4CZVA

Structure of the neurospora crassa pan2 wd40 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
324
structure length
324
Chain Sequence
PHMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
total genus 76
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czvA00
2OK4A 3VGZA 4X3EA 3KRWB 4GGCA 2G99A 3I89A 3IKOA 4JT5C 4AOWA 2H68A 3BWSA 4FHLA 4QL1A 4O3TB 1MG2A 3MZLA 3J80g 3RN1D 2IUVA 3MZKA 3C5MA 4J0WA 3I8EA 5C2VB 2PM9B 4FB1D 3EI1B 4MK0B 3RSEC 1GOTB 2CE8A 1RI6A 4BH6A 1JMZB 3OKTA 5CXBA 4ERQA 3OKWA 3UR4A 3RFHA 2J56H 4JT6C 2P9SC 2YNNA 3OW8A 5H14A 2B5MA 1PI6A 1TYQC 4H5JA 5FA5B 4CZXA 1SQ9A 1OMWB 4CY1A 4IA9A 4FWWA 4A0AA 2YMUA 2I0SA 4Y7RA 4J77A 2I3TA 4L1QD 5SXMA 3SWSD 3RLMD 4A2MA 1JJUB 3SFZA 5HQGA 3PE7A 3OKYB 3OL2B 3SN6B 2TRCB 4A11B 5FQDA 3JZHA 4J82A 4X60B 3DM0A 3AL8B 3FM0A 4JSVC 3PXTD 4L3HD 5EAPA 3W15A 3DWLC 3RN0D 5H17A 4FAVD 4K3ID 3SXTD 3L4MD 4ZN4A 3SBPA 3AL9A 1JMXB 3C99A 3PVUB 2OIZA 1U2VC 4A0BB 5CYKA 4J8BA 3F3GA 3V9FA 5AMSA 1GXRA 4J81A 4XYIA 5GXIA 4PXWA 4J8GA 3L4OD 2HESX 5EMJB 5EMMB 4CI1A 3NVQA 3SCYA 3BG0A 2OVRB 2HKRA 4JSPC 4LGNA 3OL2A 3EI4A 1PEVA 5EM2B 4KFMB 4OWRA 3IIWA 5KDOB 4CZYA 3SMRA 3VA6A 5EMLB 4ZOVA 4A2LA 5HE2B 4CI2A 3NVXA 3JZGA 4FA1D 4O45A 4NSXA 1A0RB 4ERYA 3IJCA 2XU7A 5GSAA 2HYEA 5HE0B 5I5MA 2PBIB 4N14A 3NVNA 4XEIC 5HE1B 4OZUA 4PSXB 2HJBA 5CXCB 5IC7A 2GC4A 5B4WA 5TDHB 3MMYA 2P9NC 2B5LA 2UZYB 3J81g 3EU7A 3EMHA 2OVQB 4L9OA 4U7AA 3RFGA 4CY5A 4EWRA 1K8KC 1P22A 4CZVA 2YBAA 5EALA 3ULEC 3RMZD 4UI9R 3B7FA 4J78A 3SBRA 3JPXA 5H1MA 1XIPA 4K3JB 2AGZA 4CY2A 4Y5RD 3JAMg 2GC7A 4QT8A 3PVWB 3FGBA 3K27A 4GMBA 3UKUC 3AFCA 2IWFA 1NEXB 4CI3A 4QQEA 3A0FA 4ERZA 3UVKA 2P9UC 4A7JA 1GG2B 4BL0A 1QNIA 2H9PA 4LG8A 4QRJA 3IJ1A 2GNQA 3V7DB 5GXHA 4PSWB 4O1QD 4TZ4A 2I0RA 1SHYB 4JXMA 3EI2B 2IUPA 4FAND 2G9AA 3PSLA 3SLED 4A08B 2PM9A 3EI1A 3F3FA 4ESGA 4J73A 2CE9A 3C75H 4GQBB 1B9YA 3JROA 1YFQA 1GP2B 5JWZA 2Z2OA 3F3PA 4H5IA 1B9XA 3EI3B 2H9LA 5EMKB 5I5JA 1VYHC 3AH8B 5C2WB 3ODTA 4PNKB 5TF2A 2P9PC 4ZOZA 2AH1A 1NR0A 2H14A 4E5ZB 4PBZA 5FLXg 2W18A 4BUJC 3I8CA 3HFQA 3UVLA 5HYNB 4ZOYA 4AEZA 2XYIA 1N6EA 2OVPB 3OKYA 4A09B 4A11A 5C9ZB 2YB8B 5IJ7E 1PBYB 3U4YA 4Z8LA 4JD2C 4FA5D 2OK6A 3AL8A 4L3GD 4ES0A 2AGLA 2CO0C 3PSCB 5CXBB 4J0XA 5IGQA 4ZOXA 2HXCA 1MG3A 3MKQA 2EBSA 3V5WB 3KRXB 1K32A 2AGWA 2H9MA 4CY3A 4O9DA 4JSNC 5FKQA 3CFSB 2AGYA 2UZXB 2IURA 3E0CA 2O9KA 5HE3B 5FKTA 4A0BA 4A0AB 1PGUA 4X61B 3EG6A 1N6DA 3CIKB 4GQ2P 5EAMA 4CI8A 4HDJA 4GM8A 4GM9A 2XL3A 4LG9A 5FXYA 4E5ZA 4J87A 4YVDA 4JSXC 3MKSB 4O3UB 3JZNA 4CC9A 5K19A 2IAAA 2OJYA 2AGXA 3EWEA 4FA4D 2PM6B 4A09A 5EM2A 3UVOA 3DSMA 4PBYA 2QXVA 3ORVD 2PM7B 3CFVA 2P9LC 2QC5A 1MDAH 3PXWD 1OLZA 2YNOA 3MXXA 2H6NA 5IJ8E 4R7AB 2CO0A 3SHFA 4GGAA 4XYHA 2H6KA 5AJAA 1XKSA 4GQ1A 5IGOA 3VH0A 5CXCA 3P4FA 5CYKB 5FKRA 2CNXA 3SBQA 2XL2A 1N6FA 2AH0A 1FWXA 3I7NA 2J55H 2P9KC 3RRMC 4GGDA 2H6QA 3ZWLB 1ERJA 1JOFA 2MTAH 3UVMA 4E54B 3PXSD 2Z2PA 2BBKH 3I7HA 2H9NA 3EI4B 2H47A 4D0KA 1U4CA 4IMMA 4X63B 3FRXA 3IIYA 3I2NA 3I7LA 3IJ0A 5FKSA 2I0TA 1L0QA 3I7OA 4D6VA 2J57G 2AQ5A 2IWKA 2I3SA 5IT9g 2B5NA 2CN2A 2Q7QA 5GMKn 1S4UX 3OTTA 2CN3A 3DXMC 3GREA 2H3XA 4J79A 4J86A 3UKRC 2IUQA 1XHMA 2BCJB 3BG1A 2YNPA 4U1EI 2Z2NA 3EI2A 4GZ8A 1TBGA 3C9CA 4G56B 2H13A 5TEFA 4I79A 5EARA 5K1CC 4A08A 1SQJA 2HJ4A 4J84A 4FA9D 2P9IC 3DXKC 5I5IA 4GM3A 4E54A 3N0EA 3I7PA 5AFU3 3JRPA 5A2Qg 5TEEA 3GFCA 3EI3A 3SVWD 1Q47A 1R5MA 3N0DA 3UVNA 2HKMA 3I7KA 3JB9L 2B4EA 3K26A 4PC0A 5THAA 3SJLD
chains in the Genus database with same CATH superfamily
2OK4A 3VGZA 4X3EA 3KRWB 4GGCA 2G99A 1GOGA 3I89A 1UOOA 3IKOA 4JT5C 4AOWA 2H68A 3BWSA 4FHLA 4QL1A 2XDWA 4O3TB 1MG2A 3MZLA 3J80g 2VDLA 3GD1I 3RN1D 4UM8A 4Z7NA 2IUVA 3MZKA 1QFMA 3C5MA 4J0WA 3I8EA 5C2VB 2PM9B 1UOQA 2XZGA 3GC3B 4FB1D 3EI1B 4MK0B 3RSEC 1GOTB 2CE8A 1RI6A 4BH6A 1JMZB 3OKTA 5HDBA 1BPOA 5CXBA 4ERQA 1H2WA 1E5TA 3OKWA 3UR4A 3RFHA 2J56H 4JT6C 2P9SC 2YNNA 1M1XA 3OW8A 5H14A 2B5MA 1PI6A 1TYQC 4H5JA 5FA5B 4CZXA 3ZE0A 1SQ9A 1OMWB 3ZE2A 5E6UA 4CY1A 4IA9A 4FWWA 4A0AA 2YMUA 2I0SA 4Y7RA 4J77A 2I3TA 4L1QD 5SXMA 3SWSD 2EIBA 3RLMD 4A2MA 1JJUB 3SFZA 3NIDA 5HQGA 3PE7A 3OKYB 3OL2B 3SN6B 2TRCB 5FFGA 4O02A 4A11B 4MMXA 4JHPC 5FQDA 1H2YA 3JZHA 4J82A 4X60B 3DM0A 3AL8B 3FM0A 4JSVC 4UM9A 3PXTD 4NENA 4L3HD 5EAPA 3W15A 3DWLC 3RN0D 5H17A 2VC2A 4K3ID 4FAVD 4BCDA 3SXTD 5M5TA 3L4MD 3MUNA 3SBPA 4ZN4A 3AL9A 3K6SA 2JKXA 1JMXB 3C99A 3PVUB 2OIZA 1U2VC 4A0BB 5CYKA 4J8BA 3F3GA 3V9FA 5AMSA 1GXRA 4J81A 4XYIA 5GXIA 4PXWA 4J8GA 3L4OD 2HESX 5EMJB 5EMMB 4CI1A 4AX4A 3NVQA 3SCYA 3BG0A 2OVRB 2HKRA 3IUNA 2VZ1A 5M5RA 4JSPC 4LGNA 3OL2A 2HU8A 1E8NA 1PEVA 3EI4A 4KFMB 4OWRA 3IIWA 5EM2B 5KDOB 4CZYA 3O4HA 3SMRA 3VA6A 2EICA 5EMLB 4ZOVA 4A2LA 4WK4A 1VE7A 4L1MA 5HE2B 3IUMA 4CI2A 3NVXA 3JZGA 4FA1D 1JV2A 4O45A 4NSXA 1A0RB 4ERYA 3IJCA 3IURA 5E6SA 2XU7A 5GSAA 4QAMA 2HYEA 5HE0B 5I5MA 2PBIB 4N14A 3NVNA 4XEIC 5HE1B 5M5UA 4OZUA 4PSXB 2HJBA 2VZ3A 5CXCB 5IC7A 2GC4A 5B4WA 5TDHB 3MMYA 2P9NC 2B5LA 2UZYB 3J81g 3MVDK 3EU7A 3OF7A 4DNWA 3EMHA 3QI0A 4DNVA 2OVQB 2VDNA 4L9OA 4MMZA 4U7AA 3RFGA 4CY5A 4EWRA 1K8KC 1P22A 4WJKA 4CZVA 2YBAA 5EALA 3ULEC 3RMZD 4UI9R 3B7FA 4J78A 3SBRA 3JPXA 5H1MA 1XIPA 4K3JB 2AGZA 4CY2A 4Y5RD 3T3MA 3JAMg 2GC7A 4QT8A 4G1EA 3PVWB 4JHNA 3FGBA 3K27A 3O4GA 4RE5A 3ZE1A 4GMBA 1O6GA 3AFCA 3UKUC 2IWFA 4G55A 3EQ8A 1NEXB 4CI3A 4QQEA 3A0FA 4ERZA 3UVKA 2P9UC 4A7JA 1I2MB 1GG2B 4NC4A 1C9IA 4BL0A 5M61A 4Z7QA 3DDUA 1QNIA 2H9PA 4LG8A 4QRJA 3IJ1A 2GNQA 3V7DB 5GXHA 4PSWB 4O1QD 4TZ4A 2I0RA 1SHYB 3IULA 4JXMA 3EI2B 2IUPA 4RE6A 4FAND 2VDRA 2G9AA 3PSLA 3SLED 1VZ3A 2VDMA 4A08B 2PM9A 3EI1A 3F3FA 4ESGA 4J73A 2CE9A 3C75H 4GQBB 1B9YA 3JROA 1L5GA 5THAA 1YFQA 1GP2B 5JWZA 2Z2OA 3ZDYA 3F3PA 4H5IA 1B9XA 4Z7OA 3EI3B 2H9LA 5EMKB 5I5JA 1VYHC 2QR5A 3AH8B 4BP8A 5C2WB 5FFOA 3ODTA 4PNKB 5TF2A 2P9PC 4ZOZA 2AH1A 1NR0A 1YR2A 2H14A 4E5ZB 4NAAA 4PBZA 3IVMA 5FLXg 2W18A 4BUJC 3I8CA 1E8MA 3HFQA 3UVLA 5HYNB 4ZOYA 4AEZA 2XYIA 1UTCA 1N6EA 2OVPB 4D9SA 3OKYA 4A09B 4BCBA 4A11A 3VI3A 5C9ZB 2YB8B 5IJ7E 1PBYB 3U4YA 4Z8LA 3K71A 2BKLA 4JD2C 2OK6A 4FA5D 3AL8A 4AMYA 4L3GD 1C9LA 4ES0A 2AGLA 2CO0C 4WK0A 3PSCB 5C92A 5CXBB 4J0XA 5IGQA 4ZOXA 1UOPA 1MG3A 2HXCA 2XE4A 2EBSA 3MKQA 3V5WB 4WK2A 1VE6A 3KRXB 2EIDA 2VDQA 2VDPA 5E6RA 1K32A 2AGWA 2H9MA 4CY3A 2WQ8A 4O9DA 4JSNC 5FKQA 5M5VA 3CFSB 2AGYA 2UZXB 2IURA 3E0CA 2O9KA 2VDOA 1T2XA 5HE3B 5FKTA 4A0BA 4A0AB 1PGUA 4X61B 3EG6A 1N6DA 3CIKB 4GQ2P 1GOHA 5EAMA 4CI8A 2VDKA 4HDJA 4GM8A 4GM9A 2XL3A 4LG9A 5FXYA 4E5ZA 4J87A 4YVDA 4JSXC 3MKSB 4O3UB 3JZNA 3MUOA 4CC9A 5K19A 2IAAA 3IUJA 2OJYA 2AGXA 3EWEA 1GOFA 4FA4D 2PM6B 4A09A 5EM2A 4O2WA 3UVOA 1K3IA 4MMYA 3DSMA 4BP9A 4AN1A 4PBYA 2QXVA 1U8CA 3ORVD 2PM7B 5M5SA 2P9LC 3CFVA 2EIEA 3IJEA 2QC5A 1MDAH 1O6FA 2QZPA 1OLZA 3PXWD 2YNOA 3MXXA 2H6NA 3K72A 1H2XA 3EQ7A 5IJ8E 3IUQA 4R7AB 2CO0A 3KCIA 3SHFA 4GGAA 4XYHA 2H6KA 5AJAA 1XKSA 4GQ1A 5IGOA 3VH0A 5CXCA 3P4FA 4IRZA 5CYKB 5FKRA 2CNXA 3SBQA 2XL2A 3T3PA 1N6FA 2AH0A 1FWXA 3I7NA 3EQ9A 3V4VA 2J55H 2P9KC 3RRMC 4GGDA 2H6QA 3ZWLB 1ERJA 1JOFA 2MTAH 3UVMA 4E54B 3PXSD 2Z2PA 2BBKH 3I7HA 5C86A 2H9NA 3EI4B 2H47A 4D0KA 1U4CA 4IMMA 3O4IA 1QFSA 4X63B 4AN0A 3FRXA 3V4PA 3O4JA 3IIYA 3I2NA 3I7LA 3IJ0A 5FKSA 2I0TA 1L0QA 3I7OA 1TYEA 4D6VA 2J57G 2AQ5A 2IWKA 2I3SA 5IT9g 2B5NA 3QHYB 2CN2A 3ZDZA 2Q7QA 3VI4A 5GMKn 1S4UX 3OTTA 2CN3A 3DXMC 3GREA 2H3XA 4J79A 1A12A 4J86A 3UKRC 1JTDB 2HU5A 2IUQA 1XHMA 4G1MA 3NIGA 2BCJB 3BG1A 2YNPA 4U1EI 2Z2NA 3EI2A 4GZ8A 1TBGA 3C9CA 4G56B 2H13A 5TEFA 4AMZA 4I79A 5EARA 5K1CC 4A08A 1SQJA 3ZDXA 2HJ4A 4J84A 4FA9D 2P9IC 3DXKC 5I5IA 4GM3A 4E54A 3N0EA 3I7PA 5AFU3 3JRPA 1H2ZA 3NIFA 5A2Qg 3FCSA 5TEEA 4DNUA 1VZ2A 3GFCA 3EI3A 3SVWD 1Q47A 1R5MA 3N0DA 3UVNA 2HKMA 3I7KA 3JB9L 2B4EA 3FCUA 3K26A 4NBMA 4BCCA 4PC0A 2HU7A 3SJLD
chains in the Genus database with same CATH topology
2OK4A 3VGZA 4X3EA 3KRWB 4GGCA 2G99A 3I89A 3IKOA 4JT5C 4AOWA 2H68A 3BWSA 4FHLA 4QL1A 4O3TB 1MG2A 3MZLA 3J80g 3RN1D 2IUVA 3MZKA 3C5MA 4J0WA 3I8EA 5C2VB 2PM9B 4FB1D 3EI1B 4MK0B 3RSEC 1GOTB 2CE8A 1RI6A 4BH6A 1JMZB 3OKTA 5CXBA 4ERQA 3OKWA 3UR4A 3RFHA 2J56H 4JT6C 2P9SC 2YNNA 3OW8A 5H14A 2B5MA 1PI6A 1TYQC 4H5JA 5FA5B 4CZXA 1SQ9A 1OMWB 4CY1A 4IA9A 4FWWA 4A0AA 2YMUA 2I0SA 4Y7RA 4J77A 2I3TA 4L1QD 5SXMA 3SWSD 3RLMD 4A2MA 1JJUB 3SFZA 5HQGA 3PE7A 3OKYB 3OL2B 3SN6B 2TRCB 4A11B 5FQDA 3JZHA 4J82A 4X60B 3DM0A 3AL8B 3FM0A 4JSVC 3PXTD 4L3HD 5EAPA 3W15A 3DWLC 3RN0D 5H17A 4FAVD 4K3ID 3SXTD 3L4MD 4ZN4A 3SBPA 3AL9A 1JMXB 3C99A 3PVUB 2OIZA 1U2VC 4A0BB 5CYKA 4J8BA 3F3GA 3V9FA 5AMSA 1GXRA 4J81A 4XYIA 5GXIA 4PXWA 4J8GA 3L4OD 2HESX 5EMJB 5EMMB 4CI1A 3NVQA 3SCYA 3BG0A 2OVRB 2HKRA 4JSPC 4LGNA 3OL2A 3EI4A 1PEVA 5EM2B 4KFMB 4OWRA 3IIWA 5KDOB 4CZYA 3SMRA 3VA6A 5EMLB 4ZOVA 4A2LA 5HE2B 4CI2A 3NVXA 3JZGA 4FA1D 4O45A 4NSXA 1A0RB 4ERYA 3IJCA 2XU7A 5GSAA 2HYEA 5HE0B 5I5MA 2PBIB 4N14A 3NVNA 4XEIC 5HE1B 4OZUA 4PSXB 2HJBA 5CXCB 5IC7A 2GC4A 5B4WA 5TDHB 3MMYA 2P9NC 2B5LA 2UZYB 3J81g 3EU7A 3EMHA 2OVQB 4L9OA 4U7AA 3RFGA 4CY5A 4EWRA 1K8KC 1P22A 4CZVA 2YBAA 5EALA 3ULEC 3RMZD 4UI9R 3B7FA 4J78A 3SBRA 3JPXA 5H1MA 1XIPA 4K3JB 2AGZA 4CY2A 4Y5RD 3JAMg 2GC7A 4QT8A 3PVWB 3FGBA 3K27A 4GMBA 3UKUC 3AFCA 2IWFA 1NEXB 4CI3A 4QQEA 3A0FA 4ERZA 3UVKA 2P9UC 4A7JA 1GG2B 4BL0A 1QNIA 2H9PA 4LG8A 4QRJA 3IJ1A 2GNQA 3V7DB 5GXHA 4PSWB 4O1QD 4TZ4A 2I0RA 1SHYB 4JXMA 3EI2B 2IUPA 4FAND 2G9AA 3PSLA 3SLED 4A08B 2PM9A 3EI1A 3F3FA 4ESGA 4J73A 2CE9A 3C75H 4GQBB 1B9YA 3JROA 1YFQA 1GP2B 5JWZA 2Z2OA 3F3PA 4H5IA 1B9XA 3EI3B 2H9LA 5EMKB 5I5JA 1VYHC 3AH8B 5C2WB 3ODTA 4PNKB 5TF2A 2P9PC 4ZOZA 2AH1A 1NR0A 2H14A 4E5ZB 4PBZA 5FLXg 2W18A 4BUJC 3I8CA 3HFQA 3UVLA 5HYNB 4ZOYA 4AEZA 2XYIA 1N6EA 2OVPB 3OKYA 4A09B 4A11A 5C9ZB 2YB8B 5IJ7E 1PBYB 3U4YA 4Z8LA 4JD2C 4FA5D 2OK6A 3AL8A 4L3GD 4ES0A 2AGLA 2CO0C 3PSCB 5CXBB 4J0XA 5IGQA 4ZOXA 2HXCA 1MG3A 3MKQA 2EBSA 3V5WB 3KRXB 1K32A 2AGWA 2H9MA 4CY3A 4O9DA 4JSNC 5FKQA 3CFSB 2AGYA 2UZXB 2IURA 3E0CA 2O9KA 5HE3B 5FKTA 4A0BA 4A0AB 1PGUA 4X61B 3EG6A 1N6DA 3CIKB 4GQ2P 5EAMA 4CI8A 4HDJA 4GM8A 4GM9A 2XL3A 4LG9A 5FXYA 4E5ZA 4J87A 4YVDA 4JSXC 3MKSB 4O3UB 3JZNA 4CC9A 5K19A 2IAAA 2OJYA 2AGXA 3EWEA 4FA4D 2PM6B 4A09A 5EM2A 3UVOA 3DSMA 4PBYA 2QXVA 3ORVD 2PM7B 3CFVA 2P9LC 2QC5A 1MDAH 3PXWD 1OLZA 2YNOA 3MXXA 2H6NA 5IJ8E 4R7AB 2CO0A 3SHFA 4GGAA 4XYHA 2H6KA 5AJAA 1XKSA 4GQ1A 5IGOA 3VH0A 5CXCA 3P4FA 5CYKB 5FKRA 2CNXA 3SBQA 2XL2A 1N6FA 2AH0A 1FWXA 3I7NA 2J55H 2P9KC 3RRMC 4GGDA 2H6QA 3ZWLB 1ERJA 1JOFA 2MTAH 3UVMA 4E54B 3PXSD 2Z2PA 2BBKH 3I7HA 2H9NA 3EI4B 2H47A 4D0KA 1U4CA 4IMMA 4X63B 3FRXA 3IIYA 3I2NA 3I7LA 3IJ0A 5FKSA 2I0TA 1L0QA 3I7OA 4D6VA 2J57G 2AQ5A 2IWKA 2I3SA 5IT9g 2B5NA 2CN2A 2Q7QA 5GMKn 1S4UX 3OTTA 2CN3A 3DXMC 3GREA 2H3XA 4J79A 4J86A 3UKRC 2IUQA 1XHMA 2BCJB 3BG1A 2YNPA 4U1EI 2Z2NA 3EI2A 4GZ8A 1TBGA 3C9CA 4G56B 2H13A 5TEFA 4I79A 5EARA 5K1CC 4A08A 1SQJA 2HJ4A 4J84A 4FA9D 2P9IC 3DXKC 5I5IA 4GM3A 4E54A 3N0EA 3I7PA 5AFU3 3JRPA 5A2Qg 5TEEA 3GFCA 3EI3A 3SVWD 1Q47A 1R5MA 3N0DA 3UVNA 2HKMA 3I7KA 3JB9L 2B4EA 3K26A 4PC0A 5THAA 3SJLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 A;  3VGZ A;  4X3E A;  3KRW B;  4GGC A;  2G99 A;  3I89 A;  3IKO A;  4JT5 C;  4AOW A;  2H68 A;  3BWS A;  4FHL A;  4QL1 A;  4O3T B;  1MG2 A;  3MZL A;  3J80 g;  3RN1 D;  2IUV A;  3MZK A;  3C5M A;  4J0W A;  3I8E A;  5C2V B;  2PM9 B;  4FB1 D;  3EI1 B;  4MK0 B;  3RSE C;  1GOT B;  2CE8 A;  1RI6 A;  4BH6 A;  1JMZ B;  3OKT A;  5CXB A;  4ERQ A;  3OKW A;  3UR4 A;  3RFH A;  2J56 H;  4JT6 C;  2P9S C;  2YNN A;  3OW8 A;  5H14 A;  2B5M A;  1PI6 A;  1TYQ C;  4H5J A;  5FA5 B;  4CZX A;  1SQ9 A;  1OMW B;  4CY1 A;  4IA9 A;  4FWW A;  4A0A A;  2YMU A;  2I0S A;  4Y7R A;  4J77 A;  2I3T A;  4L1Q D;  5SXM A;  3SWS D;  3RLM D;  4A2M A;  1JJU B;  3SFZ A;  5HQG A;  3PE7 A;  3OKY B;  3OL2 B;  3SN6 B;  2TRC B;  4A11 B;  5FQD A;  3JZH A;  4J82 A;  4X60 B;  3DM0 A;  3AL8 B;  3FM0 A;  4JSV C;  3PXT D;  4L3H D;  5EAP A;  3W15 A;  3DWL C;  3RN0 D;  5H17 A;  4FAV D;  4K3I D;  3SXT D;  3L4M D;  4ZN4 A;  3SBP A;  3AL9 A;  1JMX B;  3C99 A;  3PVU B;  2OIZ A;  1U2V C;  4A0B B;  5CYK A;  4J8B A;  3F3G A;  3V9F A;  5AMS A;  1GXR A;  4J81 A;  4XYI A;  5GXI A;  4PXW A;  4J8G A;  3L4O D;  2HES X;  5EMJ B;  5EMM B;  4CI1 A;  3NVQ A;  3SCY A;  3BG0 A;  2OVR B;  2HKR A;  4JSP C;  4LGN A;  3OL2 A;  3EI4 A;  1PEV A;  5EM2 B;  4KFM B;  4OWR A;  3IIW A;  5KDO B;  4CZY A;  3SMR A;  3VA6 A;  5EML B;  4ZOV A;  4A2L A;  5HE2 B;  4CI2 A;  3NVX A;  3JZG A;  4FA1 D;  4O45 A;  4NSX A;  1A0R B;  4ERY A;  3IJC A;  2XU7 A;  5GSA A;  2HYE A;  5HE0 B;  5I5M A;  2PBI B;  4N14 A;  3NVN A;  4XEI C;  5HE1 B;  4OZU A;  4PSX B;  2HJB A;  5CXC B;  5IC7 A;  2GC4 A;  5B4W A;  5TDH B;  3MMY A;  2P9N C;  2B5L A;  2UZY B;  3J81 g;  3EU7 A;  3EMH A;  2OVQ B;  4L9O A;  4U7A A;  3RFG A;  4CY5 A;  4EWR A;  1K8K C;  1P22 A;  4CZV A;  2YBA A;  5EAL A;  3ULE C;  3RMZ D;  4UI9 R;  3B7F A;  4J78 A;  3SBR A;  3JPX A;  5H1M A;  1XIP A;  4K3J B;  2AGZ A;  4CY2 A;  4Y5R D;  3JAM g;  2GC7 A;  4QT8 A;  3PVW B;  3FGB A;  3K27 A;  4GMB A;  3UKU C;  3AFC A;  2IWF A;  1NEX B;  4CI3 A;  4QQE A;  3A0F A;  4ERZ A;  3UVK A;  2P9U C;  4A7J A;  1GG2 B;  4BL0 A;  1QNI A;  2H9P A;  4LG8 A;  4QRJ A;  3IJ1 A;  2GNQ A;  3V7D B;  5GXH A;  4PSW B;  4O1Q D;  4TZ4 A;  2I0R A;  1SHY B;  4JXM A;  3EI2 B;  2IUP A;  4FAN D;  2G9A A;  3PSL A;  3SLE D;  4A08 B;  2PM9 A;  3EI1 A;  3F3F A;  4ESG A;  4J73 A;  2CE9 A;  3C75 H;  4GQB B;  1B9Y A;  3JRO A;  1YFQ A;  1GP2 B;  5JWZ A;  2Z2O A;  3F3P A;  4H5I A;  1B9X A;  3EI3 B;  2H9L A;  5EMK B;  5I5J A;  1VYH C;  3AH8 B;  5C2W B;  3ODT A;  4PNK B;  5TF2 A;  2P9P C;  4ZOZ A;  2AH1 A;  1NR0 A;  2H14 A;  4E5Z B;  4PBZ A;  5FLX g;  2W18 A;  4BUJ C;  3I8C A;  3HFQ A;  3UVL A;  5HYN B;  4ZOY A;  4AEZ A;  2XYI A;  1N6E A;  2OVP B;  3OKY A;  4A09 B;  4A11 A;  5C9Z B;  2YB8 B;  5IJ7 E;  1PBY B;  3U4Y A;  4Z8L A;  4JD2 C;  4FA5 D;  2OK6 A;  3AL8 A;  4L3G D;  4ES0 A;  2AGL A;  2CO0 C;  3PSC B;  5CXB B;  4J0X A;  5IGQ A;  4ZOX A;  2HXC A;  1MG3 A;  3MKQ A;  2EBS A;  3V5W B;  3KRX B;  1K32 A;  2AGW A;  2H9M A;  4CY3 A;  4O9D A;  4JSN C;  5FKQ A;  3CFS B;  2AGY A;  2UZX B;  2IUR A;  3E0C A;  2O9K A;  5HE3 B;  5FKT A;  4A0B A;  4A0A B;  1PGU A;  4X61 B;  3EG6 A;  1N6D A;  3CIK B;  4GQ2 P;  5EAM A;  4CI8 A;  4HDJ A;  4GM8 A;  4GM9 A;  2XL3 A;  4LG9 A;  5FXY A;  4E5Z A;  4J87 A;  4YVD A;  4JSX C;  3MKS B;  4O3U B;  3JZN A;  4CC9 A;  5K19 A;  2IAA A;  2OJY A;  2AGX A;  3EWE A;  4FA4 D;  2PM6 B;  4A09 A;  5EM2 A;  3UVO A;  3DSM A;  4PBY A;  2QXV A;  3ORV D;  2PM7 B;  3CFV A;  2P9L C;  2QC5 A;  1MDA H;  3PXW D;  1OLZ A;  2YNO A;  3MXX A;  2H6N A;  5IJ8 E;  4R7A B;  2CO0 A;  3SHF A;  4GGA A;  4XYH A;  2H6K A;  5AJA A;  1XKS A;  4GQ1 A;  5IGO A;  3VH0 A;  5CXC A;  3P4F A;  5CYK B;  5FKR A;  2CNX A;  3SBQ A;  2XL2 A;  1N6F A;  2AH0 A;  1FWX A;  3I7N A;  2J55 H;  2P9K C;  3RRM C;  4GGD A;  2H6Q A;  3ZWL B;  1ERJ A;  1JOF A;  2MTA H;  3UVM A;  4E54 B;  3PXS D;  2Z2P A;  2BBK H;  3I7H A;  2H9N A;  3EI4 B;  2H47 A;  4D0K A;  1U4C A;  4IMM A;  4X63 B;  3FRX A;  3IIY A;  3I2N A;  3I7L A;  3IJ0 A;  5FKS A;  2I0T A;  1L0Q A;  3I7O A;  4D6V A;  2J57 G;  2AQ5 A;  2IWK A;  2I3S A;  5IT9 g;  2B5N A;  2CN2 A;  2Q7Q A;  5GMK n;  1S4U X;  3OTT A;  2CN3 A;  3DXM C;  3GRE A;  2H3X A;  4J79 A;  4J86 A;  3UKR C;  2IUQ A;  1XHM A;  2BCJ B;  3BG1 A;  2YNP A;  4U1E I;  2Z2N A;  3EI2 A;  4GZ8 A;  1TBG A;  3C9C A;  4G56 B;  2H13 A;  5TEF A;  4I79 A;  5EAR A;  5K1C C;  4A08 A;  1SQJ A;  2HJ4 A;  4J84 A;  4FA9 D;  2P9I C;  3DXK C;  5I5I A;  4GM3 A;  4E54 A;  3N0E A;  3I7P A;  5AFU 3;  3JRP A;  5A2Q g;  5TEE A;  3GFC A;  3EI3 A;  3SVW D;  1Q47 A;  1R5M A;  3N0D A;  3UVN A;  2HKM A;  3I7K A;  3JB9 L;  2B4E A;  3K26 A;  4PC0 A;  5THA A;  3SJL D; 
#chains in the Genus database with same CATH topology
 2OK4 A;  3VGZ A;  4X3E A;  3KRW B;  4GGC A;  2G99 A;  1GOG A;  3I89 A;  1UOO A;  3IKO A;  4JT5 C;  4AOW A;  2H68 A;  3BWS A;  4FHL A;  4QL1 A;  2XDW A;  4O3T B;  1MG2 A;  3MZL A;  3J80 g;  2VDL A;  3GD1 I;  3RN1 D;  4UM8 A;  4Z7N A;  2IUV A;  3MZK A;  1QFM A;  3C5M A;  4J0W A;  3I8E A;  5C2V B;  2PM9 B;  1UOQ A;  2XZG A;  3GC3 B;  4FB1 D;  3EI1 B;  4MK0 B;  3RSE C;  1GOT B;  2CE8 A;  1RI6 A;  4BH6 A;  1JMZ B;  3OKT A;  5HDB A;  1BPO A;  5CXB A;  4ERQ A;  1H2W A;  1E5T A;  3OKW A;  3UR4 A;  3RFH A;  2J56 H;  4JT6 C;  2P9S C;  2YNN A;  1M1X A;  3OW8 A;  5H14 A;  2B5M A;  1PI6 A;  1TYQ C;  4H5J A;  5FA5 B;  4CZX A;  3ZE0 A;  1SQ9 A;  1OMW B;  3ZE2 A;  5E6U A;  4CY1 A;  4IA9 A;  4FWW A;  4A0A A;  2YMU A;  2I0S A;  4Y7R A;  4J77 A;  2I3T A;  4L1Q D;  5SXM A;  3SWS D;  2EIB A;  3RLM D;  4A2M A;  1JJU B;  3SFZ A;  3NID A;  5HQG A;  3PE7 A;  3OKY B;  3OL2 B;  3SN6 B;  2TRC B;  5FFG A;  4O02 A;  4A11 B;  4MMX A;  4JHP C;  5FQD A;  1H2Y A;  3JZH A;  4J82 A;  4X60 B;  3DM0 A;  3AL8 B;  3FM0 A;  4JSV C;  4UM9 A;  3PXT D;  4NEN A;  4L3H D;  5EAP A;  3W15 A;  3DWL C;  3RN0 D;  5H17 A;  2VC2 A;  4K3I D;  4FAV D;  4BCD A;  3SXT D;  5M5T A;  3L4M D;  3MUN A;  3SBP A;  4ZN4 A;  3AL9 A;  3K6S A;  2JKX A;  1JMX B;  3C99 A;  3PVU B;  2OIZ A;  1U2V C;  4A0B B;  5CYK A;  4J8B A;  3F3G A;  3V9F A;  5AMS A;  1GXR A;  4J81 A;  4XYI A;  5GXI A;  4PXW A;  4J8G A;  3L4O D;  2HES X;  5EMJ B;  5EMM B;  4CI1 A;  4AX4 A;  3NVQ A;  3SCY A;  3BG0 A;  2OVR B;  2HKR A;  3IUN A;  2VZ1 A;  5M5R A;  4JSP C;  4LGN A;  3OL2 A;  2HU8 A;  1E8N A;  1PEV A;  3EI4 A;  4KFM B;  4OWR A;  3IIW A;  5EM2 B;  5KDO B;  4CZY A;  3O4H A;  3SMR A;  3VA6 A;  2EIC A;  5EML B;  4ZOV A;  4A2L A;  4WK4 A;  1VE7 A;  4L1M A;  5HE2 B;  3IUM A;  4CI2 A;  3NVX A;  3JZG A;  4FA1 D;  1JV2 A;  4O45 A;  4NSX A;  1A0R B;  4ERY A;  3IJC A;  3IUR A;  5E6S A;  2XU7 A;  5GSA A;  4QAM A;  2HYE A;  5HE0 B;  5I5M A;  2PBI B;  4N14 A;  3NVN A;  4XEI C;  5HE1 B;  5M5U A;  4OZU A;  4PSX B;  2HJB A;  2VZ3 A;  5CXC B;  5IC7 A;  2GC4 A;  5B4W A;  5TDH B;  3MMY A;  2P9N C;  2B5L A;  2UZY B;  3J81 g;  3MVD K;  3EU7 A;  3OF7 A;  4DNW A;  3EMH A;  3QI0 A;  4DNV A;  2OVQ B;  2VDN A;  4L9O A;  4MMZ A;  4U7A A;  3RFG A;  4CY5 A;  4EWR A;  1K8K C;  1P22 A;  4WJK A;  4CZV A;  2YBA A;  5EAL A;  3ULE C;  3RMZ D;  4UI9 R;  3B7F A;  4J78 A;  3SBR A;  3JPX A;  5H1M A;  1XIP A;  4K3J B;  2AGZ A;  4CY2 A;  4Y5R D;  3T3M A;  3JAM g;  2GC7 A;  4QT8 A;  4G1E A;  3PVW B;  4JHN A;  3FGB A;  3K27 A;  3O4G A;  4RE5 A;  3ZE1 A;  4GMB A;  1O6G A;  3AFC A;  3UKU C;  2IWF A;  4G55 A;  3EQ8 A;  1NEX B;  4CI3 A;  4QQE A;  3A0F A;  4ERZ A;  3UVK A;  2P9U C;  4A7J A;  1I2M B;  1GG2 B;  4NC4 A;  1C9I A;  4BL0 A;  5M61 A;  4Z7Q A;  3DDU A;  1QNI A;  2H9P A;  4LG8 A;  4QRJ A;  3IJ1 A;  2GNQ A;  3V7D B;  5GXH A;  4PSW B;  4O1Q D;  4TZ4 A;  2I0R A;  1SHY B;  3IUL A;  4JXM A;  3EI2 B;  2IUP A;  4RE6 A;  4FAN D;  2VDR A;  2G9A A;  3PSL A;  3SLE D;  1VZ3 A;  2VDM A;  4A08 B;  2PM9 A;  3EI1 A;  3F3F A;  4ESG A;  4J73 A;  2CE9 A;  3C75 H;  4GQB B;  1B9Y A;  3JRO A;  1L5G A;  5THA A;  1YFQ A;  1GP2 B;  5JWZ A;  2Z2O A;  3ZDY A;  3F3P A;  4H5I A;  1B9X A;  4Z7O A;  3EI3 B;  2H9L A;  5EMK B;  5I5J A;  1VYH C;  2QR5 A;  3AH8 B;  4BP8 A;  5C2W B;  5FFO A;  3ODT A;  4PNK B;  5TF2 A;  2P9P C;  4ZOZ A;  2AH1 A;  1NR0 A;  1YR2 A;  2H14 A;  4E5Z B;  4NAA A;  4PBZ A;  3IVM A;  5FLX g;  2W18 A;  4BUJ C;  3I8C A;  1E8M A;  3HFQ A;  3UVL A;  5HYN B;  4ZOY A;  4AEZ A;  2XYI A;  1UTC A;  1N6E A;  2OVP B;  4D9S A;  3OKY A;  4A09 B;  4BCB A;  4A11 A;  3VI3 A;  5C9Z B;  2YB8 B;  5IJ7 E;  1PBY B;  3U4Y A;  4Z8L A;  3K71 A;  2BKL A;  4JD2 C;  2OK6 A;  4FA5 D;  3AL8 A;  4AMY A;  4L3G D;  1C9L A;  4ES0 A;  2AGL A;  2CO0 C;  4WK0 A;  3PSC B;  5C92 A;  5CXB B;  4J0X A;  5IGQ A;  4ZOX A;  1UOP A;  1MG3 A;  2HXC A;  2XE4 A;  2EBS A;  3MKQ A;  3V5W B;  4WK2 A;  1VE6 A;  3KRX B;  2EID A;  2VDQ A;  2VDP A;  5E6R A;  1K32 A;  2AGW A;  2H9M A;  4CY3 A;  2WQ8 A;  4O9D A;  4JSN C;  5FKQ A;  5M5V A;  3CFS B;  2AGY A;  2UZX B;  2IUR A;  3E0C A;  2O9K A;  2VDO A;  1T2X A;  5HE3 B;  5FKT A;  4A0B A;  4A0A B;  1PGU A;  4X61 B;  3EG6 A;  1N6D A;  3CIK B;  4GQ2 P;  1GOH A;  5EAM A;  4CI8 A;  2VDK A;  4HDJ A;  4GM8 A;  4GM9 A;  2XL3 A;  4LG9 A;  5FXY A;  4E5Z A;  4J87 A;  4YVD A;  4JSX C;  3MKS B;  4O3U B;  3JZN A;  3MUO A;  4CC9 A;  5K19 A;  2IAA A;  3IUJ A;  2OJY A;  2AGX A;  3EWE A;  1GOF A;  4FA4 D;  2PM6 B;  4A09 A;  5EM2 A;  4O2W A;  3UVO A;  1K3I A;  4MMY A;  3DSM A;  4BP9 A;  4AN1 A;  4PBY A;  2QXV A;  1U8C A;  3ORV D;  2PM7 B;  5M5S A;  2P9L C;  3CFV A;  2EIE A;  3IJE A;  2QC5 A;  1MDA H;  1O6F A;  2QZP A;  1OLZ A;  3PXW D;  2YNO A;  3MXX A;  2H6N A;  3K72 A;  1H2X A;  3EQ7 A;  5IJ8 E;  3IUQ A;  4R7A B;  2CO0 A;  3KCI A;  3SHF A;  4GGA A;  4XYH A;  2H6K A;  5AJA A;  1XKS A;  4GQ1 A;  5IGO A;  3VH0 A;  5CXC A;  3P4F A;  4IRZ A;  5CYK B;  5FKR A;  2CNX A;  3SBQ A;  2XL2 A;  3T3P A;  1N6F A;  2AH0 A;  1FWX A;  3I7N A;  3EQ9 A;  3V4V A;  2J55 H;  2P9K C;  3RRM C;  4GGD A;  2H6Q A;  3ZWL B;  1ERJ A;  1JOF A;  2MTA H;  3UVM A;  4E54 B;  3PXS D;  2Z2P A;  2BBK H;  3I7H A;  5C86 A;  2H9N A;  3EI4 B;  2H47 A;  4D0K A;  1U4C A;  4IMM A;  3O4I A;  1QFS A;  4X63 B;  4AN0 A;  3FRX A;  3V4P A;  3O4J A;  3IIY A;  3I2N A;  3I7L A;  3IJ0 A;  5FKS A;  2I0T A;  1L0Q A;  3I7O A;  1TYE A;  4D6V A;  2J57 G;  2AQ5 A;  2IWK A;  2I3S A;  5IT9 g;  2B5N A;  3QHY B;  2CN2 A;  3ZDZ A;  2Q7Q A;  3VI4 A;  5GMK n;  1S4U X;  3OTT A;  2CN3 A;  3DXM C;  3GRE A;  2H3X A;  4J79 A;  1A12 A;  4J86 A;  3UKR C;  1JTD B;  2HU5 A;  2IUQ A;  1XHM A;  4G1M A;  3NIG A;  2BCJ B;  3BG1 A;  2YNP A;  4U1E I;  2Z2N A;  3EI2 A;  4GZ8 A;  1TBG A;  3C9C A;  4G56 B;  2H13 A;  5TEF A;  4AMZ A;  4I79 A;  5EAR A;  5K1C C;  4A08 A;  1SQJ A;  3ZDX A;  2HJ4 A;  4J84 A;  4FA9 D;  2P9I C;  3DXK C;  5I5I A;  4GM3 A;  4E54 A;  3N0E A;  3I7P A;  5AFU 3;  3JRP A;  1H2Z A;  3NIF A;  5A2Q g;  3FCS A;  5TEE A;  4DNU A;  1VZ2 A;  3GFC A;  3EI3 A;  3SVW D;  1Q47 A;  1R5M A;  3N0D A;  3UVN A;  2HKM A;  3I7K A;  3JB9 L;  2B4E A;  3FCU A;  3K26 A;  4NBM A;  4BCC A;  4PC0 A;  2HU7 A;  3SJL D; 
#chains in the Genus database with same CATH homology
 2OK4 A;  3VGZ A;  4X3E A;  3KRW B;  4GGC A;  2G99 A;  3I89 A;  3IKO A;  4JT5 C;  4AOW A;  2H68 A;  3BWS A;  4FHL A;  4QL1 A;  4O3T B;  1MG2 A;  3MZL A;  3J80 g;  3RN1 D;  2IUV A;  3MZK A;  3C5M A;  4J0W A;  3I8E A;  5C2V B;  2PM9 B;  4FB1 D;  3EI1 B;  4MK0 B;  3RSE C;  1GOT B;  2CE8 A;  1RI6 A;  4BH6 A;  1JMZ B;  3OKT A;  5CXB A;  4ERQ A;  3OKW A;  3UR4 A;  3RFH A;  2J56 H;  4JT6 C;  2P9S C;  2YNN A;  3OW8 A;  5H14 A;  2B5M A;  1PI6 A;  1TYQ C;  4H5J A;  5FA5 B;  4CZX A;  1SQ9 A;  1OMW B;  4CY1 A;  4IA9 A;  4FWW A;  4A0A A;  2YMU A;  2I0S A;  4Y7R A;  4J77 A;  2I3T A;  4L1Q D;  5SXM A;  3SWS D;  3RLM D;  4A2M A;  1JJU B;  3SFZ A;  5HQG A;  3PE7 A;  3OKY B;  3OL2 B;  3SN6 B;  2TRC B;  4A11 B;  5FQD A;  3JZH A;  4J82 A;  4X60 B;  3DM0 A;  3AL8 B;  3FM0 A;  4JSV C;  3PXT D;  4L3H D;  5EAP A;  3W15 A;  3DWL C;  3RN0 D;  5H17 A;  4FAV D;  4K3I D;  3SXT D;  3L4M D;  4ZN4 A;  3SBP A;  3AL9 A;  1JMX B;  3C99 A;  3PVU B;  2OIZ A;  1U2V C;  4A0B B;  5CYK A;  4J8B A;  3F3G A;  3V9F A;  5AMS A;  1GXR A;  4J81 A;  4XYI A;  5GXI A;  4PXW A;  4J8G A;  3L4O D;  2HES X;  5EMJ B;  5EMM B;  4CI1 A;  3NVQ A;  3SCY A;  3BG0 A;  2OVR B;  2HKR A;  4JSP C;  4LGN A;  3OL2 A;  3EI4 A;  1PEV A;  5EM2 B;  4KFM B;  4OWR A;  3IIW A;  5KDO B;  4CZY A;  3SMR A;  3VA6 A;  5EML B;  4ZOV A;  4A2L A;  5HE2 B;  4CI2 A;  3NVX A;  3JZG A;  4FA1 D;  4O45 A;  4NSX A;  1A0R B;  4ERY A;  3IJC A;  2XU7 A;  5GSA A;  2HYE A;  5HE0 B;  5I5M A;  2PBI B;  4N14 A;  3NVN A;  4XEI C;  5HE1 B;  4OZU A;  4PSX B;  2HJB A;  5CXC B;  5IC7 A;  2GC4 A;  5B4W A;  5TDH B;  3MMY A;  2P9N C;  2B5L A;  2UZY B;  3J81 g;  3EU7 A;  3EMH A;  2OVQ B;  4L9O A;  4U7A A;  3RFG A;  4CY5 A;  4EWR A;  1K8K C;  1P22 A;  4CZV A;  2YBA A;  5EAL A;  3ULE C;  3RMZ D;  4UI9 R;  3B7F A;  4J78 A;  3SBR A;  3JPX A;  5H1M A;  1XIP A;  4K3J B;  2AGZ A;  4CY2 A;  4Y5R D;  3JAM g;  2GC7 A;  4QT8 A;  3PVW B;  3FGB A;  3K27 A;  4GMB A;  3UKU C;  3AFC A;  2IWF A;  1NEX B;  4CI3 A;  4QQE A;  3A0F A;  4ERZ A;  3UVK A;  2P9U C;  4A7J A;  1GG2 B;  4BL0 A;  1QNI A;  2H9P A;  4LG8 A;  4QRJ A;  3IJ1 A;  2GNQ A;  3V7D B;  5GXH A;  4PSW B;  4O1Q D;  4TZ4 A;  2I0R A;  1SHY B;  4JXM A;  3EI2 B;  2IUP A;  4FAN D;  2G9A A;  3PSL A;  3SLE D;  4A08 B;  2PM9 A;  3EI1 A;  3F3F A;  4ESG A;  4J73 A;  2CE9 A;  3C75 H;  4GQB B;  1B9Y A;  3JRO A;  1YFQ A;  1GP2 B;  5JWZ A;  2Z2O A;  3F3P A;  4H5I A;  1B9X A;  3EI3 B;  2H9L A;  5EMK B;  5I5J A;  1VYH C;  3AH8 B;  5C2W B;  3ODT A;  4PNK B;  5TF2 A;  2P9P C;  4ZOZ A;  2AH1 A;  1NR0 A;  2H14 A;  4E5Z B;  4PBZ A;  5FLX g;  2W18 A;  4BUJ C;  3I8C A;  3HFQ A;  3UVL A;  5HYN B;  4ZOY A;  4AEZ A;  2XYI A;  1N6E A;  2OVP B;  3OKY A;  4A09 B;  4A11 A;  5C9Z B;  2YB8 B;  5IJ7 E;  1PBY B;  3U4Y A;  4Z8L A;  4JD2 C;  4FA5 D;  2OK6 A;  3AL8 A;  4L3G D;  4ES0 A;  2AGL A;  2CO0 C;  3PSC B;  5CXB B;  4J0X A;  5IGQ A;  4ZOX A;  2HXC A;  1MG3 A;  3MKQ A;  2EBS A;  3V5W B;  3KRX B;  1K32 A;  2AGW A;  2H9M A;  4CY3 A;  4O9D A;  4JSN C;  5FKQ A;  3CFS B;  2AGY A;  2UZX B;  2IUR A;  3E0C A;  2O9K A;  5HE3 B;  5FKT A;  4A0B A;  4A0A B;  1PGU A;  4X61 B;  3EG6 A;  1N6D A;  3CIK B;  4GQ2 P;  5EAM A;  4CI8 A;  4HDJ A;  4GM8 A;  4GM9 A;  2XL3 A;  4LG9 A;  5FXY A;  4E5Z A;  4J87 A;  4YVD A;  4JSX C;  3MKS B;  4O3U B;  3JZN A;  4CC9 A;  5K19 A;  2IAA A;  2OJY A;  2AGX A;  3EWE A;  4FA4 D;  2PM6 B;  4A09 A;  5EM2 A;  3UVO A;  3DSM A;  4PBY A;  2QXV A;  3ORV D;  2PM7 B;  3CFV A;  2P9L C;  2QC5 A;  1MDA H;  3PXW D;  1OLZ A;  2YNO A;  3MXX A;  2H6N A;  5IJ8 E;  4R7A B;  2CO0 A;  3SHF A;  4GGA A;  4XYH A;  2H6K A;  5AJA A;  1XKS A;  4GQ1 A;  5IGO A;  3VH0 A;  5CXC A;  3P4F A;  5CYK B;  5FKR A;  2CNX A;  3SBQ A;  2XL2 A;  1N6F A;  2AH0 A;  1FWX A;  3I7N A;  2J55 H;  2P9K C;  3RRM C;  4GGD A;  2H6Q A;  3ZWL B;  1ERJ A;  1JOF A;  2MTA H;  3UVM A;  4E54 B;  3PXS D;  2Z2P A;  2BBK H;  3I7H A;  2H9N A;  3EI4 B;  2H47 A;  4D0K A;  1U4C A;  4IMM A;  4X63 B;  3FRX A;  3IIY A;  3I2N A;  3I7L A;  3IJ0 A;  5FKS A;  2I0T A;  1L0Q A;  3I7O A;  4D6V A;  2J57 G;  2AQ5 A;  2IWK A;  2I3S A;  5IT9 g;  2B5N A;  2CN2 A;  2Q7Q A;  5GMK n;  1S4U X;  3OTT A;  2CN3 A;  3DXM C;  3GRE A;  2H3X A;  4J79 A;  4J86 A;  3UKR C;  2IUQ A;  1XHM A;  2BCJ B;  3BG1 A;  2YNP A;  4U1E I;  2Z2N A;  3EI2 A;  4GZ8 A;  1TBG A;  3C9C A;  4G56 B;  2H13 A;  5TEF A;  4I79 A;  5EAR A;  5K1C C;  4A08 A;  1SQJ A;  2HJ4 A;  4J84 A;  4FA9 D;  2P9I C;  3DXK C;  5I5I A;  4GM3 A;  4E54 A;  3N0E A;  3I7P A;  5AFU 3;  3JRP A;  5A2Q g;  5TEE A;  3GFC A;  3EI3 A;  3SVW D;  1Q47 A;  1R5M A;  3N0D A;  3UVN A;  2HKM A;  3I7K A;  3JB9 L;  2B4E A;  3K26 A;  4PC0 A;  5THA A;  3SJL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...