4CZVA

Structure of the neurospora crassa pan2 wd40 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
324
structure length
324
Chain Sequence
PHMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
total genus 76
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czvA00
4O45A 2OIZA 3OL2B 4XYHA 3RN1D 1GXRA 5IJ8E 4CZXA 4O3TB 1A0RB 3I7OA 4ZOZA 3UKRC 4JT6C 5K19A 2PM7B 2CNXA 5K1CC 2IWKA 3RMZD 2YNNA 5IGQA 5HE2B 3SWSD 4ERYA 2P9KC 4LGNA 4GQ1A 5IT9g 1GP2B 4Z8LA 1B9XA 2AGYA 2OVPB 3JPXA 2YMUA 3GREA 4FAVD 3PSLA 3E0CA 4JT5C 2AH0A 2B5MA 4CY2A 3DWLC 3I7NA 2XL2A 2H14A 3SJLD 2I0SA 3RFHA 1S4UX 3PXSD 3OKYA 4XYIA 4QT8A 5EMJB 4AEZA 1NR0A 2HYEA 5CXBB 3DXMC 3F3FA 4JSXC 1PEVA 5CXBA 3I7PA 2H6NA 4ZN4A 4J78A 4N14A 3HFQA 3JAMg 3EI1B 5B4WA 2AGWA 3SBPA 3SCYA 3EI1A 2GC4A 4CI2A 4J86A 5GXIA 3W15A 3IKOA 3ULEC 3AH8B 3VGZA 2YNOA 3V9FA 2HJ4A 5FA5B 2HXCA 5H1MA 3OW8A 4H5IA 5CYKA 4ZOXA 4PC0A 3MXXA 4E54B 3AFCA 4L3GD 3A0FA 3I7KA 2P9PC 2OVQB 4FHLA 3EI4B 4U1EI 3VA6A 1YFQA 1OMWB 4JSNC 3EI4A 3EI2B 4A0BA 2BCJB 2H9NA 1B9YA 4A0AB 3I7LA 1TYQC 4D0KA 2H3XA 4A0AA 4A2MA 2H68A 2H9MA 4JD2C 5GMKn 2AQ5A 1P22A 5H17A 4K3JB 4D6VA 3MKSB 2CO0C 3EG6A 2Z2NA 3B7FA 1PBYB 3DSMA 1FWXA 5H14A 4LG8A 3RSEC 4J8GA 4A09B 3C75H 3EU7A 2GC7A 5HQGA 5IJ7E 4UI9R 5FKSA 3UR4A 4A09A 4K3ID 4J0XA 4O9DA 4ZOYA 4JSPC 4FA5D 3I7HA 3N0EA 2HESX 2P9NC 2UZYB 3NVXA 1Q47A 1QNIA 2EBSA 3FM0A 4ERZA 3KRXB 5KDOB 3F3PA 4A2LA 1N6DA 4HDJA 2OVRB 2H6QA 3IJCA 3MZKA 1JJUB 2HJBA 5HYNB 1PI6A 5C2VB 3PXWD 4X60B 1VYHC 4CZYA 4FAND 3L4MD 5A2Qg 3U4YA 3ORVD 1L0QA 4GM3A 3ODTA 4TZ4A 3SLED 2I0TA 2Z2OA 4J82A 3RFGA 3UKUC 3FGBA 4KFMB 4CI3A 3OKYB 2H9LA 2YBAA 3C5MA 3JZHA 3OKTA 3NVNA 3SFZA 3OKWA 4J87A 4ES0A 4L9OA 2Q7QA 1GG2B 5FKQA 2XU7A 2I3SA 2H9PA 4R7AB 4PXWA 5I5IA 4PSWB 5AMSA 2BBKH 4G56B 2MTAH 3DXKC 5GXHA 3IJ0A 2J55H 4QQEA 4PBYA 3IJ1A 3AL8A 3VH0A 3AL9A 4OWRA 4CI8A 5CYKB 5TDHB 4BUJC 2XL3A 2HKRA 2I0RA 2IUPA 4FB1D 3UVKA 3EWEA 4CZVA 3OTTA 4A0BB 4U7AA 3C9CA 4IA9A 2AGLA 2AH1A 3SBQA 4GGCA 4A11B 2AGXA 3BG1A 3I2NA 3RRMC 3CIKB 2H13A 2PM9A 4A11A 3JB9L 2HKMA 4L1QD 5SXMA 5THAA 1TBGA 2W18A 1N6EA 3BWSA 3PXTD 2AGZA 2CE8A 3CFVA 3CFSB 3L4OD 4GGAA 5EM2A 3V7DB 3SVWD 1U2VC 3PE7A 2CO0A 4J84A 5HE3B 1JMZB 1R5MA 4H5JA 4I79A 4CY5A 5FLXg 3SN6B 3SHFA 4J79A 2P9LC 1MDAH 2CN2A 4JXMA 4FA4D 1MG2A 3JZNA 4GQBB 2YNPA 4X63B 3JROA 2G99A 2IWFA 5HE1B 1SQ9A 5TEFA 4Y5RD 4PSXB 3JRPA 2PBIB 5CXCB 3KRWB 2P9IC 3I8EA 5CXCA 2O9KA 4NSXA 4FA1D 4A08A 3OL2A 4CY1A 4J81A 2B5NA 5HE0B 4IMMA 2OJYA 4GMBA 2P9UC 3SXTD 4ESGA 4X61B 2B5LA 2I3TA 4FWWA 2OK6A 4GGDA 4PNKB 4YVDA 3UVLA 3MKQA 4CC9A 3SMRA 2CE9A 4ERQA 4E5ZB 3RLMD 3IIWA 1MG3A 3PVWB 2P9SC 4E5ZA 3J81g 4BL0A 2Z2PA 1JOFA 5AJAA 2H6KA 3FRXA 2J56H 3MMYA 4QL1A 2H47A 4J73A 3BG0A 3V5WB 2OK4A 4EWRA 5TEEA 3UVNA 1U4CA 3I89A 1K8KC 4QRJA 2XYIA 4FA9D 2YB8B 3F3GA 4BH6A 3SBRA 3AL8B 3NVQA 1SHYB 4J8BA 3GFCA 4O1QD 3ZWLB 5EMKB 1N6FA 1XHMA 1K32A 4PBZA 4OZUA 3IIYA 1JMXB 2IAAA 4MK0B 4LG9A 3P4FA 4O3UB 4CI1A 1ERJA 2IUQA 3J80g 3I8CA 1XIPA 5AFU3 4XEIC 2PM9B 4J77A 5TF2A 2IURA 3MZLA 5EALA 4GQ2P 5I5MA 1XKSA 5EMLB 5IC7A 2PM6B 4GZ8A 3K27A 4GM8A 1SQJA 5FKTA 4E54A 3PSCB 1GOTB 3JZGA 4J0WA 5EM2B 5FKRA 4L3HD 3N0DA 3EI2A 1OLZA 2UZXB 3C99A 3DM0A 5FQDA 2B4EA 5C2WB 4AOWA 2TRCB 2QXVA 1RI6A 5IGOA 5EAMA 4JSVC 3UVOA 4X3EA 5FXYA 4ZOVA 4A7JA 2CN3A 3PVUB 1PGUA 3RN0D 2IUVA 1NEXB 5I5JA 5JWZA 3EI3B 2QC5A 4CY3A 5GSAA 3EI3A 2GNQA 5EMMB 5EARA 3EMHA 5EAPA 2J57G 2G9AA 4GM9A 3UVMA 4A08B 4Y7RA 3K26A 5C9ZB
chains in the Genus database with same CATH superfamily
4O45A 2OIZA 3OL2B 4XYHA 3RN1D 3MUNA 1GXRA 5IJ8E 4JHNA 4CZXA 4O3TB 2HU8A 1A0RB 2JKXA 3I7OA 4ZOZA 3UKRC 4JT6C 5K19A 3IVMA 2PM7B 2CNXA 5K1CC 2IWKA 3RMZD 2YNNA 5IGQA 1I2MB 5HE2B 3SWSD 3V4VA 4ERYA 2P9KC 4LGNA 4GQ1A 5IT9g 1GP2B 3ZE1A 1JV2A 1B9XA 4Z8LA 2AGYA 1H2ZA 2OVPB 3JPXA 2YMUA 3GREA 4FAVD 3PSLA 3E0CA 4JT5C 4AN1A 2AH0A 2B5MA 4CY2A 1GOGA 3DWLC 3I7NA 3FCUA 3ZDZA 2XL2A 2H14A 3SJLD 2VZ3A 2I0SA 3RFHA 1S4UX 3PXSD 3EQ9A 3OKYA 4G1EA 4XYIA 4QT8A 3QHYB 4AMZA 5EMJB 4AEZA 1NR0A 2HYEA 5CXBB 3DXMC 3T3PA 1M1XA 3F3FA 4JSXC 1PEVA 5CXBA 1E8NA 3I7PA 2H6NA 4ZN4A 4DNWA 4J78A 4N14A 3HFQA 3JAMg 4RE6A 3EI1B 1U8CA 5B4WA 2AGWA 3SBPA 3SCYA 4NC4A 3EI1A 2GC4A 4CI2A 4J86A 1H2YA 5GXIA 3W15A 3IKOA 3ULEC 3AH8B 3VGZA 2YNOA 3V9FA 2EIBA 2HJ4A 4WJKA 5FA5B 2HXCA 3VI4A 5H1MA 3OW8A 4H5IA 5CYKA 4ZOXA 3GD1I 4PC0A 3MXXA 3IUJA 3AFCA 4E54B 4L3GD 3A0FA 3I7KA 2P9PC 2OVQB 2XZGA 4FHLA 3EI4B 4U1EI 3VA6A 5HDBA 1YFQA 1OMWB 4JSNC 3EI4A 3EI2B 4A0BA 2BCJB 2VDOA 2H9NA 1B9YA 4A0AB 3I7LA 1TYQC 4QAMA 3O4IA 4D0KA 2H3XA 4A0AA 5M5TA 4A2MA 2H68A 2H9MA 4JD2C 5GMKn 3ZE0A 1VZ2A 2AQ5A 2VDPA 2EIEA 3O4JA 1P22A 5H17A 3VI3A 4K3JB 5M5RA 3IUQA 3MKSB 4D6VA 2CO0C 3EG6A 2Z2NA 3B7FA 1JTDB 1PBYB 2VDKA 3DSMA 1FWXA 5H14A 4LG8A 3RSEC 4J8GA 4A09B 3C75H 3EU7A 2GC7A 5HQGA 5IJ7E 4UI9R 5FKSA 3UR4A 4A09A 4K3ID 4J0XA 4O9DA 4BP9A 4ZOYA 4JSPC 4FA5D 3I7HA 3N0EA 2HESX 2P9NC 2UZYB 3NVXA 1Q47A 5E6SA 2VDLA 1QNIA 4D9SA 2EBSA 3IULA 3FM0A 4ERZA 3KRXB 5KDOB 3F3PA 4A2LA 4O2WA 1N6DA 3GC3B 4HDJA 2OVRB 2H6QA 3IJCA 3MZKA 3IUNA 1JJUB 2HJBA 5HYNB 1PI6A 5C2VB 3PXWD 4X60B 1VYHC 4CZYA 4FAND 3L4MD 5A2Qg 3U4YA 3ORVD 1L0QA 3K72A 4GM3A 3ODTA 1TYEA 4TZ4A 3SLED 2VDMA 3T3MA 2I0TA 2Z2OA 4J82A 3RFGA 3UKUC 3NIDA 3FGBA 4KFMB 4AX4A 4CI3A 3OKYB 2H9LA 2YBAA 3C5MA 3JZHA 3OKTA 3NVNA 3SFZA 3OKWA 4J87A 4G55A 4ES0A 4L9OA 2Q7QA 1GG2B 5FKQA 2XU7A 2I3SA 2H9PA 4R7AB 4PXWA 5I5IA 4AMYA 4PSWB 5AMSA 2BBKH 4G56B 2MTAH 3DXKC 5GXHA 4WK2A 3IJ0A 2J55H 4MMYA 4QQEA 1C9IA 2EIDA 3IJ1A 4PBYA 4BCDA 4NAAA 1VE7A 3AL8A 3VH0A 3AL9A 4OWRA 4CI8A 5CYKB 5TDHB 1O6GA 4BUJC 2XL3A 2HKRA 2I0RA 2IUPA 4FB1D 3UVKA 3EWEA 4CZVA 3OTTA 4A0BB 4U7AA 3C9CA 4IA9A 2AGLA 2AH1A 3SBQA 1O6FA 5C86A 4GGCA 4A11B 2AGXA 3BG1A 3I2NA 3RRMC 3CIKB 1VZ3A 2VDNA 2H13A 2PM9A 4A11A 3JB9L 1H2WA 2HU7A 2HKMA 1GOFA 3NIFA 4L1QD 5SXMA 5THAA 1TBGA 2EICA 2W18A 1N6EA 3BWSA 3PXTD 2AGZA 2CE8A 3CFVA 3CFSB 2VC2A 3O4HA 4RE5A 3L4OD 4GGAA 5EM2A 3V7DB 3SVWD 1U2VC 2VZ1A 2CO0A 3PE7A 4J84A 1K3IA 1JMZB 5HE3B 1R5MA 4H5JA 4I79A 4CY5A 5FLXg 3SN6B 3SHFA 4L1MA 4J79A 1GOHA 1E8MA 4JHPC 2P9LC 1MDAH 4Z7NA 2CN2A 1C9LA 4JXMA 4FA4D 1MG2A 3JZNA 4GQBB 2YNPA 3IUMA 4X63B 3V4PA 3JROA 3EQ7A 2G99A 4WK0A 2IWFA 5HE1B 1SQ9A 5TEFA 4AN0A 4Y5RD 4PSXB 3JRPA 2PBIB 5CXCB 3KRWB 2P9IC 3I8EA 4IRZA 5CXCA 2O9KA 4NSXA 4FA1D 2WQ8A 4BP8A 5C92A 4A08A 3MVDK 3OL2A 4CY1A 4DNVA 4J81A 4DNUA 5M5VA 2B5NA 5HE0B 4IMMA 2OJYA 3QI0A 4GMBA 2P9UC 3SXTD 4BCBA 4ESGA 5E6UA 4X61B 4Z7OA 2B5LA 2I3TA 2VDQA 4FWWA 2OK6A 4GGDA 4PNKB 4YVDA 3UVLA 4UM9A 3MKQA 4CC9A 3SMRA 2CE9A 4ERQA 4E5ZB 5E6RA 3RLMD 4UM8A 3IIWA 1MG3A 3PVWB 2P9SC 3NIGA 4E5ZA 1VE6A 3J81g 4BL0A 2Z2PA 1JOFA 1UOOA 5AJAA 1BPOA 2H6KA 3FRXA 2J56H 3OF7A 3MMYA 4QL1A 1QFSA 2H47A 4J73A 1UOQA 3BG0A 3V5WB 3ZE2A 3ZDXA 3DDUA 2OK4A 4EWRA 5TEEA 3UVNA 1U4CA 3I89A 1K8KC 3O4GA 4QRJA 2XYIA 4FA9D 2YB8B 3F3GA 4BH6A 3SBRA 3AL8B 3NVQA 1SHYB 4J8BA 2QR5A 3GFCA 4O1QD 1L5GA 5EMKB 3ZWLB 1YR2A 1N6FA 1E5TA 1XHMA 1K32A 1UTCA 4PBZA 4OZUA 3IIYA 1JMXB 2IAAA 3IJEA 4MMXA 2XE4A 4MK0B 1UOPA 4LG9A 2HU5A 3P4FA 4O3UB 3IURA 4CI1A 3EQ8A 1ERJA 2IUQA 3ZDYA 3J80g 3I8CA 4WK4A 1XIPA 5AFU3 4XEIC 2PM9B 4J77A 5M5UA 5TF2A 2IURA 3MZLA 5EALA 4GQ2P 5I5MA 3FCSA 5M5SA 3MUOA 1XKSA 5EMLB 1A12A 5IC7A 2PM6B 4GZ8A 3K27A 4GM8A 2QZPA 4MMZA 1SQJA 5FFGA 5FKTA 4E54A 4O02A 3PSCB 1GOTB 3JZGA 4J0WA 2VDRA 1QFMA 5FKRA 5EM2B 4L3HD 3N0DA 3EI2A 4G1MA 1OLZA 2UZXB 4BCCA 4NENA 3C99A 3DM0A 5FQDA 2B4EA 5M61A 5C2WB 4AOWA 2TRCB 1H2XA 2QXVA 1RI6A 5IGOA 1T2XA 2XDWA 5EAMA 4JSVC 3UVOA 4X3EA 5FXYA 4ZOVA 4A7JA 2CN3A 3PVUB 1PGUA 3RN0D 2IUVA 4NBMA 5FFOA 1NEXB 5I5JA 5JWZA 4Z7QA 3EI3B 3K71A 2QC5A 4CY3A 2BKLA 5GSAA 3EI3A 3KCIA 2GNQA 5EMMB 5EARA 3EMHA 5EAPA 2J57G 2G9AA 4GM9A 3UVMA 4A08B 4Y7RA 3K26A 3K6SA 5C9ZB
chains in the Genus database with same CATH topology
4O45A 2OIZA 3OL2B 4XYHA 3RN1D 1GXRA 5IJ8E 4CZXA 4O3TB 1A0RB 3I7OA 4ZOZA 3UKRC 4JT6C 5K19A 2PM7B 2CNXA 5K1CC 2IWKA 3RMZD 2YNNA 5IGQA 5HE2B 3SWSD 4ERYA 2P9KC 4LGNA 4GQ1A 5IT9g 1GP2B 4Z8LA 1B9XA 2AGYA 2OVPB 3JPXA 2YMUA 3GREA 4FAVD 3PSLA 3E0CA 4JT5C 2AH0A 2B5MA 4CY2A 3DWLC 3I7NA 2XL2A 2H14A 3SJLD 2I0SA 3RFHA 1S4UX 3PXSD 3OKYA 4XYIA 4QT8A 5EMJB 4AEZA 1NR0A 2HYEA 5CXBB 3DXMC 3F3FA 4JSXC 1PEVA 5CXBA 3I7PA 2H6NA 4ZN4A 4J78A 4N14A 3HFQA 3JAMg 3EI1B 5B4WA 2AGWA 3SBPA 3SCYA 3EI1A 2GC4A 4CI2A 4J86A 5GXIA 3W15A 3IKOA 3ULEC 3AH8B 3VGZA 2YNOA 3V9FA 2HJ4A 5FA5B 2HXCA 5H1MA 3OW8A 4H5IA 5CYKA 4ZOXA 4PC0A 3MXXA 4E54B 3AFCA 4L3GD 3A0FA 3I7KA 2P9PC 2OVQB 4FHLA 3EI4B 4U1EI 3VA6A 1YFQA 1OMWB 4JSNC 3EI4A 3EI2B 4A0BA 2BCJB 2H9NA 1B9YA 4A0AB 3I7LA 1TYQC 4D0KA 2H3XA 4A0AA 4A2MA 2H68A 2H9MA 4JD2C 5GMKn 2AQ5A 1P22A 5H17A 4K3JB 4D6VA 3MKSB 2CO0C 3EG6A 2Z2NA 3B7FA 1PBYB 3DSMA 1FWXA 5H14A 4LG8A 3RSEC 4J8GA 4A09B 3C75H 3EU7A 2GC7A 5HQGA 5IJ7E 4UI9R 5FKSA 3UR4A 4A09A 4K3ID 4J0XA 4O9DA 4ZOYA 4JSPC 4FA5D 3I7HA 3N0EA 2HESX 2P9NC 2UZYB 3NVXA 1Q47A 1QNIA 2EBSA 3FM0A 4ERZA 3KRXB 5KDOB 3F3PA 4A2LA 1N6DA 4HDJA 2OVRB 2H6QA 3IJCA 3MZKA 1JJUB 2HJBA 5HYNB 1PI6A 5C2VB 3PXWD 4X60B 1VYHC 4CZYA 4FAND 3L4MD 5A2Qg 3U4YA 3ORVD 1L0QA 4GM3A 3ODTA 4TZ4A 3SLED 2I0TA 2Z2OA 4J82A 3RFGA 3UKUC 3FGBA 4KFMB 4CI3A 3OKYB 2H9LA 2YBAA 3C5MA 3JZHA 3OKTA 3NVNA 3SFZA 3OKWA 4J87A 4ES0A 4L9OA 2Q7QA 1GG2B 5FKQA 2XU7A 2I3SA 2H9PA 4R7AB 4PXWA 5I5IA 4PSWB 5AMSA 2BBKH 4G56B 2MTAH 3DXKC 5GXHA 3IJ0A 2J55H 4QQEA 4PBYA 3IJ1A 3AL8A 3VH0A 3AL9A 4OWRA 4CI8A 5CYKB 5TDHB 4BUJC 2XL3A 2HKRA 2I0RA 2IUPA 4FB1D 3UVKA 3EWEA 4CZVA 3OTTA 4A0BB 4U7AA 3C9CA 4IA9A 2AGLA 2AH1A 3SBQA 4GGCA 4A11B 2AGXA 3BG1A 3I2NA 3RRMC 3CIKB 2H13A 2PM9A 4A11A 3JB9L 2HKMA 4L1QD 5SXMA 5THAA 1TBGA 2W18A 1N6EA 3BWSA 3PXTD 2AGZA 2CE8A 3CFVA 3CFSB 3L4OD 4GGAA 5EM2A 3V7DB 3SVWD 1U2VC 3PE7A 2CO0A 4J84A 5HE3B 1JMZB 1R5MA 4H5JA 4I79A 4CY5A 5FLXg 3SN6B 3SHFA 4J79A 2P9LC 1MDAH 2CN2A 4JXMA 4FA4D 1MG2A 3JZNA 4GQBB 2YNPA 4X63B 3JROA 2G99A 2IWFA 5HE1B 1SQ9A 5TEFA 4Y5RD 4PSXB 3JRPA 2PBIB 5CXCB 3KRWB 2P9IC 3I8EA 5CXCA 2O9KA 4NSXA 4FA1D 4A08A 3OL2A 4CY1A 4J81A 2B5NA 5HE0B 4IMMA 2OJYA 4GMBA 2P9UC 3SXTD 4ESGA 4X61B 2B5LA 2I3TA 4FWWA 2OK6A 4GGDA 4PNKB 4YVDA 3UVLA 3MKQA 4CC9A 3SMRA 2CE9A 4ERQA 4E5ZB 3RLMD 3IIWA 1MG3A 3PVWB 2P9SC 4E5ZA 3J81g 4BL0A 2Z2PA 1JOFA 5AJAA 2H6KA 3FRXA 2J56H 3MMYA 4QL1A 2H47A 4J73A 3BG0A 3V5WB 2OK4A 4EWRA 5TEEA 3UVNA 1U4CA 3I89A 1K8KC 4QRJA 2XYIA 4FA9D 2YB8B 3F3GA 4BH6A 3SBRA 3AL8B 3NVQA 1SHYB 4J8BA 3GFCA 4O1QD 3ZWLB 5EMKB 1N6FA 1XHMA 1K32A 4PBZA 4OZUA 3IIYA 1JMXB 2IAAA 4MK0B 4LG9A 3P4FA 4O3UB 4CI1A 1ERJA 2IUQA 3J80g 3I8CA 1XIPA 5AFU3 4XEIC 2PM9B 4J77A 5TF2A 2IURA 3MZLA 5EALA 4GQ2P 5I5MA 1XKSA 5EMLB 5IC7A 2PM6B 4GZ8A 3K27A 4GM8A 1SQJA 5FKTA 4E54A 3PSCB 1GOTB 3JZGA 4J0WA 5EM2B 5FKRA 4L3HD 3N0DA 3EI2A 1OLZA 2UZXB 3C99A 3DM0A 5FQDA 2B4EA 5C2WB 4AOWA 2TRCB 2QXVA 1RI6A 5IGOA 5EAMA 4JSVC 3UVOA 4X3EA 5FXYA 4ZOVA 4A7JA 2CN3A 3PVUB 1PGUA 3RN0D 2IUVA 1NEXB 5I5JA 5JWZA 3EI3B 2QC5A 4CY3A 5GSAA 3EI3A 2GNQA 5EMMB 5EARA 3EMHA 5EAPA 2J57G 2G9AA 4GM9A 3UVMA 4A08B 4Y7RA 3K26A 5C9ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O45 A;  2OIZ A;  3OL2 B;  4XYH A;  3RN1 D;  1GXR A;  5IJ8 E;  4CZX A;  4O3T B;  1A0R B;  3I7O A;  4ZOZ A;  3UKR C;  4JT6 C;  5K19 A;  2PM7 B;  2CNX A;  5K1C C;  2IWK A;  3RMZ D;  2YNN A;  5IGQ A;  5HE2 B;  3SWS D;  4ERY A;  2P9K C;  4LGN A;  4GQ1 A;  5IT9 g;  1GP2 B;  4Z8L A;  1B9X A;  2AGY A;  2OVP B;  3JPX A;  2YMU A;  3GRE A;  4FAV D;  3PSL A;  3E0C A;  4JT5 C;  2AH0 A;  2B5M A;  4CY2 A;  3DWL C;  3I7N A;  2XL2 A;  2H14 A;  3SJL D;  2I0S A;  3RFH A;  1S4U X;  3PXS D;  3OKY A;  4XYI A;  4QT8 A;  5EMJ B;  4AEZ A;  1NR0 A;  2HYE A;  5CXB B;  3DXM C;  3F3F A;  4JSX C;  1PEV A;  5CXB A;  3I7P A;  2H6N A;  4ZN4 A;  4J78 A;  4N14 A;  3HFQ A;  3JAM g;  3EI1 B;  5B4W A;  2AGW A;  3SBP A;  3SCY A;  3EI1 A;  2GC4 A;  4CI2 A;  4J86 A;  5GXI A;  3W15 A;  3IKO A;  3ULE C;  3AH8 B;  3VGZ A;  2YNO A;  3V9F A;  2HJ4 A;  5FA5 B;  2HXC A;  5H1M A;  3OW8 A;  4H5I A;  5CYK A;  4ZOX A;  4PC0 A;  3MXX A;  4E54 B;  3AFC A;  4L3G D;  3A0F A;  3I7K A;  2P9P C;  2OVQ B;  4FHL A;  3EI4 B;  4U1E I;  3VA6 A;  1YFQ A;  1OMW B;  4JSN C;  3EI4 A;  3EI2 B;  4A0B A;  2BCJ B;  2H9N A;  1B9Y A;  4A0A B;  3I7L A;  1TYQ C;  4D0K A;  2H3X A;  4A0A A;  4A2M A;  2H68 A;  2H9M A;  4JD2 C;  5GMK n;  2AQ5 A;  1P22 A;  5H17 A;  4K3J B;  4D6V A;  3MKS B;  2CO0 C;  3EG6 A;  2Z2N A;  3B7F A;  1PBY B;  3DSM A;  1FWX A;  5H14 A;  4LG8 A;  3RSE C;  4J8G A;  4A09 B;  3C75 H;  3EU7 A;  2GC7 A;  5HQG A;  5IJ7 E;  4UI9 R;  5FKS A;  3UR4 A;  4A09 A;  4K3I D;  4J0X A;  4O9D A;  4ZOY A;  4JSP C;  4FA5 D;  3I7H A;  3N0E A;  2HES X;  2P9N C;  2UZY B;  3NVX A;  1Q47 A;  1QNI A;  2EBS A;  3FM0 A;  4ERZ A;  3KRX B;  5KDO B;  3F3P A;  4A2L A;  1N6D A;  4HDJ A;  2OVR B;  2H6Q A;  3IJC A;  3MZK A;  1JJU B;  2HJB A;  5HYN B;  1PI6 A;  5C2V B;  3PXW D;  4X60 B;  1VYH C;  4CZY A;  4FAN D;  3L4M D;  5A2Q g;  3U4Y A;  3ORV D;  1L0Q A;  4GM3 A;  3ODT A;  4TZ4 A;  3SLE D;  2I0T A;  2Z2O A;  4J82 A;  3RFG A;  3UKU C;  3FGB A;  4KFM B;  4CI3 A;  3OKY B;  2H9L A;  2YBA A;  3C5M A;  3JZH A;  3OKT A;  3NVN A;  3SFZ A;  3OKW A;  4J87 A;  4ES0 A;  4L9O A;  2Q7Q A;  1GG2 B;  5FKQ A;  2XU7 A;  2I3S A;  2H9P A;  4R7A B;  4PXW A;  5I5I A;  4PSW B;  5AMS A;  2BBK H;  4G56 B;  2MTA H;  3DXK C;  5GXH A;  3IJ0 A;  2J55 H;  4QQE A;  4PBY A;  3IJ1 A;  3AL8 A;  3VH0 A;  3AL9 A;  4OWR A;  4CI8 A;  5CYK B;  5TDH B;  4BUJ C;  2XL3 A;  2HKR A;  2I0R A;  2IUP A;  4FB1 D;  3UVK A;  3EWE A;  4CZV A;  3OTT A;  4A0B B;  4U7A A;  3C9C A;  4IA9 A;  2AGL A;  2AH1 A;  3SBQ A;  4GGC A;  4A11 B;  2AGX A;  3BG1 A;  3I2N A;  3RRM C;  3CIK B;  2H13 A;  2PM9 A;  4A11 A;  3JB9 L;  2HKM A;  4L1Q D;  5SXM A;  5THA A;  1TBG A;  2W18 A;  1N6E A;  3BWS A;  3PXT D;  2AGZ A;  2CE8 A;  3CFV A;  3CFS B;  3L4O D;  4GGA A;  5EM2 A;  3V7D B;  3SVW D;  1U2V C;  3PE7 A;  2CO0 A;  4J84 A;  5HE3 B;  1JMZ B;  1R5M A;  4H5J A;  4I79 A;  4CY5 A;  5FLX g;  3SN6 B;  3SHF A;  4J79 A;  2P9L C;  1MDA H;  2CN2 A;  4JXM A;  4FA4 D;  1MG2 A;  3JZN A;  4GQB B;  2YNP A;  4X63 B;  3JRO A;  2G99 A;  2IWF A;  5HE1 B;  1SQ9 A;  5TEF A;  4Y5R D;  4PSX B;  3JRP A;  2PBI B;  5CXC B;  3KRW B;  2P9I C;  3I8E A;  5CXC A;  2O9K A;  4NSX A;  4FA1 D;  4A08 A;  3OL2 A;  4CY1 A;  4J81 A;  2B5N A;  5HE0 B;  4IMM A;  2OJY A;  4GMB A;  2P9U C;  3SXT D;  4ESG A;  4X61 B;  2B5L A;  2I3T A;  4FWW A;  2OK6 A;  4GGD A;  4PNK B;  4YVD A;  3UVL A;  3MKQ A;  4CC9 A;  3SMR A;  2CE9 A;  4ERQ A;  4E5Z B;  3RLM D;  3IIW A;  1MG3 A;  3PVW B;  2P9S C;  4E5Z A;  3J81 g;  4BL0 A;  2Z2P A;  1JOF A;  5AJA A;  2H6K A;  3FRX A;  2J56 H;  3MMY A;  4QL1 A;  2H47 A;  4J73 A;  3BG0 A;  3V5W B;  2OK4 A;  4EWR A;  5TEE A;  3UVN A;  1U4C A;  3I89 A;  1K8K C;  4QRJ A;  2XYI A;  4FA9 D;  2YB8 B;  3F3G A;  4BH6 A;  3SBR A;  3AL8 B;  3NVQ A;  1SHY B;  4J8B A;  3GFC A;  4O1Q D;  3ZWL B;  5EMK B;  1N6F A;  1XHM A;  1K32 A;  4PBZ A;  4OZU A;  3IIY A;  1JMX B;  2IAA A;  4MK0 B;  4LG9 A;  3P4F A;  4O3U B;  4CI1 A;  1ERJ A;  2IUQ A;  3J80 g;  3I8C A;  1XIP A;  5AFU 3;  4XEI C;  2PM9 B;  4J77 A;  5TF2 A;  2IUR A;  3MZL A;  5EAL A;  4GQ2 P;  5I5M A;  1XKS A;  5EML B;  5IC7 A;  2PM6 B;  4GZ8 A;  3K27 A;  4GM8 A;  1SQJ A;  5FKT A;  4E54 A;  3PSC B;  1GOT B;  3JZG A;  4J0W A;  5EM2 B;  5FKR A;  4L3H D;  3N0D A;  3EI2 A;  1OLZ A;  2UZX B;  3C99 A;  3DM0 A;  5FQD A;  2B4E A;  5C2W B;  4AOW A;  2TRC B;  2QXV A;  1RI6 A;  5IGO A;  5EAM A;  4JSV C;  3UVO A;  4X3E A;  5FXY A;  4ZOV A;  4A7J A;  2CN3 A;  3PVU B;  1PGU A;  3RN0 D;  2IUV A;  1NEX B;  5I5J A;  5JWZ A;  3EI3 B;  2QC5 A;  4CY3 A;  5GSA A;  3EI3 A;  2GNQ A;  5EMM B;  5EAR A;  3EMH A;  5EAP A;  2J57 G;  2G9A A;  4GM9 A;  3UVM A;  4A08 B;  4Y7R A;  3K26 A;  5C9Z B; 
#chains in the Genus database with same CATH topology
 4O45 A;  2OIZ A;  3OL2 B;  4XYH A;  3RN1 D;  3MUN A;  1GXR A;  5IJ8 E;  4JHN A;  4CZX A;  4O3T B;  2HU8 A;  1A0R B;  2JKX A;  3I7O A;  4ZOZ A;  3UKR C;  4JT6 C;  5K19 A;  3IVM A;  2PM7 B;  2CNX A;  5K1C C;  2IWK A;  3RMZ D;  2YNN A;  5IGQ A;  1I2M B;  5HE2 B;  3SWS D;  3V4V A;  4ERY A;  2P9K C;  4LGN A;  4GQ1 A;  5IT9 g;  1GP2 B;  3ZE1 A;  1JV2 A;  1B9X A;  4Z8L A;  2AGY A;  1H2Z A;  2OVP B;  3JPX A;  2YMU A;  3GRE A;  4FAV D;  3PSL A;  3E0C A;  4JT5 C;  4AN1 A;  2AH0 A;  2B5M A;  4CY2 A;  1GOG A;  3DWL C;  3I7N A;  3FCU A;  3ZDZ A;  2XL2 A;  2H14 A;  3SJL D;  2VZ3 A;  2I0S A;  3RFH A;  1S4U X;  3PXS D;  3EQ9 A;  3OKY A;  4G1E A;  4XYI A;  4QT8 A;  3QHY B;  4AMZ A;  5EMJ B;  4AEZ A;  1NR0 A;  2HYE A;  5CXB B;  3DXM C;  3T3P A;  1M1X A;  3F3F A;  4JSX C;  1PEV A;  5CXB A;  1E8N A;  3I7P A;  2H6N A;  4ZN4 A;  4DNW A;  4J78 A;  4N14 A;  3HFQ A;  3JAM g;  4RE6 A;  3EI1 B;  1U8C A;  5B4W A;  2AGW A;  3SBP A;  3SCY A;  4NC4 A;  3EI1 A;  2GC4 A;  4CI2 A;  4J86 A;  1H2Y A;  5GXI A;  3W15 A;  3IKO A;  3ULE C;  3AH8 B;  3VGZ A;  2YNO A;  3V9F A;  2EIB A;  2HJ4 A;  4WJK A;  5FA5 B;  2HXC A;  3VI4 A;  5H1M A;  3OW8 A;  4H5I A;  5CYK A;  4ZOX A;  3GD1 I;  4PC0 A;  3MXX A;  3IUJ A;  3AFC A;  4E54 B;  4L3G D;  3A0F A;  3I7K A;  2P9P C;  2OVQ B;  2XZG A;  4FHL A;  3EI4 B;  4U1E I;  3VA6 A;  5HDB A;  1YFQ A;  1OMW B;  4JSN C;  3EI4 A;  3EI2 B;  4A0B A;  2BCJ B;  2VDO A;  2H9N A;  1B9Y A;  4A0A B;  3I7L A;  1TYQ C;  4QAM A;  3O4I A;  4D0K A;  2H3X A;  4A0A A;  5M5T A;  4A2M A;  2H68 A;  2H9M A;  4JD2 C;  5GMK n;  3ZE0 A;  1VZ2 A;  2AQ5 A;  2VDP A;  2EIE A;  3O4J A;  1P22 A;  5H17 A;  3VI3 A;  4K3J B;  5M5R A;  3IUQ A;  3MKS B;  4D6V A;  2CO0 C;  3EG6 A;  2Z2N A;  3B7F A;  1JTD B;  1PBY B;  2VDK A;  3DSM A;  1FWX A;  5H14 A;  4LG8 A;  3RSE C;  4J8G A;  4A09 B;  3C75 H;  3EU7 A;  2GC7 A;  5HQG A;  5IJ7 E;  4UI9 R;  5FKS A;  3UR4 A;  4A09 A;  4K3I D;  4J0X A;  4O9D A;  4BP9 A;  4ZOY A;  4JSP C;  4FA5 D;  3I7H A;  3N0E A;  2HES X;  2P9N C;  2UZY B;  3NVX A;  1Q47 A;  5E6S A;  2VDL A;  1QNI A;  4D9S A;  2EBS A;  3IUL A;  3FM0 A;  4ERZ A;  3KRX B;  5KDO B;  3F3P A;  4A2L A;  4O2W A;  1N6D A;  3GC3 B;  4HDJ A;  2OVR B;  2H6Q A;  3IJC A;  3MZK A;  3IUN A;  1JJU B;  2HJB A;  5HYN B;  1PI6 A;  5C2V B;  3PXW D;  4X60 B;  1VYH C;  4CZY A;  4FAN D;  3L4M D;  5A2Q g;  3U4Y A;  3ORV D;  1L0Q A;  3K72 A;  4GM3 A;  3ODT A;  1TYE A;  4TZ4 A;  3SLE D;  2VDM A;  3T3M A;  2I0T A;  2Z2O A;  4J82 A;  3RFG A;  3UKU C;  3NID A;  3FGB A;  4KFM B;  4AX4 A;  4CI3 A;  3OKY B;  2H9L A;  2YBA A;  3C5M A;  3JZH A;  3OKT A;  3NVN A;  3SFZ A;  3OKW A;  4J87 A;  4G55 A;  4ES0 A;  4L9O A;  2Q7Q A;  1GG2 B;  5FKQ A;  2XU7 A;  2I3S A;  2H9P A;  4R7A B;  4PXW A;  5I5I A;  4AMY A;  4PSW B;  5AMS A;  2BBK H;  4G56 B;  2MTA H;  3DXK C;  5GXH A;  4WK2 A;  3IJ0 A;  2J55 H;  4MMY A;  4QQE A;  1C9I A;  2EID A;  3IJ1 A;  4PBY A;  4BCD A;  4NAA A;  1VE7 A;  3AL8 A;  3VH0 A;  3AL9 A;  4OWR A;  4CI8 A;  5CYK B;  5TDH B;  1O6G A;  4BUJ C;  2XL3 A;  2HKR A;  2I0R A;  2IUP A;  4FB1 D;  3UVK A;  3EWE A;  4CZV A;  3OTT A;  4A0B B;  4U7A A;  3C9C A;  4IA9 A;  2AGL A;  2AH1 A;  3SBQ A;  1O6F A;  5C86 A;  4GGC A;  4A11 B;  2AGX A;  3BG1 A;  3I2N A;  3RRM C;  3CIK B;  1VZ3 A;  2VDN A;  2H13 A;  2PM9 A;  4A11 A;  3JB9 L;  1H2W A;  2HU7 A;  2HKM A;  1GOF A;  3NIF A;  4L1Q D;  5SXM A;  5THA A;  1TBG A;  2EIC A;  2W18 A;  1N6E A;  3BWS A;  3PXT D;  2AGZ A;  2CE8 A;  3CFV A;  3CFS B;  2VC2 A;  3O4H A;  4RE5 A;  3L4O D;  4GGA A;  5EM2 A;  3V7D B;  3SVW D;  1U2V C;  2VZ1 A;  2CO0 A;  3PE7 A;  4J84 A;  1K3I A;  1JMZ B;  5HE3 B;  1R5M A;  4H5J A;  4I79 A;  4CY5 A;  5FLX g;  3SN6 B;  3SHF A;  4L1M A;  4J79 A;  1GOH A;  1E8M A;  4JHP C;  2P9L C;  1MDA H;  4Z7N A;  2CN2 A;  1C9L A;  4JXM A;  4FA4 D;  1MG2 A;  3JZN A;  4GQB B;  2YNP A;  3IUM A;  4X63 B;  3V4P A;  3JRO A;  3EQ7 A;  2G99 A;  4WK0 A;  2IWF A;  5HE1 B;  1SQ9 A;  5TEF A;  4AN0 A;  4Y5R D;  4PSX B;  3JRP A;  2PBI B;  5CXC B;  3KRW B;  2P9I C;  3I8E A;  4IRZ A;  5CXC A;  2O9K A;  4NSX A;  4FA1 D;  2WQ8 A;  4BP8 A;  5C92 A;  4A08 A;  3MVD K;  3OL2 A;  4CY1 A;  4DNV A;  4J81 A;  4DNU A;  5M5V A;  2B5N A;  5HE0 B;  4IMM A;  2OJY A;  3QI0 A;  4GMB A;  2P9U C;  3SXT D;  4BCB A;  4ESG A;  5E6U A;  4X61 B;  4Z7O A;  2B5L A;  2I3T A;  2VDQ A;  4FWW A;  2OK6 A;  4GGD A;  4PNK B;  4YVD A;  3UVL A;  4UM9 A;  3MKQ A;  4CC9 A;  3SMR A;  2CE9 A;  4ERQ A;  4E5Z B;  5E6R A;  3RLM D;  4UM8 A;  3IIW A;  1MG3 A;  3PVW B;  2P9S C;  3NIG A;  4E5Z A;  1VE6 A;  3J81 g;  4BL0 A;  2Z2P A;  1JOF A;  1UOO A;  5AJA A;  1BPO A;  2H6K A;  3FRX A;  2J56 H;  3OF7 A;  3MMY A;  4QL1 A;  1QFS A;  2H47 A;  4J73 A;  1UOQ A;  3BG0 A;  3V5W B;  3ZE2 A;  3ZDX A;  3DDU A;  2OK4 A;  4EWR A;  5TEE A;  3UVN A;  1U4C A;  3I89 A;  1K8K C;  3O4G A;  4QRJ A;  2XYI A;  4FA9 D;  2YB8 B;  3F3G A;  4BH6 A;  3SBR A;  3AL8 B;  3NVQ A;  1SHY B;  4J8B A;  2QR5 A;  3GFC A;  4O1Q D;  1L5G A;  5EMK B;  3ZWL B;  1YR2 A;  1N6F A;  1E5T A;  1XHM A;  1K32 A;  1UTC A;  4PBZ A;  4OZU A;  3IIY A;  1JMX B;  2IAA A;  3IJE A;  4MMX A;  2XE4 A;  4MK0 B;  1UOP A;  4LG9 A;  2HU5 A;  3P4F A;  4O3U B;  3IUR A;  4CI1 A;  3EQ8 A;  1ERJ A;  2IUQ A;  3ZDY A;  3J80 g;  3I8C A;  4WK4 A;  1XIP A;  5AFU 3;  4XEI C;  2PM9 B;  4J77 A;  5M5U A;  5TF2 A;  2IUR A;  3MZL A;  5EAL A;  4GQ2 P;  5I5M A;  3FCS A;  5M5S A;  3MUO A;  1XKS A;  5EML B;  1A12 A;  5IC7 A;  2PM6 B;  4GZ8 A;  3K27 A;  4GM8 A;  2QZP A;  4MMZ A;  1SQJ A;  5FFG A;  5FKT A;  4E54 A;  4O02 A;  3PSC B;  1GOT B;  3JZG A;  4J0W A;  2VDR A;  1QFM A;  5FKR A;  5EM2 B;  4L3H D;  3N0D A;  3EI2 A;  4G1M A;  1OLZ A;  2UZX B;  4BCC A;  4NEN A;  3C99 A;  3DM0 A;  5FQD A;  2B4E A;  5M61 A;  5C2W B;  4AOW A;  2TRC B;  1H2X A;  2QXV A;  1RI6 A;  5IGO A;  1T2X A;  2XDW A;  5EAM A;  4JSV C;  3UVO A;  4X3E A;  5FXY A;  4ZOV A;  4A7J A;  2CN3 A;  3PVU B;  1PGU A;  3RN0 D;  2IUV A;  4NBM A;  5FFO A;  1NEX B;  5I5J A;  5JWZ A;  4Z7Q A;  3EI3 B;  3K71 A;  2QC5 A;  4CY3 A;  2BKL A;  5GSA A;  3EI3 A;  3KCI A;  2GNQ A;  5EMM B;  5EAR A;  3EMH A;  5EAP A;  2J57 G;  2G9A A;  4GM9 A;  3UVM A;  4A08 B;  4Y7R A;  3K26 A;  3K6S A;  5C9Z B; 
#chains in the Genus database with same CATH homology
 4O45 A;  2OIZ A;  3OL2 B;  4XYH A;  3RN1 D;  1GXR A;  5IJ8 E;  4CZX A;  4O3T B;  1A0R B;  3I7O A;  4ZOZ A;  3UKR C;  4JT6 C;  5K19 A;  2PM7 B;  2CNX A;  5K1C C;  2IWK A;  3RMZ D;  2YNN A;  5IGQ A;  5HE2 B;  3SWS D;  4ERY A;  2P9K C;  4LGN A;  4GQ1 A;  5IT9 g;  1GP2 B;  4Z8L A;  1B9X A;  2AGY A;  2OVP B;  3JPX A;  2YMU A;  3GRE A;  4FAV D;  3PSL A;  3E0C A;  4JT5 C;  2AH0 A;  2B5M A;  4CY2 A;  3DWL C;  3I7N A;  2XL2 A;  2H14 A;  3SJL D;  2I0S A;  3RFH A;  1S4U X;  3PXS D;  3OKY A;  4XYI A;  4QT8 A;  5EMJ B;  4AEZ A;  1NR0 A;  2HYE A;  5CXB B;  3DXM C;  3F3F A;  4JSX C;  1PEV A;  5CXB A;  3I7P A;  2H6N A;  4ZN4 A;  4J78 A;  4N14 A;  3HFQ A;  3JAM g;  3EI1 B;  5B4W A;  2AGW A;  3SBP A;  3SCY A;  3EI1 A;  2GC4 A;  4CI2 A;  4J86 A;  5GXI A;  3W15 A;  3IKO A;  3ULE C;  3AH8 B;  3VGZ A;  2YNO A;  3V9F A;  2HJ4 A;  5FA5 B;  2HXC A;  5H1M A;  3OW8 A;  4H5I A;  5CYK A;  4ZOX A;  4PC0 A;  3MXX A;  4E54 B;  3AFC A;  4L3G D;  3A0F A;  3I7K A;  2P9P C;  2OVQ B;  4FHL A;  3EI4 B;  4U1E I;  3VA6 A;  1YFQ A;  1OMW B;  4JSN C;  3EI4 A;  3EI2 B;  4A0B A;  2BCJ B;  2H9N A;  1B9Y A;  4A0A B;  3I7L A;  1TYQ C;  4D0K A;  2H3X A;  4A0A A;  4A2M A;  2H68 A;  2H9M A;  4JD2 C;  5GMK n;  2AQ5 A;  1P22 A;  5H17 A;  4K3J B;  4D6V A;  3MKS B;  2CO0 C;  3EG6 A;  2Z2N A;  3B7F A;  1PBY B;  3DSM A;  1FWX A;  5H14 A;  4LG8 A;  3RSE C;  4J8G A;  4A09 B;  3C75 H;  3EU7 A;  2GC7 A;  5HQG A;  5IJ7 E;  4UI9 R;  5FKS A;  3UR4 A;  4A09 A;  4K3I D;  4J0X A;  4O9D A;  4ZOY A;  4JSP C;  4FA5 D;  3I7H A;  3N0E A;  2HES X;  2P9N C;  2UZY B;  3NVX A;  1Q47 A;  1QNI A;  2EBS A;  3FM0 A;  4ERZ A;  3KRX B;  5KDO B;  3F3P A;  4A2L A;  1N6D A;  4HDJ A;  2OVR B;  2H6Q A;  3IJC A;  3MZK A;  1JJU B;  2HJB A;  5HYN B;  1PI6 A;  5C2V B;  3PXW D;  4X60 B;  1VYH C;  4CZY A;  4FAN D;  3L4M D;  5A2Q g;  3U4Y A;  3ORV D;  1L0Q A;  4GM3 A;  3ODT A;  4TZ4 A;  3SLE D;  2I0T A;  2Z2O A;  4J82 A;  3RFG A;  3UKU C;  3FGB A;  4KFM B;  4CI3 A;  3OKY B;  2H9L A;  2YBA A;  3C5M A;  3JZH A;  3OKT A;  3NVN A;  3SFZ A;  3OKW A;  4J87 A;  4ES0 A;  4L9O A;  2Q7Q A;  1GG2 B;  5FKQ A;  2XU7 A;  2I3S A;  2H9P A;  4R7A B;  4PXW A;  5I5I A;  4PSW B;  5AMS A;  2BBK H;  4G56 B;  2MTA H;  3DXK C;  5GXH A;  3IJ0 A;  2J55 H;  4QQE A;  4PBY A;  3IJ1 A;  3AL8 A;  3VH0 A;  3AL9 A;  4OWR A;  4CI8 A;  5CYK B;  5TDH B;  4BUJ C;  2XL3 A;  2HKR A;  2I0R A;  2IUP A;  4FB1 D;  3UVK A;  3EWE A;  4CZV A;  3OTT A;  4A0B B;  4U7A A;  3C9C A;  4IA9 A;  2AGL A;  2AH1 A;  3SBQ A;  4GGC A;  4A11 B;  2AGX A;  3BG1 A;  3I2N A;  3RRM C;  3CIK B;  2H13 A;  2PM9 A;  4A11 A;  3JB9 L;  2HKM A;  4L1Q D;  5SXM A;  5THA A;  1TBG A;  2W18 A;  1N6E A;  3BWS A;  3PXT D;  2AGZ A;  2CE8 A;  3CFV A;  3CFS B;  3L4O D;  4GGA A;  5EM2 A;  3V7D B;  3SVW D;  1U2V C;  3PE7 A;  2CO0 A;  4J84 A;  5HE3 B;  1JMZ B;  1R5M A;  4H5J A;  4I79 A;  4CY5 A;  5FLX g;  3SN6 B;  3SHF A;  4J79 A;  2P9L C;  1MDA H;  2CN2 A;  4JXM A;  4FA4 D;  1MG2 A;  3JZN A;  4GQB B;  2YNP A;  4X63 B;  3JRO A;  2G99 A;  2IWF A;  5HE1 B;  1SQ9 A;  5TEF A;  4Y5R D;  4PSX B;  3JRP A;  2PBI B;  5CXC B;  3KRW B;  2P9I C;  3I8E A;  5CXC A;  2O9K A;  4NSX A;  4FA1 D;  4A08 A;  3OL2 A;  4CY1 A;  4J81 A;  2B5N A;  5HE0 B;  4IMM A;  2OJY A;  4GMB A;  2P9U C;  3SXT D;  4ESG A;  4X61 B;  2B5L A;  2I3T A;  4FWW A;  2OK6 A;  4GGD A;  4PNK B;  4YVD A;  3UVL A;  3MKQ A;  4CC9 A;  3SMR A;  2CE9 A;  4ERQ A;  4E5Z B;  3RLM D;  3IIW A;  1MG3 A;  3PVW B;  2P9S C;  4E5Z A;  3J81 g;  4BL0 A;  2Z2P A;  1JOF A;  5AJA A;  2H6K A;  3FRX A;  2J56 H;  3MMY A;  4QL1 A;  2H47 A;  4J73 A;  3BG0 A;  3V5W B;  2OK4 A;  4EWR A;  5TEE A;  3UVN A;  1U4C A;  3I89 A;  1K8K C;  4QRJ A;  2XYI A;  4FA9 D;  2YB8 B;  3F3G A;  4BH6 A;  3SBR A;  3AL8 B;  3NVQ A;  1SHY B;  4J8B A;  3GFC A;  4O1Q D;  3ZWL B;  5EMK B;  1N6F A;  1XHM A;  1K32 A;  4PBZ A;  4OZU A;  3IIY A;  1JMX B;  2IAA A;  4MK0 B;  4LG9 A;  3P4F A;  4O3U B;  4CI1 A;  1ERJ A;  2IUQ A;  3J80 g;  3I8C A;  1XIP A;  5AFU 3;  4XEI C;  2PM9 B;  4J77 A;  5TF2 A;  2IUR A;  3MZL A;  5EAL A;  4GQ2 P;  5I5M A;  1XKS A;  5EML B;  5IC7 A;  2PM6 B;  4GZ8 A;  3K27 A;  4GM8 A;  1SQJ A;  5FKT A;  4E54 A;  3PSC B;  1GOT B;  3JZG A;  4J0W A;  5EM2 B;  5FKR A;  4L3H D;  3N0D A;  3EI2 A;  1OLZ A;  2UZX B;  3C99 A;  3DM0 A;  5FQD A;  2B4E A;  5C2W B;  4AOW A;  2TRC B;  2QXV A;  1RI6 A;  5IGO A;  5EAM A;  4JSV C;  3UVO A;  4X3E A;  5FXY A;  4ZOV A;  4A7J A;  2CN3 A;  3PVU B;  1PGU A;  3RN0 D;  2IUV A;  1NEX B;  5I5J A;  5JWZ A;  3EI3 B;  2QC5 A;  4CY3 A;  5GSA A;  3EI3 A;  2GNQ A;  5EMM B;  5EAR A;  3EMH A;  5EAP A;  2J57 G;  2G9A A;  4GM9 A;  3UVM A;  4A08 B;  4Y7R A;  3K26 A;  5C9Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...