4CZVA

Structure of the neurospora crassa pan2 wd40 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
324
structure length
324
Chain Sequence
PHMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
total genus 76
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czvA00
4A11B 5HE0B 4FAVD 4OWRA 1N6DA 1NEXB 1TBGA 2I0TA 4PBZA 3F3GA 5IT9g 2QC5A 4TZ4A 4LG9A 3I7PA 3EI4A 3ODTA 5FKSA 5IC7A 3MKQA 3C5MA 1QNIA 2H68A 2AH1A 3F3PA 2B5LA 5I5MA 2H47A 3OKYA 1PGUA 4I79A 5EARA 4J84A 3RLMD 3SBQA 4FB1D 4JXMA 4H5JA 3PSLA 4ES0A 1JMXB 4YVDA 4ZOYA 2GC7A 2I0RA 2CN2A 2PM6B 3PVUB 2P9NC 3SLED 1U4CA 4A0BB 1N6EA 3EI1B 5GSAA 3OKWA 2P9IC 2H14A 1K8KC 2UZYB 5GXHA 1A0RB 5EMMB 3I8EA 4CY3A 4QQEA 2G9AA 5B4WA 2YNNA 4GM9A 5AJAA 3JZHA 4J8GA 3EG6A 3AL9A 2GC4A 4GMBA 4CZYA 4K3JB 4CZXA 3I7OA 5H14A 4L1QD 3VH0A 2J56H 3IIWA 4X63B 2XYIA 1PI6A 3JZNA 4G56B 2AGYA 4QT8A 5KDOB 2CE8A 5JWZA 4GZ8A 3SJLD 3BWSA 4JSXC 5HE1B 4HDJA 2P9UC 4CZVA 5CXBB 4J0XA 4IA9A 4X61B 4JSNC 4ZOXA 5IGQA 3AFCA 1RI6A 5EM2B 3GREA 3NVXA 3MZKA 5I5IA 3DXKC 2Z2PA 3UVKA 3ZWLB 3BG0A 4K3ID 4J78A 3C99A 1B9YA 3IJ1A 2P9PC 4XYHA 3SFZA 4PXWA 2QXVA 3OL2B 4J81A 2OVPB 3C75H 1SQ9A 3EWEA 4CY5A 3N0EA 4J8BA 4BH6A 1XKSA 4U7AA 4PC0A 2XL3A 3EU7A 1N6FA 2IUVA 5AFU3 1MDAH 5C2VB 4QRJA 4Z8LA 3JZGA 2CO0C 4ERZA 4J73A 4E54B 2HKRA 4Y5RD 4J0WA 2PM7B 4X60B 4XYIA 1PEVA 3OTTA 4O1QD 4GQ2P 2OJYA 4GGDA 5I5JA 2IUQA 2AGLA 3MXXA 3V5WB 4J86A 3GFCA 2IWFA 4JSPC 3UKRC 4J77A 3B7FA 2YNOA 3OL2A 3RN1D 3VGZA 4JT5C 3IKOA 4GM8A 4CI1A 1B9XA 3J81g 2AH0A 1Q47A 3N0DA 5FA5B 3KRXB 2HESX 3K26A 5EALA 2EBSA 4O9DA 2MTAH 4GM3A 3J80g 5C9ZB 4X3EA 2BCJB 2I0SA 2B5MA 4ERYA 1XIPA 4CI8A 5EMKB 4MK0B 3JPXA 2AGWA 1VYHC 4KFMB 3RRMC 1YFQA 2YB8B 2I3SA 3DWLC 5FLXg 4PBYA 5THAA 4XEIC 3RSEC 3A0FA 4FWWA 3U4YA 5TEEA 1GG2B 2AQ5A 2Z2NA 4FHLA 4N14A 4LG8A 5IJ7E 5EMLB 2H13A 3IJ0A 3SMRA 3FM0A 2AGZA 2P9LC 3UVMA 5TDHB 1JOFA 2H6NA 4EWRA 4A08A 4Y7RA 1R5MA 4OZUA 1P22A 3ORVD 5CXBA 5HE2B 4A09B 3F3FA 2B4EA 2HKMA 4BL0A 5HQGA 4J82A 1SHYB 3MMYA 1PBYB 3KRWB 3ULEC 3V7DB 5GXIA 2OVQB 1JJUB 3IJCA 4GQ1A 4D6VA 2XL2A 2PM9B 5CXCA 3SBPA 3FGBA 2OVRB 4L3GD 4A0AA 3UR4A 1ERJA 3V9FA 4E5ZA 2G99A 4ZN4A 2H9NA 5CYKA 4J79A 2H6KA 2IAAA 5K19A 4L3HD 3DM0A 1OLZA 3UVNA 4PNKB 3SVWD 3SWSD 5FQDA 4O3TB 2H9PA 3I7LA 3MZLA 4JT6C 2XU7A 5A2Qg 3IIYA 4A2LA 5SXMA 5TEFA 1S4UX 3JRPA 2HJBA 3HFQA 5H1MA 3SCYA 2I3TA 3BG1A 2J55H 3UVLA 4CI2A 3EI1A 2UZXB 5EAMA 4R7AB 4D0KA 4A0AB 3I2NA 3UVOA 4CI3A 3EI4B 3NVQA 3JROA 3CFSB 3CIKB 2Z2OA 3PVWB 4LGNA 3L4OD 2PBIB 2OK4A 2H9LA 2OIZA 4FA5D 3EI2A 2TRCB 5EM2A 2P9KC 4PSXB 1GOTB 3RFHA 2H9MA 4GQBB 4JSVC 3OW8A 5FKTA 3AL8B 4NSXA 5FKRA 2BBKH 3I7NA 3EMHA 4QL1A 4A7JA 2O9KA 4UI9R 3VA6A 4CY1A 5EMJB 2HXCA 4E5ZB 3EI3A 2Q7QA 3PXSD 3SXTD 1OMWB 3OKTA 3JAMg 3PSCB 4A0BA 5C2WB 5TF2A 1TYQC 3EI3B 5FXYA 1MG2A 4CC9A 4FA1D 3I7KA 4AOWA 3OKYB 3FRXA 5IGOA 5FKQA 1U2VC 2CN3A 4E54A 2CO0A 1NR0A 3UKUC 3MKSB 3RFGA 5HE3B 4J87A 4FA9D 4BUJC 3I8CA 4IMMA 4CY2A 4ZOZA 2PM9A 3CFVA 3W15A 4GGAA 1GXRA 3SHFA 2YBAA 3K27A 2HJ4A 2IWKA 2IURA 3C9CA 4A2MA 2W18A 2H3XA 3PXTD 3JB9L 4U1EI 1XHMA 3RN0D 4AEZA 5EAPA 5GMKn 3PXWD 3SBRA 5IJ8E 4A08B 1K32A 5AMSA 4O3UB 3P4FA 2CE9A 4PSWB 2H6QA 2YNPA 2AGXA 3I7HA 3SN6B 2YMUA 5HYNB 4A09A 2HYEA 2P9SC 3DSMA 2GNQA 3DXMC 1MG3A 4JD2C 3RMZD 2IUPA 4FA4D 2J57G 3E0CA 1SQJA 5H17A 2OK6A 4H5IA 4A11A 5CXCB 4ERQA 1JMZB 2B5NA 4L9OA 3AH8B 3PE7A 1FWXA 4FAND 3EI2B 2CNXA 4ZOVA 4ESGA 5CYKB 1GP2B 3AL8A 3I89A 3NVNA 4O45A 3L4MD 1L0QA 5K1CC 4GGCA
chains in the Genus database with same CATH superfamily
4A11B 5HE0B 4FAVD 4OWRA 4D9SA 1N6DA 1NEXB 1TBGA 2I0TA 3GC3B 4PBZA 5M5TA 3F3GA 5IT9g 2QC5A 4TZ4A 4LG9A 3K72A 3I7PA 3EI4A 3ODTA 5FKSA 5IC7A 3MKQA 3C5MA 1UTCA 1QNIA 2H68A 2AH1A 3F3PA 2B5LA 5I5MA 2H47A 3OKYA 1PGUA 4I79A 4UM9A 4J84A 5EARA 5E6SA 3RLMD 3SBQA 4FB1D 1C9LA 4JXMA 4H5JA 3PSLA 4ES0A 1JMXB 4YVDA 5HDBA 4ZOYA 2GC7A 2I0RA 2CN2A 2PM6B 3PVUB 2P9NC 2QR5A 3FCUA 3SLED 1VZ2A 1U4CA 4A0BB 1N6EA 1VE6A 1E8NA 3EI1B 5GSAA 3OKWA 2P9IC 2H14A 1K8KC 2UZYB 5GXHA 3DDUA 1A0RB 5EMMB 2EIBA 3MVDK 3I8EA 4CY3A 5M5SA 4QQEA 2G9AA 1E8MA 1L5GA 5B4WA 2YNNA 4GM9A 3ZDYA 5AJAA 4NC4A 3JZHA 4J8GA 3EG6A 3AL9A 2GC4A 4GMBA 5M61A 4CZYA 4K3JB 1VE7A 4CZXA 3K6SA 3I7OA 3ZDZA 3IUNA 5H14A 4L1QD 3VH0A 2J56H 3IIWA 4X63B 2XYIA 1PI6A 3JZNA 4G56B 2AGYA 1U8CA 4QT8A 5KDOB 2BKLA 2CE8A 5JWZA 4GZ8A 3SJLD 3BWSA 4JSXC 4IRZA 5HE1B 4HDJA 2P9UC 4BCCA 4CZVA 5CXBB 3O4GA 4WJKA 4J0XA 4IA9A 4X61B 4JSNC 4ZOXA 5IGQA 5C92A 3AFCA 1RI6A 5EM2B 3GREA 3EQ9A 5M5UA 3NVXA 3KCIA 2EIDA 3MZKA 2JKXA 5I5IA 3DXKC 2Z2PA 3UVKA 3NIFA 3ZWLB 3BG0A 4K3ID 4G55A 4J78A 3C99A 1B9YA 3IJ1A 4NENA 3ZE0A 2P9PC 4XYHA 2VC2A 3SFZA 4AN1A 2VDKA 4PXWA 2QXVA 3OL2B 4J81A 2OVPB 3C75H 1SQ9A 3ZDXA 3EWEA 4G1EA 4CY5A 3N0EA 4J8BA 4BH6A 1XKSA 4U7AA 4PC0A 2XL3A 3EU7A 1N6FA 2XZGA 2IUVA 3T3PA 5AFU3 1MDAH 5C2VB 4QRJA 4Z8LA 3JZGA 2CO0C 4ERZA 4J73A 4E54B 2HKRA 4O2WA 4Y5RD 3QI0A 4J0WA 2PM7B 1C9IA 2VDNA 4NBMA 4X60B 4XYIA 1VZ3A 3O4IA 1PEVA 3OTTA 4WK2A 4DNUA 4O1QD 4GQ2P 2OJYA 4GGDA 5I5JA 3MUOA 4WK4A 2IUQA 2AGLA 3MXXA 3V5WB 5E6UA 4J86A 4BP8A 3GFCA 2IWFA 4JSPC 1QFMA 3EQ7A 3UKRC 3VI4A 4J77A 2VDMA 3B7FA 2YNOA 3OL2A 3RN1D 3VGZA 4JT5C 3IKOA 1GOFA 4GM8A 4CI1A 1B9XA 3J81g 1UOQA 2AH0A 1Q47A 3N0DA 5FA5B 3KRXB 2HESX 1E5TA 3K26A 5EALA 2EBSA 4O9DA 4Z7OA 2MTAH 4GM3A 4UM8A 3J80g 1JTDB 5C9ZB 4X3EA 2BCJB 2I0SA 2B5MA 4ERYA 1XIPA 1H2YA 4CI8A 5EMKB 4MK0B 1O6FA 3O4JA 1UOPA 3JPXA 2AGWA 4BCBA 1H2XA 4WK0A 1VYHC 4KFMB 3RRMC 1YFQA 4AN0A 4AMZA 1GOGA 2YB8B 2I3SA 3DWLC 5FLXg 4PBYA 5THAA 1T2XA 5E6RA 4XEIC 5FFOA 3RSEC 4AX4A 3A0FA 4FWWA 3U4YA 5TEEA 1BPOA 1GG2B 2AQ5A 4DNVA 2Z2NA 4FHLA 4N14A 4LG8A 5IJ7E 5EMLB 2H13A 3IJ0A 3IUJA 3SMRA 3FM0A 2AGZA 2P9LC 3NIDA 3FCSA 3UVMA 2VZ1A 5TDHB 1JOFA 2HU8A 2H6NA 2HU5A 3O4HA 4EWRA 4A08A 4Y7RA 1R5MA 4OZUA 1P22A 3IURA 3ORVD 5CXBA 5HE2B 5C86A 4A09B 3F3FA 2B4EA 2HKMA 4BL0A 5HQGA 4J82A 1SHYB 3MMYA 1PBYB 1A12A 3KRWB 3ULEC 3IJEA 3V7DB 5GXIA 2OVQB 1JJUB 3IJCA 4GQ1A 2QZPA 4D6VA 2XL2A 2PM9B 3NIGA 5CXCA 3FGBA 3SBPA 2OVRB 4L3GD 4A0AA 3UR4A 1ERJA 3V9FA 3IVMA 3K71A 4E5ZA 2G99A 4ZN4A 4BP9A 3ZE1A 3GD1I 2H9NA 2WQ8A 5CYKA 4J79A 2H6KA 2IAAA 4DNWA 5K19A 1H2ZA 4L3HD 3DM0A 1JV2A 1OLZA 3UVNA 4PNKB 3SVWD 3SWSD 5FQDA 4O3TB 2H9PA 3I7LA 3MZLA 4JT6C 4RE5A 2XU7A 4BCDA 5A2Qg 3IIYA 1GOHA 2VDQA 2XDWA 4A2LA 5SXMA 5TEFA 1S4UX 3JRPA 2HJBA 3HFQA 5H1MA 3SCYA 2I3TA 4Z7QA 3BG1A 2J55H 3UVLA 4CI2A 3EI1A 2UZXB 5EAMA 4R7AB 4D0KA 4A0AB 1O6GA 3I2NA 3UVOA 4CI3A 3EI4B 3NVQA 3JROA 3CFSB 3CIKB 2Z2OA 3PVWB 4LGNA 3L4OD 2PBIB 2OK4A 2H9LA 4NAAA 2EIEA 3IUQA 4RE6A 2OIZA 2VDOA 4FA5D 3EI2A 2TRCB 5EM2A 2P9KC 4O02A 4PSXB 3EQ8A 2EICA 2XE4A 1GOTB 3RFHA 2H9MA 4GQBB 4JSVC 3OW8A 5FKTA 3AL8B 1K3IA 4NSXA 5FKRA 3IUMA 2BBKH 3I7NA 3EMHA 4QL1A 4A7JA 2O9KA 4UI9R 3VA6A 4Z7NA 4CY1A 5EMJB 2HXCA 4E5ZB 3EI3A 2Q7QA 3PXSD 5FFGA 3SXTD 1OMWB 3OKTA 3JAMg 3PSCB 3V4VA 3ZE2A 4A0BA 5C2WB 5TF2A 1TYQC 3EI3B 5FXYA 1MG2A 4CC9A 4FA1D 3I7KA 4AOWA 3OKYB 3FRXA 4AMYA 5IGOA 2VDLA 5FKQA 1M1XA 1U2VC 2CN3A 4E54A 2CO0A 1NR0A 3T3MA 3UKUC 4MMZA 4G1MA 3MKSB 3RFGA 5HE3B 4J87A 4FA9D 3VI3A 1TYEA 4JHPC 3I8CA 4IMMA 4BUJC 4CY2A 4MMYA 4ZOZA 2PM9A 3CFVA 3W15A 4GGAA 1GXRA 3SHFA 2YBAA 3K27A 2HJ4A 2IWKA 2IURA 3C9CA 3V4PA 4A2MA 2W18A 2H3XA 3PXTD 1YR2A 3JB9L 4U1EI 1XHMA 3QHYB 3RN0D 4AEZA 4JHNA 1H2WA 5EAPA 5GMKn 3PXWD 3SBRA 5IJ8E 4A08B 1K32A 5AMSA 2VDRA 4O3UB 4QAMA 3P4FA 2CE9A 4PSWB 2H6QA 2YNPA 2AGXA 3I7HA 4MMXA 3SN6B 2YMUA 5HYNB 4A09A 2HYEA 2P9SC 3DSMA 2GNQA 3MUNA 1QFSA 1I2MB 3DXMC 1MG3A 3OF7A 3IULA 4JD2C 3RMZD 2IUPA 4FA4D 2J57G 3E0CA 1SQJA 5H17A 1UOOA 2OK6A 4H5IA 4A11A 5CXCB 4ERQA 1JMZB 2B5NA 4L9OA 3AH8B 3PE7A 1FWXA 4FAND 3EI2B 2CNXA 2VDPA 5M5RA 4L1MA 4ZOVA 5CYKB 4ESGA 5M5VA 1GP2B 3AL8A 3I89A 3NVNA 2HU7A 4O45A 3L4MD 1L0QA 5K1CC 4GGCA 2VZ3A
chains in the Genus database with same CATH topology
4A11B 5HE0B 4FAVD 4OWRA 1N6DA 1NEXB 1TBGA 2I0TA 4PBZA 3F3GA 5IT9g 2QC5A 4TZ4A 4LG9A 3I7PA 3EI4A 3ODTA 5FKSA 5IC7A 3MKQA 3C5MA 1QNIA 2H68A 2AH1A 3F3PA 2B5LA 5I5MA 2H47A 3OKYA 1PGUA 4I79A 5EARA 4J84A 3RLMD 3SBQA 4FB1D 4JXMA 4H5JA 3PSLA 4ES0A 1JMXB 4YVDA 4ZOYA 2GC7A 2I0RA 2CN2A 2PM6B 3PVUB 2P9NC 3SLED 1U4CA 4A0BB 1N6EA 3EI1B 5GSAA 3OKWA 2P9IC 2H14A 1K8KC 2UZYB 5GXHA 1A0RB 5EMMB 3I8EA 4CY3A 4QQEA 2G9AA 5B4WA 2YNNA 4GM9A 5AJAA 3JZHA 4J8GA 3EG6A 3AL9A 2GC4A 4GMBA 4CZYA 4K3JB 4CZXA 3I7OA 5H14A 4L1QD 3VH0A 2J56H 3IIWA 4X63B 2XYIA 1PI6A 3JZNA 4G56B 2AGYA 4QT8A 5KDOB 2CE8A 5JWZA 4GZ8A 3SJLD 3BWSA 4JSXC 5HE1B 4HDJA 2P9UC 4CZVA 5CXBB 4J0XA 4IA9A 4X61B 4JSNC 4ZOXA 5IGQA 3AFCA 1RI6A 5EM2B 3GREA 3NVXA 3MZKA 5I5IA 3DXKC 2Z2PA 3UVKA 3ZWLB 3BG0A 4K3ID 4J78A 3C99A 1B9YA 3IJ1A 2P9PC 4XYHA 3SFZA 4PXWA 2QXVA 3OL2B 4J81A 2OVPB 3C75H 1SQ9A 3EWEA 4CY5A 3N0EA 4J8BA 4BH6A 1XKSA 4U7AA 4PC0A 2XL3A 3EU7A 1N6FA 2IUVA 5AFU3 1MDAH 5C2VB 4QRJA 4Z8LA 3JZGA 2CO0C 4ERZA 4J73A 4E54B 2HKRA 4Y5RD 4J0WA 2PM7B 4X60B 4XYIA 1PEVA 3OTTA 4O1QD 4GQ2P 2OJYA 4GGDA 5I5JA 2IUQA 2AGLA 3MXXA 3V5WB 4J86A 3GFCA 2IWFA 4JSPC 3UKRC 4J77A 3B7FA 2YNOA 3OL2A 3RN1D 3VGZA 4JT5C 3IKOA 4GM8A 4CI1A 1B9XA 3J81g 2AH0A 1Q47A 3N0DA 5FA5B 3KRXB 2HESX 3K26A 5EALA 2EBSA 4O9DA 2MTAH 4GM3A 3J80g 5C9ZB 4X3EA 2BCJB 2I0SA 2B5MA 4ERYA 1XIPA 4CI8A 5EMKB 4MK0B 3JPXA 2AGWA 1VYHC 4KFMB 3RRMC 1YFQA 2YB8B 2I3SA 3DWLC 5FLXg 4PBYA 5THAA 4XEIC 3RSEC 3A0FA 4FWWA 3U4YA 5TEEA 1GG2B 2AQ5A 2Z2NA 4FHLA 4N14A 4LG8A 5IJ7E 5EMLB 2H13A 3IJ0A 3SMRA 3FM0A 2AGZA 2P9LC 3UVMA 5TDHB 1JOFA 2H6NA 4EWRA 4A08A 4Y7RA 1R5MA 4OZUA 1P22A 3ORVD 5CXBA 5HE2B 4A09B 3F3FA 2B4EA 2HKMA 4BL0A 5HQGA 4J82A 1SHYB 3MMYA 1PBYB 3KRWB 3ULEC 3V7DB 5GXIA 2OVQB 1JJUB 3IJCA 4GQ1A 4D6VA 2XL2A 2PM9B 5CXCA 3SBPA 3FGBA 2OVRB 4L3GD 4A0AA 3UR4A 1ERJA 3V9FA 4E5ZA 2G99A 4ZN4A 2H9NA 5CYKA 4J79A 2H6KA 2IAAA 5K19A 4L3HD 3DM0A 1OLZA 3UVNA 4PNKB 3SVWD 3SWSD 5FQDA 4O3TB 2H9PA 3I7LA 3MZLA 4JT6C 2XU7A 5A2Qg 3IIYA 4A2LA 5SXMA 5TEFA 1S4UX 3JRPA 2HJBA 3HFQA 5H1MA 3SCYA 2I3TA 3BG1A 2J55H 3UVLA 4CI2A 3EI1A 2UZXB 5EAMA 4R7AB 4D0KA 4A0AB 3I2NA 3UVOA 4CI3A 3EI4B 3NVQA 3JROA 3CFSB 3CIKB 2Z2OA 3PVWB 4LGNA 3L4OD 2PBIB 2OK4A 2H9LA 2OIZA 4FA5D 3EI2A 2TRCB 5EM2A 2P9KC 4PSXB 1GOTB 3RFHA 2H9MA 4GQBB 4JSVC 3OW8A 5FKTA 3AL8B 4NSXA 5FKRA 2BBKH 3I7NA 3EMHA 4QL1A 4A7JA 2O9KA 4UI9R 3VA6A 4CY1A 5EMJB 2HXCA 4E5ZB 3EI3A 2Q7QA 3PXSD 3SXTD 1OMWB 3OKTA 3JAMg 3PSCB 4A0BA 5C2WB 5TF2A 1TYQC 3EI3B 5FXYA 1MG2A 4CC9A 4FA1D 3I7KA 4AOWA 3OKYB 3FRXA 5IGOA 5FKQA 1U2VC 2CN3A 4E54A 2CO0A 1NR0A 3UKUC 3MKSB 3RFGA 5HE3B 4J87A 4FA9D 4BUJC 3I8CA 4IMMA 4CY2A 4ZOZA 2PM9A 3CFVA 3W15A 4GGAA 1GXRA 3SHFA 2YBAA 3K27A 2HJ4A 2IWKA 2IURA 3C9CA 4A2MA 2W18A 2H3XA 3PXTD 3JB9L 4U1EI 1XHMA 3RN0D 4AEZA 5EAPA 5GMKn 3PXWD 3SBRA 5IJ8E 4A08B 1K32A 5AMSA 4O3UB 3P4FA 2CE9A 4PSWB 2H6QA 2YNPA 2AGXA 3I7HA 3SN6B 2YMUA 5HYNB 4A09A 2HYEA 2P9SC 3DSMA 2GNQA 3DXMC 1MG3A 4JD2C 3RMZD 2IUPA 4FA4D 2J57G 3E0CA 1SQJA 5H17A 2OK6A 4H5IA 4A11A 5CXCB 4ERQA 1JMZB 2B5NA 4L9OA 3AH8B 3PE7A 1FWXA 4FAND 3EI2B 2CNXA 4ZOVA 4ESGA 5CYKB 1GP2B 3AL8A 3I89A 3NVNA 4O45A 3L4MD 1L0QA 5K1CC 4GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A11 B;  5HE0 B;  4FAV D;  4OWR A;  1N6D A;  1NEX B;  1TBG A;  2I0T A;  4PBZ A;  3F3G A;  5IT9 g;  2QC5 A;  4TZ4 A;  4LG9 A;  3I7P A;  3EI4 A;  3ODT A;  5FKS A;  5IC7 A;  3MKQ A;  3C5M A;  1QNI A;  2H68 A;  2AH1 A;  3F3P A;  2B5L A;  5I5M A;  2H47 A;  3OKY A;  1PGU A;  4I79 A;  5EAR A;  4J84 A;  3RLM D;  3SBQ A;  4FB1 D;  4JXM A;  4H5J A;  3PSL A;  4ES0 A;  1JMX B;  4YVD A;  4ZOY A;  2GC7 A;  2I0R A;  2CN2 A;  2PM6 B;  3PVU B;  2P9N C;  3SLE D;  1U4C A;  4A0B B;  1N6E A;  3EI1 B;  5GSA A;  3OKW A;  2P9I C;  2H14 A;  1K8K C;  2UZY B;  5GXH A;  1A0R B;  5EMM B;  3I8E A;  4CY3 A;  4QQE A;  2G9A A;  5B4W A;  2YNN A;  4GM9 A;  5AJA A;  3JZH A;  4J8G A;  3EG6 A;  3AL9 A;  2GC4 A;  4GMB A;  4CZY A;  4K3J B;  4CZX A;  3I7O A;  5H14 A;  4L1Q D;  3VH0 A;  2J56 H;  3IIW A;  4X63 B;  2XYI A;  1PI6 A;  3JZN A;  4G56 B;  2AGY A;  4QT8 A;  5KDO B;  2CE8 A;  5JWZ A;  4GZ8 A;  3SJL D;  3BWS A;  4JSX C;  5HE1 B;  4HDJ A;  2P9U C;  4CZV A;  5CXB B;  4J0X A;  4IA9 A;  4X61 B;  4JSN C;  4ZOX A;  5IGQ A;  3AFC A;  1RI6 A;  5EM2 B;  3GRE A;  3NVX A;  3MZK A;  5I5I A;  3DXK C;  2Z2P A;  3UVK A;  3ZWL B;  3BG0 A;  4K3I D;  4J78 A;  3C99 A;  1B9Y A;  3IJ1 A;  2P9P C;  4XYH A;  3SFZ A;  4PXW A;  2QXV A;  3OL2 B;  4J81 A;  2OVP B;  3C75 H;  1SQ9 A;  3EWE A;  4CY5 A;  3N0E A;  4J8B A;  4BH6 A;  1XKS A;  4U7A A;  4PC0 A;  2XL3 A;  3EU7 A;  1N6F A;  2IUV A;  5AFU 3;  1MDA H;  5C2V B;  4QRJ A;  4Z8L A;  3JZG A;  2CO0 C;  4ERZ A;  4J73 A;  4E54 B;  2HKR A;  4Y5R D;  4J0W A;  2PM7 B;  4X60 B;  4XYI A;  1PEV A;  3OTT A;  4O1Q D;  4GQ2 P;  2OJY A;  4GGD A;  5I5J A;  2IUQ A;  2AGL A;  3MXX A;  3V5W B;  4J86 A;  3GFC A;  2IWF A;  4JSP C;  3UKR C;  4J77 A;  3B7F A;  2YNO A;  3OL2 A;  3RN1 D;  3VGZ A;  4JT5 C;  3IKO A;  4GM8 A;  4CI1 A;  1B9X A;  3J81 g;  2AH0 A;  1Q47 A;  3N0D A;  5FA5 B;  3KRX B;  2HES X;  3K26 A;  5EAL A;  2EBS A;  4O9D A;  2MTA H;  4GM3 A;  3J80 g;  5C9Z B;  4X3E A;  2BCJ B;  2I0S A;  2B5M A;  4ERY A;  1XIP A;  4CI8 A;  5EMK B;  4MK0 B;  3JPX A;  2AGW A;  1VYH C;  4KFM B;  3RRM C;  1YFQ A;  2YB8 B;  2I3S A;  3DWL C;  5FLX g;  4PBY A;  5THA A;  4XEI C;  3RSE C;  3A0F A;  4FWW A;  3U4Y A;  5TEE A;  1GG2 B;  2AQ5 A;  2Z2N A;  4FHL A;  4N14 A;  4LG8 A;  5IJ7 E;  5EML B;  2H13 A;  3IJ0 A;  3SMR A;  3FM0 A;  2AGZ A;  2P9L C;  3UVM A;  5TDH B;  1JOF A;  2H6N A;  4EWR A;  4A08 A;  4Y7R A;  1R5M A;  4OZU A;  1P22 A;  3ORV D;  5CXB A;  5HE2 B;  4A09 B;  3F3F A;  2B4E A;  2HKM A;  4BL0 A;  5HQG A;  4J82 A;  1SHY B;  3MMY A;  1PBY B;  3KRW B;  3ULE C;  3V7D B;  5GXI A;  2OVQ B;  1JJU B;  3IJC A;  4GQ1 A;  4D6V A;  2XL2 A;  2PM9 B;  5CXC A;  3SBP A;  3FGB A;  2OVR B;  4L3G D;  4A0A A;  3UR4 A;  1ERJ A;  3V9F A;  4E5Z A;  2G99 A;  4ZN4 A;  2H9N A;  5CYK A;  4J79 A;  2H6K A;  2IAA A;  5K19 A;  4L3H D;  3DM0 A;  1OLZ A;  3UVN A;  4PNK B;  3SVW D;  3SWS D;  5FQD A;  4O3T B;  2H9P A;  3I7L A;  3MZL A;  4JT6 C;  2XU7 A;  5A2Q g;  3IIY A;  4A2L A;  5SXM A;  5TEF A;  1S4U X;  3JRP A;  2HJB A;  3HFQ A;  5H1M A;  3SCY A;  2I3T A;  3BG1 A;  2J55 H;  3UVL A;  4CI2 A;  3EI1 A;  2UZX B;  5EAM A;  4R7A B;  4D0K A;  4A0A B;  3I2N A;  3UVO A;  4CI3 A;  3EI4 B;  3NVQ A;  3JRO A;  3CFS B;  3CIK B;  2Z2O A;  3PVW B;  4LGN A;  3L4O D;  2PBI B;  2OK4 A;  2H9L A;  2OIZ A;  4FA5 D;  3EI2 A;  2TRC B;  5EM2 A;  2P9K C;  4PSX B;  1GOT B;  3RFH A;  2H9M A;  4GQB B;  4JSV C;  3OW8 A;  5FKT A;  3AL8 B;  4NSX A;  5FKR A;  2BBK H;  3I7N A;  3EMH A;  4QL1 A;  4A7J A;  2O9K A;  4UI9 R;  3VA6 A;  4CY1 A;  5EMJ B;  2HXC A;  4E5Z B;  3EI3 A;  2Q7Q A;  3PXS D;  3SXT D;  1OMW B;  3OKT A;  3JAM g;  3PSC B;  4A0B A;  5C2W B;  5TF2 A;  1TYQ C;  3EI3 B;  5FXY A;  1MG2 A;  4CC9 A;  4FA1 D;  3I7K A;  4AOW A;  3OKY B;  3FRX A;  5IGO A;  5FKQ A;  1U2V C;  2CN3 A;  4E54 A;  2CO0 A;  1NR0 A;  3UKU C;  3MKS B;  3RFG A;  5HE3 B;  4J87 A;  4FA9 D;  4BUJ C;  3I8C A;  4IMM A;  4CY2 A;  4ZOZ A;  2PM9 A;  3CFV A;  3W15 A;  4GGA A;  1GXR A;  3SHF A;  2YBA A;  3K27 A;  2HJ4 A;  2IWK A;  2IUR A;  3C9C A;  4A2M A;  2W18 A;  2H3X A;  3PXT D;  3JB9 L;  4U1E I;  1XHM A;  3RN0 D;  4AEZ A;  5EAP A;  5GMK n;  3PXW D;  3SBR A;  5IJ8 E;  4A08 B;  1K32 A;  5AMS A;  4O3U B;  3P4F A;  2CE9 A;  4PSW B;  2H6Q A;  2YNP A;  2AGX A;  3I7H A;  3SN6 B;  2YMU A;  5HYN B;  4A09 A;  2HYE A;  2P9S C;  3DSM A;  2GNQ A;  3DXM C;  1MG3 A;  4JD2 C;  3RMZ D;  2IUP A;  4FA4 D;  2J57 G;  3E0C A;  1SQJ A;  5H17 A;  2OK6 A;  4H5I A;  4A11 A;  5CXC B;  4ERQ A;  1JMZ B;  2B5N A;  4L9O A;  3AH8 B;  3PE7 A;  1FWX A;  4FAN D;  3EI2 B;  2CNX A;  4ZOV A;  4ESG A;  5CYK B;  1GP2 B;  3AL8 A;  3I89 A;  3NVN A;  4O45 A;  3L4M D;  1L0Q A;  5K1C C;  4GGC A; 
#chains in the Genus database with same CATH topology
 4A11 B;  5HE0 B;  4FAV D;  4OWR A;  4D9S A;  1N6D A;  1NEX B;  1TBG A;  2I0T A;  3GC3 B;  4PBZ A;  5M5T A;  3F3G A;  5IT9 g;  2QC5 A;  4TZ4 A;  4LG9 A;  3K72 A;  3I7P A;  3EI4 A;  3ODT A;  5FKS A;  5IC7 A;  3MKQ A;  3C5M A;  1UTC A;  1QNI A;  2H68 A;  2AH1 A;  3F3P A;  2B5L A;  5I5M A;  2H47 A;  3OKY A;  1PGU A;  4I79 A;  4UM9 A;  4J84 A;  5EAR A;  5E6S A;  3RLM D;  3SBQ A;  4FB1 D;  1C9L A;  4JXM A;  4H5J A;  3PSL A;  4ES0 A;  1JMX B;  4YVD A;  5HDB A;  4ZOY A;  2GC7 A;  2I0R A;  2CN2 A;  2PM6 B;  3PVU B;  2P9N C;  2QR5 A;  3FCU A;  3SLE D;  1VZ2 A;  1U4C A;  4A0B B;  1N6E A;  1VE6 A;  1E8N A;  3EI1 B;  5GSA A;  3OKW A;  2P9I C;  2H14 A;  1K8K C;  2UZY B;  5GXH A;  3DDU A;  1A0R B;  5EMM B;  2EIB A;  3MVD K;  3I8E A;  4CY3 A;  5M5S A;  4QQE A;  2G9A A;  1E8M A;  1L5G A;  5B4W A;  2YNN A;  4GM9 A;  3ZDY A;  5AJA A;  4NC4 A;  3JZH A;  4J8G A;  3EG6 A;  3AL9 A;  2GC4 A;  4GMB A;  5M61 A;  4CZY A;  4K3J B;  1VE7 A;  4CZX A;  3K6S A;  3I7O A;  3ZDZ A;  3IUN A;  5H14 A;  4L1Q D;  3VH0 A;  2J56 H;  3IIW A;  4X63 B;  2XYI A;  1PI6 A;  3JZN A;  4G56 B;  2AGY A;  1U8C A;  4QT8 A;  5KDO B;  2BKL A;  2CE8 A;  5JWZ A;  4GZ8 A;  3SJL D;  3BWS A;  4JSX C;  4IRZ A;  5HE1 B;  4HDJ A;  2P9U C;  4BCC A;  4CZV A;  5CXB B;  3O4G A;  4WJK A;  4J0X A;  4IA9 A;  4X61 B;  4JSN C;  4ZOX A;  5IGQ A;  5C92 A;  3AFC A;  1RI6 A;  5EM2 B;  3GRE A;  3EQ9 A;  5M5U A;  3NVX A;  3KCI A;  2EID A;  3MZK A;  2JKX A;  5I5I A;  3DXK C;  2Z2P A;  3UVK A;  3NIF A;  3ZWL B;  3BG0 A;  4K3I D;  4G55 A;  4J78 A;  3C99 A;  1B9Y A;  3IJ1 A;  4NEN A;  3ZE0 A;  2P9P C;  4XYH A;  2VC2 A;  3SFZ A;  4AN1 A;  2VDK A;  4PXW A;  2QXV A;  3OL2 B;  4J81 A;  2OVP B;  3C75 H;  1SQ9 A;  3ZDX A;  3EWE A;  4G1E A;  4CY5 A;  3N0E A;  4J8B A;  4BH6 A;  1XKS A;  4U7A A;  4PC0 A;  2XL3 A;  3EU7 A;  1N6F A;  2XZG A;  2IUV A;  3T3P A;  5AFU 3;  1MDA H;  5C2V B;  4QRJ A;  4Z8L A;  3JZG A;  2CO0 C;  4ERZ A;  4J73 A;  4E54 B;  2HKR A;  4O2W A;  4Y5R D;  3QI0 A;  4J0W A;  2PM7 B;  1C9I A;  2VDN A;  4NBM A;  4X60 B;  4XYI A;  1VZ3 A;  3O4I A;  1PEV A;  3OTT A;  4WK2 A;  4DNU A;  4O1Q D;  4GQ2 P;  2OJY A;  4GGD A;  5I5J A;  3MUO A;  4WK4 A;  2IUQ A;  2AGL A;  3MXX A;  3V5W B;  5E6U A;  4J86 A;  4BP8 A;  3GFC A;  2IWF A;  4JSP C;  1QFM A;  3EQ7 A;  3UKR C;  3VI4 A;  4J77 A;  2VDM A;  3B7F A;  2YNO A;  3OL2 A;  3RN1 D;  3VGZ A;  4JT5 C;  3IKO A;  1GOF A;  4GM8 A;  4CI1 A;  1B9X A;  3J81 g;  1UOQ A;  2AH0 A;  1Q47 A;  3N0D A;  5FA5 B;  3KRX B;  2HES X;  1E5T A;  3K26 A;  5EAL A;  2EBS A;  4O9D A;  4Z7O A;  2MTA H;  4GM3 A;  4UM8 A;  3J80 g;  1JTD B;  5C9Z B;  4X3E A;  2BCJ B;  2I0S A;  2B5M A;  4ERY A;  1XIP A;  1H2Y A;  4CI8 A;  5EMK B;  4MK0 B;  1O6F A;  3O4J A;  1UOP A;  3JPX A;  2AGW A;  4BCB A;  1H2X A;  4WK0 A;  1VYH C;  4KFM B;  3RRM C;  1YFQ A;  4AN0 A;  4AMZ A;  1GOG A;  2YB8 B;  2I3S A;  3DWL C;  5FLX g;  4PBY A;  5THA A;  1T2X A;  5E6R A;  4XEI C;  5FFO A;  3RSE C;  4AX4 A;  3A0F A;  4FWW A;  3U4Y A;  5TEE A;  1BPO A;  1GG2 B;  2AQ5 A;  4DNV A;  2Z2N A;  4FHL A;  4N14 A;  4LG8 A;  5IJ7 E;  5EML B;  2H13 A;  3IJ0 A;  3IUJ A;  3SMR A;  3FM0 A;  2AGZ A;  2P9L C;  3NID A;  3FCS A;  3UVM A;  2VZ1 A;  5TDH B;  1JOF A;  2HU8 A;  2H6N A;  2HU5 A;  3O4H A;  4EWR A;  4A08 A;  4Y7R A;  1R5M A;  4OZU A;  1P22 A;  3IUR A;  3ORV D;  5CXB A;  5HE2 B;  5C86 A;  4A09 B;  3F3F A;  2B4E A;  2HKM A;  4BL0 A;  5HQG A;  4J82 A;  1SHY B;  3MMY A;  1PBY B;  1A12 A;  3KRW B;  3ULE C;  3IJE A;  3V7D B;  5GXI A;  2OVQ B;  1JJU B;  3IJC A;  4GQ1 A;  2QZP A;  4D6V A;  2XL2 A;  2PM9 B;  3NIG A;  5CXC A;  3FGB A;  3SBP A;  2OVR B;  4L3G D;  4A0A A;  3UR4 A;  1ERJ A;  3V9F A;  3IVM A;  3K71 A;  4E5Z A;  2G99 A;  4ZN4 A;  4BP9 A;  3ZE1 A;  3GD1 I;  2H9N A;  2WQ8 A;  5CYK A;  4J79 A;  2H6K A;  2IAA A;  4DNW A;  5K19 A;  1H2Z A;  4L3H D;  3DM0 A;  1JV2 A;  1OLZ A;  3UVN A;  4PNK B;  3SVW D;  3SWS D;  5FQD A;  4O3T B;  2H9P A;  3I7L A;  3MZL A;  4JT6 C;  4RE5 A;  2XU7 A;  4BCD A;  5A2Q g;  3IIY A;  1GOH A;  2VDQ A;  2XDW A;  4A2L A;  5SXM A;  5TEF A;  1S4U X;  3JRP A;  2HJB A;  3HFQ A;  5H1M A;  3SCY A;  2I3T A;  4Z7Q A;  3BG1 A;  2J55 H;  3UVL A;  4CI2 A;  3EI1 A;  2UZX B;  5EAM A;  4R7A B;  4D0K A;  4A0A B;  1O6G A;  3I2N A;  3UVO A;  4CI3 A;  3EI4 B;  3NVQ A;  3JRO A;  3CFS B;  3CIK B;  2Z2O A;  3PVW B;  4LGN A;  3L4O D;  2PBI B;  2OK4 A;  2H9L A;  4NAA A;  2EIE A;  3IUQ A;  4RE6 A;  2OIZ A;  2VDO A;  4FA5 D;  3EI2 A;  2TRC B;  5EM2 A;  2P9K C;  4O02 A;  4PSX B;  3EQ8 A;  2EIC A;  2XE4 A;  1GOT B;  3RFH A;  2H9M A;  4GQB B;  4JSV C;  3OW8 A;  5FKT A;  3AL8 B;  1K3I A;  4NSX A;  5FKR A;  3IUM A;  2BBK H;  3I7N A;  3EMH A;  4QL1 A;  4A7J A;  2O9K A;  4UI9 R;  3VA6 A;  4Z7N A;  4CY1 A;  5EMJ B;  2HXC A;  4E5Z B;  3EI3 A;  2Q7Q A;  3PXS D;  5FFG A;  3SXT D;  1OMW B;  3OKT A;  3JAM g;  3PSC B;  3V4V A;  3ZE2 A;  4A0B A;  5C2W B;  5TF2 A;  1TYQ C;  3EI3 B;  5FXY A;  1MG2 A;  4CC9 A;  4FA1 D;  3I7K A;  4AOW A;  3OKY B;  3FRX A;  4AMY A;  5IGO A;  2VDL A;  5FKQ A;  1M1X A;  1U2V C;  2CN3 A;  4E54 A;  2CO0 A;  1NR0 A;  3T3M A;  3UKU C;  4MMZ A;  4G1M A;  3MKS B;  3RFG A;  5HE3 B;  4J87 A;  4FA9 D;  3VI3 A;  1TYE A;  4JHP C;  3I8C A;  4IMM A;  4BUJ C;  4CY2 A;  4MMY A;  4ZOZ A;  2PM9 A;  3CFV A;  3W15 A;  4GGA A;  1GXR A;  3SHF A;  2YBA A;  3K27 A;  2HJ4 A;  2IWK A;  2IUR A;  3C9C A;  3V4P A;  4A2M A;  2W18 A;  2H3X A;  3PXT D;  1YR2 A;  3JB9 L;  4U1E I;  1XHM A;  3QHY B;  3RN0 D;  4AEZ A;  4JHN A;  1H2W A;  5EAP A;  5GMK n;  3PXW D;  3SBR A;  5IJ8 E;  4A08 B;  1K32 A;  5AMS A;  2VDR A;  4O3U B;  4QAM A;  3P4F A;  2CE9 A;  4PSW B;  2H6Q A;  2YNP A;  2AGX A;  3I7H A;  4MMX A;  3SN6 B;  2YMU A;  5HYN B;  4A09 A;  2HYE A;  2P9S C;  3DSM A;  2GNQ A;  3MUN A;  1QFS A;  1I2M B;  3DXM C;  1MG3 A;  3OF7 A;  3IUL A;  4JD2 C;  3RMZ D;  2IUP A;  4FA4 D;  2J57 G;  3E0C A;  1SQJ A;  5H17 A;  1UOO A;  2OK6 A;  4H5I A;  4A11 A;  5CXC B;  4ERQ A;  1JMZ B;  2B5N A;  4L9O A;  3AH8 B;  3PE7 A;  1FWX A;  4FAN D;  3EI2 B;  2CNX A;  2VDP A;  5M5R A;  4L1M A;  4ZOV A;  5CYK B;  4ESG A;  5M5V A;  1GP2 B;  3AL8 A;  3I89 A;  3NVN A;  2HU7 A;  4O45 A;  3L4M D;  1L0Q A;  5K1C C;  4GGC A;  2VZ3 A; 
#chains in the Genus database with same CATH homology
 4A11 B;  5HE0 B;  4FAV D;  4OWR A;  1N6D A;  1NEX B;  1TBG A;  2I0T A;  4PBZ A;  3F3G A;  5IT9 g;  2QC5 A;  4TZ4 A;  4LG9 A;  3I7P A;  3EI4 A;  3ODT A;  5FKS A;  5IC7 A;  3MKQ A;  3C5M A;  1QNI A;  2H68 A;  2AH1 A;  3F3P A;  2B5L A;  5I5M A;  2H47 A;  3OKY A;  1PGU A;  4I79 A;  5EAR A;  4J84 A;  3RLM D;  3SBQ A;  4FB1 D;  4JXM A;  4H5J A;  3PSL A;  4ES0 A;  1JMX B;  4YVD A;  4ZOY A;  2GC7 A;  2I0R A;  2CN2 A;  2PM6 B;  3PVU B;  2P9N C;  3SLE D;  1U4C A;  4A0B B;  1N6E A;  3EI1 B;  5GSA A;  3OKW A;  2P9I C;  2H14 A;  1K8K C;  2UZY B;  5GXH A;  1A0R B;  5EMM B;  3I8E A;  4CY3 A;  4QQE A;  2G9A A;  5B4W A;  2YNN A;  4GM9 A;  5AJA A;  3JZH A;  4J8G A;  3EG6 A;  3AL9 A;  2GC4 A;  4GMB A;  4CZY A;  4K3J B;  4CZX A;  3I7O A;  5H14 A;  4L1Q D;  3VH0 A;  2J56 H;  3IIW A;  4X63 B;  2XYI A;  1PI6 A;  3JZN A;  4G56 B;  2AGY A;  4QT8 A;  5KDO B;  2CE8 A;  5JWZ A;  4GZ8 A;  3SJL D;  3BWS A;  4JSX C;  5HE1 B;  4HDJ A;  2P9U C;  4CZV A;  5CXB B;  4J0X A;  4IA9 A;  4X61 B;  4JSN C;  4ZOX A;  5IGQ A;  3AFC A;  1RI6 A;  5EM2 B;  3GRE A;  3NVX A;  3MZK A;  5I5I A;  3DXK C;  2Z2P A;  3UVK A;  3ZWL B;  3BG0 A;  4K3I D;  4J78 A;  3C99 A;  1B9Y A;  3IJ1 A;  2P9P C;  4XYH A;  3SFZ A;  4PXW A;  2QXV A;  3OL2 B;  4J81 A;  2OVP B;  3C75 H;  1SQ9 A;  3EWE A;  4CY5 A;  3N0E A;  4J8B A;  4BH6 A;  1XKS A;  4U7A A;  4PC0 A;  2XL3 A;  3EU7 A;  1N6F A;  2IUV A;  5AFU 3;  1MDA H;  5C2V B;  4QRJ A;  4Z8L A;  3JZG A;  2CO0 C;  4ERZ A;  4J73 A;  4E54 B;  2HKR A;  4Y5R D;  4J0W A;  2PM7 B;  4X60 B;  4XYI A;  1PEV A;  3OTT A;  4O1Q D;  4GQ2 P;  2OJY A;  4GGD A;  5I5J A;  2IUQ A;  2AGL A;  3MXX A;  3V5W B;  4J86 A;  3GFC A;  2IWF A;  4JSP C;  3UKR C;  4J77 A;  3B7F A;  2YNO A;  3OL2 A;  3RN1 D;  3VGZ A;  4JT5 C;  3IKO A;  4GM8 A;  4CI1 A;  1B9X A;  3J81 g;  2AH0 A;  1Q47 A;  3N0D A;  5FA5 B;  3KRX B;  2HES X;  3K26 A;  5EAL A;  2EBS A;  4O9D A;  2MTA H;  4GM3 A;  3J80 g;  5C9Z B;  4X3E A;  2BCJ B;  2I0S A;  2B5M A;  4ERY A;  1XIP A;  4CI8 A;  5EMK B;  4MK0 B;  3JPX A;  2AGW A;  1VYH C;  4KFM B;  3RRM C;  1YFQ A;  2YB8 B;  2I3S A;  3DWL C;  5FLX g;  4PBY A;  5THA A;  4XEI C;  3RSE C;  3A0F A;  4FWW A;  3U4Y A;  5TEE A;  1GG2 B;  2AQ5 A;  2Z2N A;  4FHL A;  4N14 A;  4LG8 A;  5IJ7 E;  5EML B;  2H13 A;  3IJ0 A;  3SMR A;  3FM0 A;  2AGZ A;  2P9L C;  3UVM A;  5TDH B;  1JOF A;  2H6N A;  4EWR A;  4A08 A;  4Y7R A;  1R5M A;  4OZU A;  1P22 A;  3ORV D;  5CXB A;  5HE2 B;  4A09 B;  3F3F A;  2B4E A;  2HKM A;  4BL0 A;  5HQG A;  4J82 A;  1SHY B;  3MMY A;  1PBY B;  3KRW B;  3ULE C;  3V7D B;  5GXI A;  2OVQ B;  1JJU B;  3IJC A;  4GQ1 A;  4D6V A;  2XL2 A;  2PM9 B;  5CXC A;  3SBP A;  3FGB A;  2OVR B;  4L3G D;  4A0A A;  3UR4 A;  1ERJ A;  3V9F A;  4E5Z A;  2G99 A;  4ZN4 A;  2H9N A;  5CYK A;  4J79 A;  2H6K A;  2IAA A;  5K19 A;  4L3H D;  3DM0 A;  1OLZ A;  3UVN A;  4PNK B;  3SVW D;  3SWS D;  5FQD A;  4O3T B;  2H9P A;  3I7L A;  3MZL A;  4JT6 C;  2XU7 A;  5A2Q g;  3IIY A;  4A2L A;  5SXM A;  5TEF A;  1S4U X;  3JRP A;  2HJB A;  3HFQ A;  5H1M A;  3SCY A;  2I3T A;  3BG1 A;  2J55 H;  3UVL A;  4CI2 A;  3EI1 A;  2UZX B;  5EAM A;  4R7A B;  4D0K A;  4A0A B;  3I2N A;  3UVO A;  4CI3 A;  3EI4 B;  3NVQ A;  3JRO A;  3CFS B;  3CIK B;  2Z2O A;  3PVW B;  4LGN A;  3L4O D;  2PBI B;  2OK4 A;  2H9L A;  2OIZ A;  4FA5 D;  3EI2 A;  2TRC B;  5EM2 A;  2P9K C;  4PSX B;  1GOT B;  3RFH A;  2H9M A;  4GQB B;  4JSV C;  3OW8 A;  5FKT A;  3AL8 B;  4NSX A;  5FKR A;  2BBK H;  3I7N A;  3EMH A;  4QL1 A;  4A7J A;  2O9K A;  4UI9 R;  3VA6 A;  4CY1 A;  5EMJ B;  2HXC A;  4E5Z B;  3EI3 A;  2Q7Q A;  3PXS D;  3SXT D;  1OMW B;  3OKT A;  3JAM g;  3PSC B;  4A0B A;  5C2W B;  5TF2 A;  1TYQ C;  3EI3 B;  5FXY A;  1MG2 A;  4CC9 A;  4FA1 D;  3I7K A;  4AOW A;  3OKY B;  3FRX A;  5IGO A;  5FKQ A;  1U2V C;  2CN3 A;  4E54 A;  2CO0 A;  1NR0 A;  3UKU C;  3MKS B;  3RFG A;  5HE3 B;  4J87 A;  4FA9 D;  4BUJ C;  3I8C A;  4IMM A;  4CY2 A;  4ZOZ A;  2PM9 A;  3CFV A;  3W15 A;  4GGA A;  1GXR A;  3SHF A;  2YBA A;  3K27 A;  2HJ4 A;  2IWK A;  2IUR A;  3C9C A;  4A2M A;  2W18 A;  2H3X A;  3PXT D;  3JB9 L;  4U1E I;  1XHM A;  3RN0 D;  4AEZ A;  5EAP A;  5GMK n;  3PXW D;  3SBR A;  5IJ8 E;  4A08 B;  1K32 A;  5AMS A;  4O3U B;  3P4F A;  2CE9 A;  4PSW B;  2H6Q A;  2YNP A;  2AGX A;  3I7H A;  3SN6 B;  2YMU A;  5HYN B;  4A09 A;  2HYE A;  2P9S C;  3DSM A;  2GNQ A;  3DXM C;  1MG3 A;  4JD2 C;  3RMZ D;  2IUP A;  4FA4 D;  2J57 G;  3E0C A;  1SQJ A;  5H17 A;  2OK6 A;  4H5I A;  4A11 A;  5CXC B;  4ERQ A;  1JMZ B;  2B5N A;  4L9O A;  3AH8 B;  3PE7 A;  1FWX A;  4FAN D;  3EI2 B;  2CNX A;  4ZOV A;  4ESG A;  5CYK B;  1GP2 B;  3AL8 A;  3I89 A;  3NVN A;  4O45 A;  3L4M D;  1L0Q A;  5K1C C;  4GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...