XA 3DM0A 3PSLA 3JZNA 2H9LA 3EI2B 3OKWA 3DXMC 2OIZA 4A0BA 2AGZA 2PM9A 4E54A 3SLED 4JSPC 2H68A 4O9DA 1B9YA 3MXXA 2H14A 2YBAA 2YNNA 3J81g 3AH8B 3C75H 5FKSA 4GGCA 4CY1A 3V9FA 4GQ2P 1MG3A 4YVDA 4FA4D 2XL3A 3CIKB 3EU7A 4A2MA 3BG1A 4O3TB 2I3SA 4J78A 3RSEC 3SBPA 3IIWA 5EAMA 4ERQA 2H47A 3AFCA 3MKSB 4CZXA 2TRCB 5EALA 2O9KA 5EMMB 3C99A 2IURA 4PNKB 1ERJA 4I79A 3SBQA 4U7AA 2J55H 2Z2NA 1PEVA 3MKQA 1XIPA 2P9UC 3I8CA 4QRJA 5EM2A 4CZYA 3N0DA 4BUJC 3J80g 3VH0A 1GP2B 1OMWB 2I3TA 4PBYA 3AL9A 3UR4A 3K26A 3F3GA 5FKTA 3SJLD 4JSNC 1QNIA 5CYKB 5IC7A 4A0BB 3FGBA 1N6DA 3I7NA 4PXWA 3SFZA 2P9KC 4GZ8A 4E54B 2EBSA 3I7OA 2QXVA 3PXTD 5H17A 5EAPA 3JROA 4Z8LA 5FKRA 5EMKB 4L3GD 3U4YA 2H9PA 2XL2A 4ES0A 3JZHA 2AGWA 2J56H 2XYIA 2CN3A 4BH6A 2HKRA 4ZOYA 4LGNA 4A0AB 4J81A 4GMBA 2PM6B 2YMUA 4X61B 4XYHA 3RRMC 4K3ID 2GNQA 3L4MD 3PVUB 3P4FA 4FA1D 3PSCB 1PGUA 3SBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9I C;  2HXC A;  4J8B A;  4J0X A;  4JD2 C;  5CXB A;  4XEI C;  2CN2 A;  3OL2 A;  4CY2 A;  2AGL A;  1GOT B;  2GC7 A;  3VGZ A;  4N14 A;  3EI1 B;  5I5M A;  2IWF A;  4O3U B;  4Y7R A;  3JZG A;  4U1E I;  3AL8 A;  5CYK A;  4J79 A;  3UVM A;  3NVQ A;  3GFC A;  1XHM A;  2P9P C;  1L0Q A;  3NVN A;  1P22 A;  4CY3 A;  4J84 A;  1NR0 A;  3BWS A;  4CI8 A;  4X3E A;  3PXW D;  2H13 A;  1S4U X;  4PSX B;  5K19 A;  4E5Z B;  5C2W B;  2H9M A;  2Z2O A;  1TYQ C;  2H6K A;  1R5M A;  2Q7Q A;  5FXY A;  3EI3 A;  4A0A A;  1MDA H;  5TDH B;  3I7L A;  4IA9 A;  4OZU A;  5AFU 3;  3L4O D;  4FB1 D;  3F3F A;  5IJ8 E;  5HE2 B;  2AH1 A;  3V5W B;  1N6E A;  1GXR A;  4K3J B;  2MTA H;  3PE7 A;  2P9S C;  2BBK H;  3ODT A;  5AMS A;  2I0R A;  2B5M A;  4J73 A;  5TEE A;  4A11 B;  3FM0 A;  2B5N A;  4X63 B;  3N0E A;  2Z2P A;  4JT5 C;  3EI1 A;  1N6F A;  5CXB B;  3A0F A;  3HFQ A;  3OL2 B;  5IGO A;  4UI9 R;  1JMZ B;  5H1M A;  2HJ4 A;  2H3X A;  4Y5R D;  5HQG A;  3AL8 B;  4QQE A;  5FLX g;  3B7F A;  3RN0 D;  4FWW A;  3KRX B;  2CE8 A;  2W18 A;  3RFH A;  1VYH C;  4FHL A;  4J82 A;  1YFQ A;  1FWX A;  5THA A;  3UKU C;  3JRP A;  4CC9 A;  4CY5 A;  4X60 B;  4E5Z A;  4AEZ A;  3UKR C;  1RI6 A;  3IJC A;  4BL0 A;  5AJA A;  5GSA A;  2OK4 A;  3BG0 A;  1SHY B;  3OTT A;  2I0T A;  3V7D B;  5GMK n;  4JSV C;  5EMJ B;  1K32 A;  3EI3 B;  4KFM B;  4A2L A;  5HE3 B;  4ZOV A;  5EAR A;  4R7A B;  5C2V B;  2H9N A;  3KRW B;  5KDO B;  2OK6 A;  1XKS A;  4CZV A;  5FA5 B;  4A11 A;  3OW8 A;  3GRE A;  3UVN A;  3NVX A;  2UZX B;  4XYI A;  4PSW B;  3SMR A;  2UZY B;  4J0W A;  4J86 A;  4QT8 A;  3ZWL B;  2QC5 A;  2IUV A;  3C5M A;  3SXT D;  4ESG A;  4L1Q D;  5JWZ A;  5GXH A;  5IJ7 E;  3MZL A;  3PVW B;  2CO0 C;  2PBI B;  3E0C A;  3I89 A;  3RFG A;  5K1C C;  2CE9 A;  2H6N A;  2OVQ B;  1OLZ A;  4ERZ A;  5SXM A;  3EWE A;  4A09 A;  4CI2 A;  4GGD A;  5A2Q g;  3CFV A;  1SQJ A;  4H5J A;  4NSX A;  2PM7 B;  2HES X;  4MK0 B;  4GQ1 A;  3EI4 B;  3FRX A;  5TEF A;  5IGQ A;  4O1Q D;  2YNO A;  3IJ1 A;  2P9N C;  3DXK C;  3OKY A;  2H6Q A;  3IKO A;  3OKT A;  3I8E A;  4AOW A;  4FA9 D;  2IAA A;  4L3H D;  2IWK A;  1MG2 A;  3RLM D;  4TZ4 A;  4FA5 D;  5HYN B;  2I0S A;  5I5J A;  5GXI A;  4J77 A;  3UVL A;  5B4W A;  5C9Z B;  3IIY A;  4A08 A;  3PXS D;  2YB8 B;  4CI1 A;  5CXC A;  2OVP B;  3RMZ D;  4ZOX A;  5FKQ A;  1PI6 A;  3SHF A;  3C9C A;  3I7K A;  4ZOZ A;  4A7J A;  2IUP A;  2HYE A;  5HE1 B;  3DSM A;  3UVO A;  3UVK A;  2HJB A;  2AH0 A;  4H5I A;  4JXM A;  2BCJ B;  2AGY A;  4EWR A;  1PBY B;  2B5L A;  1Q47 A;  4J8G A;  3JB9 L;  4GM3 A;  2HKM A;  3EMH A;  4JT6 C;  3DWL C;  1JOF A;  4GGA A;  4LG8 A;  5EML B;  3VA6 A;  4A09 B;  3EI2 A;  2P9L C;  3MZK A;  1JJU B;  1TBG A;  4GQB B;  3ULE C;  2CNX A;  4PBZ A;  3EI4 A;  2OJY A;  3I7P A;  2B4E A;  3K27 A;  4J87 A;  4QL1 A;  3MMY A;  1GG2 B;  3SCY A;  2PM9 B;  3CFS B;  2YNP A;  5TF2 A;  4FAV D;  3F3P A;  4O45 A;  4JSX C;  2J57 G;  4GM8 A;  1U2V C;  5I5I A;  3I2N A;  2OVR B;  3OKY B;  2G99 A;  3ORV D;  1SQ9 A;  1K8K C;  5FQD A;  4CI3 A;  5IT9 g;  4LG9 A;  3JPX A;  3SWS D;  4OWR A;  2XU7 A;  1A0R B;  1JMX B;  2AGX A;  5HE0 B;  3I7H A;  3RN1 D;  4A08 B;  2AQ5 A;  1NEX B;  2G9A A;  3IJ0 A;  4FAN D;  5CXC B;  4ZN4 A;  4D0K A;  3SN6 B;  3SVW D;  4L9O A;  2IUQ A;  1U4C A;  3EG6 A;  4GM9 A;  4PC0 A;  4IMM A;  3W15 A;  4ERY A;  3JAM g;  2GC4 A;  4HDJ A;  4G56 B;  2CO0 A;  4D6V A;  5EM2 B;  5H14 A;  1B9X A;  3DM0 A;  3PSL A;  3JZN A;  2H9L A;  3EI2 B;  3OKW A;  3DXM C;  2OIZ A;  4A0B A;  2AGZ A;  2PM9 A;  4E54 A;  3SLE D;  4JSP C;  2H68 A;  4O9D A;  1B9Y A;  3MXX A;  2H14 A;  2YBA A;  2YNN A;  3J81 g;  3AH8 B;  3C75 H;  5FKS A;  4GGC A;  4CY1 A;  3V9F A;  4GQ2 P;  1MG3 A;  4YVD A;  4FA4 D;  2XL3 A;  3CIK B;  3EU7 A;  4A2M A;  3BG1 A;  4O3T B;  2I3S A;  4J78 A;  3RSE C;  3SBP A;  3IIW A;  5EAM A;  4ERQ A;  2H47 A;  3AFC A;  3MKS B;  4CZX A;  2TRC B;  5EAL A;  2O9K A;  5EMM B;  3C99 A;  2IUR A;  4PNK B;  1ERJ A;  4I79 A;  3SBQ A;  4U7A A;  2J55 H;  2Z2N A;  1PEV A;  3MKQ A;  1XIP A;  2P9U C;  3I8C A;  4QRJ A;  5EM2 A;  4CZY A;  3N0D A;  4BUJ C;  3J80 g;  3VH0 A;  1GP2 B;  1OMW B;  2I3T A;  4PBY A;  3AL9 A;  3UR4 A;  3K26 A;  3F3G A;  5FKT A;  3SJL D;  4JSN C;  1QNI A;  5CYK B;  5IC7 A;  4A0B B;  3FGB A;  1N6D A;  3I7N A;  4PXW A;  3SFZ A;  2P9K C;  4GZ8 A;  4E54 B;  2EBS A;  3I7O A;  2QXV A;  3PXT D;  5H17 A;  5EAP A;  3JRO A;  4Z8L A;  5FKR A;  5EMK B;  4L3G D;  3U4Y A;  2H9P A;  2XL2 A;  4ES0 A;  3JZH A;  2AGW A;  2J56 H;  2XYI A;  2CN3 A;  4BH6 A;  2HKR A;  4ZOY A;  4LGN A;  4A0A B;  4J81 A;  4GMB A;  2PM6 B;  2YMU A;  4X61 B;  4XYH A;  3RRM C;  4K3I D;  2GNQ A;  3L4M D;  3PVU B;  3P4F A;  4FA1 D;  3PSC B;  1PGU A;  3SBR A; 
#chains in the Genus database with same CATH topology
 2P9I C;  4Z7O A;  2EIC A;  2VDN A;  4BP9 A;  2HXC A;  4J8B A;  4J0X A;  3NIG A;  4JD2 C;  5CXB A;  4XEI C;  2CN2 A;  3OL2 A;  5FFO A;  4CY2 A;  2AGL A;  1GOT B;  2GC7 A;  3VGZ A;  4N14 A;  3EI1 B;  5I5M A;  1K3I A;  2IWF A;  4O3U B;  4Y7R A;  3JZG A;  1GOG A;  4U1E I;  3AL8 A;  4NEN A;  1JV2 A;  3OF7 A;  5CYK A;  3VI3 A;  4J79 A;  5M5R A;  3UVM A;  3ZDX A;  3QHY B;  3NVQ A;  3GFC A;  1E8M A;  1XHM A;  2P9P C;  4Z7N A;  1L0Q A;  4QAM A;  3NVN A;  4WK2 A;  1P22 A;  1QFS A;  4J84 A;  2XDW A;  4CY3 A;  3ZDY A;  1NR0 A;  4AX4 A;  3BWS A;  4CI8 A;  4X3E A;  3PXW D;  5M61 A;  2H13 A;  1S4U X;  4PSX B;  5K19 A;  4E5Z B;  4JHP C;  5C2W B;  2H9M A;  2Z2O A;  1TYQ C;  2H6K A;  1R5M A;  2Q7Q A;  4MMX A;  5FXY A;  3EQ8 A;  3EI3 A;  4A0A A;  1H2X A;  1MDA H;  5TDH B;  3I7L A;  4IA9 A;  5M5T A;  4OZU A;  5AFU 3;  3L4O D;  4FB1 D;  3F3F A;  5IJ8 E;  5HE2 B;  3O4H A;  3V5W B;  1N6E A;  1GXR A;  4K3J B;  2MTA H;  3PE7 A;  2P9S C;  3ZE1 A;  2BBK H;  3ODT A;  5AMS A;  1UTC A;  2I0R A;  2B5M A;  4J73 A;  1U8C A;  5TEE A;  4A11 B;  3FM0 A;  1VE7 A;  4AN1 A;  3GC3 B;  2B5N A;  5M5V A;  4X63 B;  3N0E A;  2Z2P A;  4JT5 C;  2VDP A;  3EI1 A;  1N6F A;  5CXB B;  3A0F A;  3HFQ A;  3OL2 B;  1UOQ A;  5IGO A;  4UI9 R;  1JMZ B;  5H1M A;  3IUJ A;  3K72 A;  2HJ4 A;  4O2W A;  2H3X A;  2VZ3 A;  4Y5R D;  5HQG A;  3K71 A;  3AL8 B;  4QQE A;  5FLX g;  4NBM A;  3B7F A;  1A12 A;  3RN0 D;  4FWW A;  2QR5 A;  3KRX B;  2CE8 A;  2W18 A;  3RFH A;  1VYH C;  4FHL A;  4J82 A;  1YFQ A;  1FWX A;  4IRZ A;  5THA A;  3UKU C;  3JRP A;  3IUM A;  3EQ7 A;  4CC9 A;  4CY5 A;  1YR2 A;  4DNV A;  4X60 B;  4E5Z A;  4AEZ A;  3UKR C;  4UM8 A;  1RI6 A;  4G1M A;  3IJC A;  4BL0 A;  5AJA A;  5GSA A;  2OK4 A;  3NID A;  3BG0 A;  1SHY B;  3OTT A;  2I0T A;  3V7D B;  5GMK n;  4JSV C;  5EMJ B;  4Z7Q A;  1I2M B;  1K32 A;  3EI3 B;  4KFM B;  4A2L A;  5HE3 B;  4ZOV A;  3EQ9 A;  4NC4 A;  5EAR A;  4R7A B;  5C2V B;  2H9N A;  3FCU A;  3KRW B;  5KDO B;  2OK6 A;  1XKS A;  4CZV A;  2VZ1 A;  5FA5 B;  4A11 A;  3OW8 A;  3GRE A;  3UVN A;  3NVX A;  2UZX B;  4XYI A;  4PSW B;  3SMR A;  5M5S A;  2UZY B;  4J0W A;  4J86 A;  4QT8 A;  3ZWL B;  2QC5 A;  2IUV A;  3C5M A;  3SXT D;  4NAA A;  4ESG A;  4L1Q D;  5JWZ A;  5GXH A;  3IVM A;  3VI4 A;  5IJ7 E;  4BP8 A;  3MZL A;  3PVW B;  2CO0 C;  2PBI B;  3E0C A;  1JTD B;  3I89 A;  3RFG A;  5K1C C;  2CE9 A;  2H6N A;  3NIF A;  3ZE2 A;  2OVQ B;  1OLZ A;  4ERZ A;  5SXM A;  3EWE A;  4A09 A;  4CI2 A;  4GGD A;  4G55 A;  5A2Q g;  3CFV A;  1SQJ A;  4H5J A;  4NSX A;  2PM7 B;  2HES X;  1M1X A;  4MK0 B;  4GQ1 A;  3EI4 B;  3FRX A;  5TEF A;  5IGQ A;  4O1Q D;  2YNO A;  3IJ1 A;  2P9N C;  3DXK C;  3OKY A;  3IUQ A;  2H6Q A;  3IKO A;  3OKT A;  3DDU A;  3I8E A;  4AOW A;  1L5G A;  4FA9 D;  2IAA A;  4L3H D;  2IWK A;  1MG2 A;  3RLM D;  4TZ4 A;  4FA5 D;  5HYN B;  5M5U A;  2I0S A;  1C9L A;  5I5J A;  5GXI A;  2VDK A;  2VDM A;  4J77 A;  3UVL A;  5B4W A;  3V4P A;  5C9Z B;  3IIY A;  4A08 A;  3PXS D;  1VZ2 A;  2YB8 B;  2VDO A;  4CI1 A;  5CXC A;  3PSC B;  1VZ3 A;  4AMZ A;  2OVP B;  1GOF A;  3RMZ D;  2VDL A;  4ZOX A;  5FKQ A;  2BKL A;  1PI6 A;  3SHF A;  1E8N A;  3C9C A;  3I7K A;  4ZOZ A;  4A7J A;  2IUP A;  2HYE A;  5HE1 B;  3DSM A;  3UVO A;  3UVK A;  2VDR A;  5FFG A;  5C86 A;  2HJB A;  4O02 A;  2AH0 A;  4H5I A;  4JXM A;  3T3M A;  2BCJ B;  2AGY A;  4EWR A;  4BCD A;  1PBY B;  2B5L A;  1Q47 A;  4J8G A;  3JB9 L;  4GM3 A;  2HKM A;  3IUL A;  3EMH A;  4JT6 C;  3DWL C;  1JOF A;  1GOH A;  4GGA A;  4LG8 A;  5EML B;  3VA6 A;  4A09 B;  4MMZ A;  3QI0 A;  2P9L C;  3EI2 A;  3MZK A;  1JJU B;  1TBG A;  4GQB B;  3ULE C;  4BCC A;  2CNX A;  4PBZ A;  3EI4 A;  2OJY A;  3I7P A;  2B4E A;  3K27 A;  4J87 A;  4QL1 A;  3MMY A;  1GG2 B;  3SCY A;  2PM9 B;  3CFS B;  2YNP A;  5TF2 A;  3ZDZ A;  4FAV D;  3GD1 I;  3F3P A;  5E6U A;  1H2Z A;  4JSX C;  2J57 G;  4GM8 A;  4O45 A;  1U2V C;  5I5I A;  3I2N A;  2OVR B;  3OKY B;  2G99 A;  3ORV D;  1SQ9 A;  5E6S A;  1O6G A;  3IUR A;  1K8K C;  5FQD A;  2VC2 A;  4CI3 A;  5IT9 g;  2XZG A;  4LG9 A;  3JPX A;  3SWS D;  4OWR A;  2XU7 A;  1A0R B;  1JMX B;  2AGX A;  5HE0 B;  3I7H A;  3RN1 D;  4A08 B;  2AQ5 A;  1NEX B;  3ZE0 A;  2G9A A;  3KCI A;  3IJ0 A;  4FAN D;  2JKX A;  5CXC B;  2WQ8 A;  4ZN4 A;  4D0K A;  5E6R A;  5C92 A;  3SN6 B;  3SVW D;  2QZP A;  4WK0 A;  4L9O A;  2IUQ A;  1U4C A;  3O4I A;  2EIE A;  3K6S A;  3EG6 A;  2HU8 A;  4GM9 A;  4PC0 A;  4IMM A;  3W15 A;  4ERY A;  3JAM g;  2GC4 A;  4G1E A;  3V4V A;  4HDJ A;  1O6F A;  4G56 B;  2CO0 A;  4D6V A;  5EM2 B;  5H14 A;  1B9X A;  3DM0 A;  3PSL A;  3JZN A;  3MUO A;  2H9L A;  5HDB A;  3EI2 B;  3OKW A;  3DXM C;  2OIZ A;  4A0B A;  3O4J A;  2AGZ A;  1UOP A;  4RE6 A;  2PM9 A;  1C9I A;  4E54 A;  3SLE D;  4JSP C;  2H68 A;  4O9D A;  3IUN A;  1B9Y A;  3IJE A;  3MXX A;  2H14 A;  2YBA A;  1H2Y A;  4WJK A;  2YNN A;  3J81 g;  3AH8 B;  3C75 H;  5FKS A;  4GGC A;  4CY1 A;  3V9F A;  4GQ2 P;  1MG3 A;  4D9S A;  4YVD A;  4FA4 D;  2XE4 A;  2XL3 A;  1VE6 A;  3CIK B;  3EU7 A;  4A2M A;  4MMY A;  3MUN A;  3BG1 A;  4O3T B;  2I3S A;  4J78 A;  3RSE C;  3SBP A;  3IIW A;  2EID A;  5EAM A;  4ERQ A;  2H47 A;  3AFC A;  3MKS B;  4CZX A;  4BCB A;  1QFM A;  2TRC B;  5EAL A;  2O9K A;  1TYE A;  5EMM B;  3C99 A;  2IUR A;  4PNK B;  1ERJ A;  4I79 A;  3SBQ A;  4U7A A;  2J55 H;  2Z2N A;  3O4G A;  1PEV A;  4DNU A;  3MKQ A;  1XIP A;  3FCS A;  4AMY A;  2P9U C;  3I8C A;  4QRJ A;  5EM2 A;  4UM9 A;  1H2W A;  2VDQ A;  4CZY A;  3N0D A;  4BUJ C;  3J80 g;  3VH0 A;  1UOO A;  1GP2 B;  1OMW B;  2I3T A;  4PBY A;  3AL9 A;  3UR4 A;  3K26 A;  2HU5 A;  3F3G A;  5FKT A;  1BPO A;  4DNW A;  3SJL D;  4JSN C;  1QNI A;  5CYK B;  5IC7 A;  4A0B B;  3FGB A;  1N6D A;  3I7N A;  4PXW A;  3SFZ A;  2P9K C;  4GZ8 A;  4E54 B;  2EBS A;  3I7O A;  2QXV A;  3PXT D;  5H17 A;  5EAP A;  3JRO A;  4Z8L A;  5FKR A;  4AN0 A;  5EMK B;  4L3G D;  3U4Y A;  3MVD K;  2H9P A;  2XL2 A;  4ES0 A;  3JZH A;  1T2X A;  1E5T A;  2AGW A;  2EIB A;  2J56 H;  2XYI A;  2CN3 A;  3T3P A;  4L1M A;  4BH6 A;  4JHN A;  2HKR A;  4ZOY A;  4LGN A;  2HU7 A;  4A0A B;  4J81 A;  4WK4 A;  4GMB A;  2PM6 B;  4RE5 A;  2YMU A;  4X61 B;  4XYH A;  3RRM C;  4K3I D;  2GNQ A;  3L4M D;  3PVU B;  3P4F A;  4FA1 D;  2AH1 A;  1PGU A;  3SBR A; 
#chains in the Genus database with same CATH homology
 2P9I C;  2HXC A;  4J8B A;  4J0X A;  4JD2 C;  5CXB A;  4XEI C;  2CN2 A;  3OL2 A;  4CY2 A;  2AGL A;  1GOT B;  2GC7 A;  3VGZ A;  4N14 A;  3EI1 B;  5I5M A;  2IWF A;  4O3U B;  4Y7R A;  3JZG A;  4U1E I;  3AL8 A;  5CYK A;  4J79 A;  3UVM A;  3NVQ A;  3GFC A;  1XHM A;  2P9P C;  1L0Q A;  3NVN A;  1P22 A;  4CY3 A;  4J84 A;  1NR0 A;  3BWS A;  4CI8 A;  4X3E A;  3PXW D;  2H13 A;  1S4U X;  4PSX B;  5K19 A;  4E5Z B;  5C2W B;  2H9M A;  2Z2O A;  1TYQ C;  2H6K A;  1R5M A;  2Q7Q A;  5FXY A;  3EI3 A;  4A0A A;  1MDA H;  5TDH B;  3I7L A;  4IA9 A;  4OZU A;  5AFU 3;  3L4O D;  4FB1 D;  3F3F A;  5IJ8 E;  5HE2 B;  2AH1 A;  3V5W B;  1N6E A;  1GXR A;  4K3J B;  2MTA H;  3PE7 A;  2P9S C;  2BBK H;  3ODT A;  5AMS A;  2I0R A;  2B5M A;  4J73 A;  5TEE A;  4A11 B;  3FM0 A;  2B5N A;  4X63 B;  3N0E A;  2Z2P A;  4JT5 C;  3EI1 A;  1N6F A;  5CXB B;  3A0F A;  3HFQ A;  3OL2 B;  5IGO A;  4UI9 R;  1JMZ B;  5H1M A;  2HJ4 A;  2H3X A;  4Y5R D;  5HQG A;  3AL8 B;  4QQE A;  5FLX g;  3B7F A;  3RN0 D;  4FWW A;  3KRX B;  2CE8 A;  2W18 A;  3RFH A;  1VYH C;  4FHL A;  4J82 A;  1YFQ A;  1FWX A;  5THA A;  3UKU C;  3JRP A;  4CC9 A;  4CY5 A;  4X60 B;  4E5Z A;  4AEZ A;  3UKR C;  1RI6 A;  3IJC A;  4BL0 A;  5AJA A;  5GSA A;  2OK4 A;  3BG0 A;  1SHY B;  3OTT A;  2I0T A;  3V7D B;  5GMK n;  4JSV C;  5EMJ B;  1K32 A;  3EI3 B;  4KFM B;  4A2L A;  5HE3 B;  4ZOV A;  5EAR A;  4R7A B;  5C2V B;  2H9N A;  3KRW B;  5KDO B;  2OK6 A;  1XKS A;  4CZV A;  5FA5 B;  4A11 A;  3OW8 A;  3GRE A;  3UVN A;  3NVX A;  2UZX B;  4XYI A;  4PSW B;  3SMR A;  2UZY B;  4J0W A;  4J86 A;  4QT8 A;  3ZWL B;  2QC5 A;  2IUV A;  3C5M A;  3SXT D;  4ESG A;  4L1Q D;  5JWZ A;  5GXH A;  5IJ7 E;  3MZL A;  3PVW B;  2CO0 C;  2PBI B;  3E0C A;  3I89 A;  3RFG A;  5K1C C;  2CE9 A;  2H6N A;  2OVQ B;  1OLZ A;  4ERZ A;  5SXM A;  3EWE A;  4A09 A;  4CI2 A;  4GGD A;  5A2Q g;  3CFV A;  1SQJ A;  4H5J A;  4NSX A;  2PM7 B;  2HES X;  4MK0 B;  4GQ1 A;  3EI4 B;  3FRX A;  5TEF A;  5IGQ A;  4O1Q D;  2YNO A;  3IJ1 A;  2P9N C;  3DXK C;  3OKY A;  2H6Q A;  3IKO A;  3OKT A;  3I8E A;  4AOW A;  4FA9 D;  2IAA A;  4L3H D;  2IWK A;  1MG2 A;  3RLM D;  4TZ4 A;  4FA5 D;  5HYN B;  2I0S A;  5I5J A;  5GXI A;  4J77 A;  3UVL A;  5B4W A;  5C9Z B;  3IIY A;  4A08 A;  3PXS D;  2YB8 B;  4CI1 A;  5CXC A;  2OVP B;  3RMZ D;  4ZOX A;  5FKQ A;  1PI6 A;  3SHF A;  3C9C A;  3I7K A;  4ZOZ A;  4A7J A;  2IUP A;  2HYE A;  5HE1 B;  3DSM A;  3UVO A;  3UVK A;  2HJB A;  2AH0 A;  4H5I A;  4JXM A;  2BCJ B;  2AGY A;  4EWR A;  1PBY B;  2B5L A;  1Q47 A;  4J8G A;  3JB9 L;  4GM3 A;  2HKM A;  3EMH A;  4JT6 C;  3DWL C;  1JOF A;  4GGA A;  4LG8 A;  5EML B;  3VA6 A;  4A09 B;  3EI2 A;  2P9L C;  3MZK A;  1JJU B;  1TBG A;  4GQB B;  3ULE C;  2CNX A;  4PBZ A;  3EI4 A;  2OJY A;  3I7P A;  2B4E A;  3K27 A;  4J87 A;  4QL1 A;  3MMY A;  1GG2 B;  3SCY A;  2PM9 B;  3CFS B;  2YNP A;  5TF2 A;  4FAV D;  3F3P A;  4O45 A;  4JSX C;  2J57 G;  4GM8 A;  1U2V C;  5I5I A;  3I2N A;  2OVR B;  3OKY B;  2G99 A;  3ORV D;  1SQ9 A;  1K8K C;  5FQD A;  4CI3 A;  5IT9 g;  4LG9 A;  3JPX A;  3SWS D;  4OWR A;  2XU7 A;  1A0R B;  1JMX B;  2AGX A;  5HE0 B;  3I7H A;  3RN1 D;  4A08 B;  2AQ5 A;  1NEX B;  2G9A A;  3IJ0 A;  4FAN D;  5CXC B;  4ZN4 A;  4D0K A;  3SN6 B;  3SVW D;  4L9O A;  2IUQ A;  1U4C A;  3EG6 A;  4GM9 A;  4PC0 A;  4IMM A;  3W15 A;  4ERY A;  3JAM g;  2GC4 A;  4HDJ A;  4G56 B;  2CO0 A;  4D6V A;  5EM2 B;  5H14 A;  1B9X A;  3DM0 A;  3PSL A;  3JZN A;  2H9L A;  3EI2 B;  3OKW A;  3DXM C;  2OIZ A;  4A0B A;  2AGZ A;  2PM9 A;  4E54 A;  3SLE D;  4JSP C;  2H68 A;  4O9D A;  1B9Y A;  3MXX A;  2H14 A;  2YBA A;  2YNN A;  3J81 g;  3AH8 B;  3C75 H;  5FKS A;  4GGC A;  4CY1 A;  3V9F A;  4GQ2 P;  1MG3 A;  4YVD A;  4FA4 D;  2XL3 A;  3CIK B;  3EU7 A;  4A2M A;  3BG1 A;  4O3T B;  2I3S A;  4J78 A;  3RSE C;  3SBP A;  3IIW A;  5EAM A;  4ERQ A;  2H47 A;  3AFC A;  3MKS B;  4CZX A;  2TRC B;  5EAL A;  2O9K A;  5EMM B;  3C99 A;  2IUR A;  4PNK B;  1ERJ A;  4I79 A;  3SBQ A;  4U7A A;  2J55 H;  2Z2N A;  1PEV A;  3MKQ A;  1XIP A;  2P9U C;  3I8C A;  4QRJ A;  5EM2 A;  4CZY A;  3N0D A;  4BUJ C;  3J80 g;  3VH0 A;  1GP2 B;  1OMW B;  2I3T A;  4PBY A;  3AL9 A;  3UR4 A;  3K26 A;  3F3G A;  5FKT A;  3SJL D;  4JSN C;  1QNI A;  5CYK B;  5IC7 A;  4A0B B;  3FGB A;  1N6D A;  3I7N A;  4PXW A;  3SFZ A;  2P9K C;  4GZ8 A;  4E54 B;  2EBS A;  3I7O A;  2QXV A;  3PXT D;  5H17 A;  5EAP A;  3JRO A;  4Z8L A;  5FKR A;  5EMK B;  4L3G D;  3U4Y A;  2H9P A;  2XL2 A;  4ES0 A;  3JZH A;  2AGW A;  2J56 H;  2XYI A;  2CN3 A;  4BH6 A;  2HKR A;  4ZOY A;  4LGN A;  4A0A B;  4J81 A;  4GMB A;  2PM6 B;  2YMU A;  4X61 B;  4XYH A;  3RRM C;  4K3I D;  2GNQ A;  3L4M D;  3PVU B;  3P4F A;  4FA1 D;  3PSC B;  1PGU A;  3SBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...