4CZVA

Structure of the neurospora crassa pan2 wd40 domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
324
structure length
324
Chain Sequence
PHMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
total genus 76
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czvA00
3AFCA 3IJCA 4ZOXA 2PM9A 3UKRC 4KFMB 5C2WB 1XIPA 4J82A 3GFCA 2IWKA 4O45A 3SLED 2H6KA 2OVQB 5EAMA 3C5MA 5TEFA 2YNOA 2XYIA 1U2VC 4PXWA 4XEIC 4GGDA 3OKWA 4A7JA 3JPXA 3SVWD 1XKSA 5C2VB 3C9CA 3I8CA 3ORVD 4ERYA 3I2NA 4D0KA 4U1EI 2AGXA 4ES0A 1FWXA 2H13A 1B9YA 2PM7B 3ULEC 3V9FA 2OIZA 3RFHA 3SFZA 3PVUB 3UVLA 2AGWA 3MXXA 5HQGA 1A0RB 1NEXB 2B5LA 4QRJA 2IUVA 4A11A 4E54A 3MKQA 4J84A 4A2LA 3RN0D 3DM0A 5C9ZB 4PBYA 5EARA 3CFVA 3V7DB 4GMBA 3UVMA 4FA1D 3IJ1A 3FGBA 4GQ2P 4ERQA 3JZHA 3AL9A 4GM3A 1VYHC 3EI3B 3OL2B 5FQDA 1YFQA 3AL8A 2G99A 1SQJA 4FHLA 4J86A 3FRXA 2QXVA 5EMJB 4AOWA 4X3EA 3SXTD 3N0EA 4A09A 3I89A 4XYHA 5IJ8E 3JAMg 4A0BB 2I3TA 3EI1B 4X60B 2P9LC 3K26A 5CXBB 1JMZB 4J8GA 4XYIA 2CN2A 1PEVA 2YB8B 1P22A 4JD2C 5EALA 4J79A 4Y7RA 3SBPA 1K8KC 2B5NA 5H14A 3PE7A 3JZNA 4GGCA 3DXMC 3KRWB 4J81A 3BG0A 5IGOA 4D6VA 2CO0A 2OVPB 2XU7A 4GQBB 1OMWB 2Q7QA 4BUJC 4O9DA 2IWFA 4O3TB 5KDOB 3VGZA 3DXKC 2P9NC 5CXCB 4L9OA 2IUQA 3SBRA 3NVNA 5SXMA 5JWZA 3P4FA 1RI6A 3UKUC 1JOFA 3JROA 2BCJB 3KRXB 2CO0C 2J55H 3OKTA 3GREA 3F3FA 5HE0B 1PGUA 4IA9A 3SCYA 5GMKn 4FAVD 1SHYB 1NR0A 3EI3A 3OL2A 4O1QD 2AH0A 1B9XA 3EU7A 4BL0A 3OW8A 2UZXB 3BWSA 4PSXB 4QL1A 4JSPC 4JSXC 5EMMB 4A0AB 2AGYA 2IUPA 2YMUA 4L3HD 5GXHA 4A0BA 4FA5D 3OTTA 3EI1A 3EMHA 5FXYA 4IMMA 5CXBA 5FA5B 2H68A 1GG2B 5EM2B 4BH6A 5HE2B 1PBYB 4NSXA 4ZOVA 2Z2OA 2YBAA 5I5IA 5K19A 2GC7A 4PC0A 5THAA 4AEZA 4CZVA 4LG8A 4G56B 3V5WB 2HJ4A 3OKYB 1SQ9A 5HE1B 3NVQA 4CI3A 5FKTA 3E0CA 4A2MA 3I7NA 2IAAA 2W18A 2J57G 3SBQA 3W15A 5HYNB 5A2Qg 3RN1D 4FWWA 4GM9A 4PNKB 4Y5RD 2UZYB 2HKMA 5CXCA 4GGAA 2H9LA 5TDHB 5K1CC 3NVXA 3SHFA 2TRCB 4OWRA 5CYKB 4J73A 2AQ5A 2HKRA 5H17A 1N6EA 5EAPA 1Q47A 1S4UX 2O9KA 4ESGA 3RLMD 3RSEC 4ZN4A 3I8EA 4E5ZB 5IJ7E 4J0XA 1L0QA 4H5IA 5B4WA 3MZLA 3B7FA 3UVNA 1MG3A 2XL2A 4I79A 3C99A 3EI4B 1MG2A 1GOTB 4GZ8A 3JZGA 4FAND 3I7LA 5IT9g 2BBKH 1XHMA 3N0DA 3A0FA 1QNIA 2H9MA 3PXTD 4H5JA 3HFQA 2OVRB 4A0AA 3AH8B 4ERZA 5EMKB 2OJYA 4YVDA 5GSAA 2PM6B 5EM2A 3MZKA 4CY3A 3MMYA 2EBSA 3EG6A 4J87A 3MKSB 4X61B 2P9KC 2H3XA 4GM8A 4JT6C 4LGNA 4EWRA 4QQEA 3CFSB 4A08B 3OKYA 3J80g 3RRMC 5AJAA 2HXCA 4QT8A 5EMLB 4LG9A 3IIYA 2GC4A 2J56H 1MDAH 3L4OD 5AFU3 4FB1D 4O3UB 2I3SA 2P9UC 3ODTA 4HDJA 2AGZA 1U4CA 2B4EA 3PXSD 2P9SC 2AH1A 5CYKA 4CI8A 2H6NA 3K27A 3U4YA 1TYQC 3I7PA 3I7KA 2H47A 4CC9A 4L3GD 3J81g 2GNQA 4JT5C 2B5MA 1ERJA 2CE8A 3IJ0A 5IC7A 4E5ZA 2YNNA 4U7AA 5H1MA 2OK6A 2I0RA 3EI2A 3EI4A 1R5MA 2XL3A 4OZUA 4J8BA 2IURA 4PBZA 2HYEA 1PI6A 4CZYA 3DSMA 5HE3B 4CI1A 4CY5A 2PM9B 3RFGA 2H9PA 4J0WA 3SMRA 2OK4A 4J78A 3JB9L 2H14A 2G9AA 4Z8LA 3F3GA 2Z2PA 3I7OA 4FA9D 4CY2A 3SN6B 1OLZA 4L1QD 1N6DA 3JRPA 2CN3A 3BG1A 5GXIA 4X63B 1GP2B 2HESX 2CE9A 5FKQA 2H9NA 3PXWD 4J77A 5TF2A 5IGQA 4MK0B 4A08A 3PSCB 4PSWB 2H6QA 2P9IC 2P9PC 4R7AB 4GQ1A 3EI2B 3EWEA 2CNXA 5TEEA 3F3PA 5I5MA 2AGLA 2QC5A 2Z2NA 3IKOA 2PBIB 5FKRA 4CY1A 1TBGA 3CIKB 3UVKA 4ZOYA 2HJBA 4A11B 3SJLD 5AMSA 4E54B 3PSLA 1JMXB 4K3JB 4UI9R 4FA4D 3L4MD 3SWSD 4ZOZA 4TZ4A 1N6FA 1GXRA 3UR4A 2MTAH 2I0SA 4JXMA 3I7HA 3IIWA 4JSVC 3C75H 4JSNC 2YNPA 3AL8B 3VA6A 3ZWLB 5FLXg 3RMZD 1K32A 4A09B 3PVWB 2I0TA 3FM0A 3DWLC 3VH0A 5FKSA 3UVOA 5I5JA 4K3ID 1JJUB 4CI2A 4CZXA 4N14A
chains in the Genus database with same CATH superfamily
3AFCA 2EIDA 3IJCA 4ZOXA 2PM9A 3UKRC 4KFMB 5C2WB 1XIPA 4J82A 3GFCA 2IWKA 4O45A 3SLED 2H6KA 2BKLA 3DDUA 3O4HA 2OVQB 5EAMA 3C5MA 5TEFA 2YNOA 1UTCA 2XYIA 1YR2A 1U2VC 4G1MA 4PXWA 2VZ3A 4RE5A 4XEIC 4GGDA 3OKWA 4A7JA 3JPXA 3SVWD 3EQ9A 1H2YA 1XKSA 5C2VB 3C9CA 3I8CA 3ORVD 4ERYA 1UOPA 3I2NA 4D0KA 4U1EI 2AGXA 4ES0A 1FWXA 2H13A 1B9YA 2PM7B 3ULEC 3V9FA 2OIZA 3RFHA 3SFZA 3PVUB 3UVLA 2AGWA 3MXXA 3O4IA 4MMYA 3IUNA 5HQGA 1M1XA 1A0RB 1NEXB 4BP9A 2B5LA 4QRJA 2IUVA 4A11A 4E54A 3MKQA 4J84A 4A2LA 3RN0D 3DM0A 5C9ZB 4PBYA 5EARA 3CFVA 3V7DB 4GMBA 3UVMA 4FA1D 3VI3A 3IJ1A 3FGBA 1O6GA 4GQ2P 4ERQA 1VE6A 3JZHA 4NENA 3AL9A 4GM3A 1VYHC 3EI3B 3OL2B 5FQDA 1YFQA 3AL8A 3IJEA 2G99A 1SQJA 4FHLA 4J86A 3FRXA 2QXVA 3FCSA 5EMJB 4AOWA 4X3EA 3SXTD 4A09A 3I89A 4XYHA 5IJ8E 3ZE0A 3JAMg 4A0BB 2I3TA 4BCBA 3ZDZA 3EI1B 4X60B 2P9LC 3K26A 1JTDB 5CXBB 1JMZB 4J8GA 4XYIA 5M5VA 2CN2A 1PEVA 3MUNA 2YB8B 1P22A 1E5TA 2EIBA 4JD2C 5EALA 4J79A 4Y7RA 1VZ2A 2HU8A 3SBPA 1K8KC 2B5NA 5H14A 3PE7A 3JZNA 4GGCA 3DXMC 5FFGA 3KRWB 3NIGA 3NIDA 4J81A 3BG0A 5IGOA 4D6VA 2CO0A 2OVPB 2XU7A 4GQBB 1OMWB 2Q7QA 4BUJC 4O9DA 2IWFA 4O3TB 5KDOB 4JHPC 3QI0A 3VGZA 1U8CA 3DXKC 2P9NC 3K6SA 5CXCB 4L9OA 2EIEA 5E6UA 2IUQA 3SBRA 1C9IA 3NVNA 5SXMA 5JWZA 3P4FA 1RI6A 1GOFA 3UKUC 1JOFA 3JROA 3GD1I 4NAAA 2BCJB 3KRXB 2CO0C 2J55H 3O4GA 3OKTA 3GREA 3F3FA 3T3MA 5HE0B 1PGUA 4IA9A 4UM9A 3SCYA 5GMKn 4FAVD 1SHYB 1NR0A 4BCDA 3EI3A 3OF7A 3OL2A 4AMZA 4L1MA 4O1QD 1L5GA 3EQ8A 1B9XA 2AH0A 3EU7A 4BL0A 3OW8A 2UZXB 3BWSA 1O6FA 4PSXB 4QAMA 4QL1A 4DNVA 4Z7NA 4JSPC 4JSXC 4Z7QA 5EMMB 4A0AB 2VDMA 2AGYA 4D9SA 2IUPA 2YMUA 4L3HD 5GXHA 4A0BA 4FA5D 3OTTA 3EI1A 3EMHA 5FXYA 4IMMA 5CXBA 5FA5B 2H68A 1GG2B 5EM2B 4BH6A 2VDQA 5HE2B 4AX4A 1PBYB 4UM8A 4NSXA 2VDRA 4ZOVA 2Z2OA 2YBAA 5I5IA 5K19A 2GC7A 4PC0A 3ZE2A 4WK4A 1H2ZA 5THAA 4AEZA 4CZVA 4LG8A 2EICA 4G56B 1QFSA 2HJ4A 3V5WB 3OKYB 1SQ9A 5HE1B 3NVQA 4CI3A 5FKTA 3E0CA 4A2MA 3I7NA 3MUOA 2HU7A 2IAAA 3FCUA 2W18A 2J57G 4JHNA 3SBQA 3W15A 5HYNB 5A2Qg 3RN1D 4NBMA 4FWWA 4GM9A 4PNKB 4Y5RD 2UZYB 2HKMA 5M61A 5CXCA 4DNUA 4GGAA 2H9LA 1H2XA 5TDHB 5K1CC 3NVXA 3SHFA 5M5TA 2TRCB 3EQ7A 4OWRA 5CYKB 4J73A 2AQ5A 2HKRA 1VE7A 5H17A 1N6EA 5EAPA 1Q47A 1S4UX 2O9KA 4ESGA 3RLMD 3RSEC 2WQ8A 4ZN4A 3I8EA 4E5ZB 5IJ7E 4J0XA 1L0QA 4WK0A 4H5IA 5B4WA 3IVMA 3MZLA 3T3PA 3B7FA 4WK2A 3UVNA 1MG3A 5C92A 2VZ1A 2XL2A 4I79A 3C99A 2VC2A 3EI4B 1MG2A 1GOTB 4GZ8A 3JZGA 4FAND 3I7LA 5IT9g 1UOQA 1H2WA 2BBKH 1XHMA 3N0DA 3A0FA 1QNIA 2H9MA 3PXTD 4H5JA 3HFQA 2OVRB 4A0AA 3AH8B 4ERZA 5EMKB 2OJYA 4YVDA 5GSAA 1GOGA 2PM6B 3IURA 5EM2A 3MZKA 4CY3A 3MMYA 2EBSA 4MMXA 3EG6A 4J87A 5E6SA 3MKSB 4X61B 2P9KC 3GC3B 4AMYA 1I2MB 2H3XA 4GM8A 4JT6C 4LGNA 4Z7OA 4EWRA 4QQEA 3CFSB 3IUQA 3V4PA 4A08B 4BCCA 3OKYA 3J80g 3RRMC 5AJAA 2HXCA 4QT8A 5M5SA 5EMLB 4LG9A 3IIYA 2GC4A 2J56H 1MDAH 3NIFA 3L4OD 5AFU3 4FB1D 4O3UB 2I3SA 4G1EA 2P9UC 3ODTA 5M5UA 4HDJA 2AGZA 1U4CA 2B4EA 3PXSD 2P9SC 2AH1A 4IRZA 5CYKA 4CI8A 3K71A 2H6NA 1JV2A 3K27A 3U4YA 1TYQC 3I7PA 3I7KA 2H47A 1BPOA 2VDPA 4L3GD 4CC9A 3J81g 1VZ3A 2GNQA 4JT5C 2B5MA 1ERJA 2CE8A 3IJ0A 2XDWA 1A12A 5IC7A 4E5ZA 3IULA 4WJKA 2YNNA 4U7AA 5H1MA 2OK6A 2I0RA 1UOOA 3EI2A 3EI4A 1R5MA 3QHYB 2XL3A 4OZUA 4J8BA 2IURA 4PBZA 3ZDXA 2XE4A 2HYEA 1PI6A 4CZYA 3DSMA 5HE3B 4CI1A 4CY5A 2PM9B 3IUJA 3RFGA 2H9PA 4J0WA 2JKXA 3SMRA 2OK4A 4O02A 4G55A 4J78A 5M5RA 1TYEA 2H14A 3JB9L 2G9AA 4Z8LA 3F3GA 3VI4A 2Z2PA 3I7OA 4FA9D 4CY2A 3SN6B 1OLZA 4L1QD 3JRPA 1N6DA 2VDKA 2VDOA 2XZGA 2CN3A 3BG1A 1E8MA 5GXIA 4X63B 1GP2B 2HESX 2CE9A 5FKQA 2H9NA 3KCIA 4NC4A 3IUMA 3PXWD 4J77A 4MMZA 4AN0A 5C86A 5FFOA 5TF2A 5IGQA 4MK0B 4A08A 3MVDK 3PSCB 4PSWB 2QR5A 2H6QA 2P9IC 3V4VA 2P9PC 1K3IA 4R7AB 4GQ1A 3EI2B 3EWEA 2CNXA 4O2WA 5TEEA 3F3PA 3O4JA 1C9LA 5I5MA 2AGLA 2QC5A 2Z2NA 1GOHA 3IKOA 2PBIB 5FKRA 4CY1A 1TBGA 3CIKB 3UVKA 4ZOYA 3ZDYA 4DNWA 2HJBA 2VDNA 4A11B 3SJLD 5AMSA 4E54B 3PSLA 1JMXB 4K3JB 4UI9R 4FA4D 3L4MD 2QZPA 2VDLA 3SWSD 3K72A 4ZOZA 4TZ4A 1N6FA 1GXRA 3UR4A 2MTAH 2I0SA 4JXMA 3I7HA 3ZE1A 3IIWA 4JSVC 1QFMA 3C75H 4JSNC 2YNPA 4N14A 3AL8B 1E8NA 3VA6A 3ZWLB 4AN1A 5FLXg 5E6RA 3RMZD 1K32A 4A09B 3PVWB 2I0TA 2HU5A 3FM0A 3DWLC 3VH0A 5FKSA 3UVOA 1T2XA 4BP8A 5HDBA 4RE6A 5I5JA 4K3ID 1JJUB 4CI2A 4CZXA 3N0EA
chains in the Genus database with same CATH topology
3AFCA 3IJCA 4ZOXA 2PM9A 3UKRC 4KFMB 5C2WB 1XIPA 4J82A 3GFCA 2IWKA 4O45A 3SLED 2H6KA 2OVQB 5EAMA 3C5MA 5TEFA 2YNOA 2XYIA 1U2VC 4PXWA 4XEIC 4GGDA 3OKWA 4A7JA 3JPXA 3SVWD 1XKSA 5C2VB 3C9CA 3I8CA 3ORVD 4ERYA 3I2NA 4D0KA 4U1EI 2AGXA 4ES0A 1FWXA 2H13A 1B9YA 2PM7B 3ULEC 3V9FA 2OIZA 3RFHA 3SFZA 3PVUB 3UVLA 2AGWA 3MXXA 5HQGA 1A0RB 1NEXB 2B5LA 4QRJA 2IUVA 4A11A 4E54A 3MKQA 4J84A 4A2LA 3RN0D 3DM0A 5C9ZB 4PBYA 5EARA 3CFVA 3V7DB 4GMBA 3UVMA 4FA1D 3IJ1A 3FGBA 4GQ2P 4ERQA 3JZHA 3AL9A 4GM3A 1VYHC 3EI3B 3OL2B 5FQDA 1YFQA 3AL8A 2G99A 1SQJA 4FHLA 4J86A 3FRXA 2QXVA 5EMJB 4AOWA 4X3EA 3SXTD 3N0EA 4A09A 3I89A 4XYHA 5IJ8E 3JAMg 4A0BB 2I3TA 3EI1B 4X60B 2P9LC 3K26A 5CXBB 1JMZB 4J8GA 4XYIA 2CN2A 1PEVA 2YB8B 1P22A 4JD2C 5EALA 4J79A 4Y7RA 3SBPA 1K8KC 2B5NA 5H14A 3PE7A 3JZNA 4GGCA 3DXMC 3KRWB 4J81A 3BG0A 5IGOA 4D6VA 2CO0A 2OVPB 2XU7A 4GQBB 1OMWB 2Q7QA 4BUJC 4O9DA 2IWFA 4O3TB 5KDOB 3VGZA 3DXKC 2P9NC 5CXCB 4L9OA 2IUQA 3SBRA 3NVNA 5SXMA 5JWZA 3P4FA 1RI6A 3UKUC 1JOFA 3JROA 2BCJB 3KRXB 2CO0C 2J55H 3OKTA 3GREA 3F3FA 5HE0B 1PGUA 4IA9A 3SCYA 5GMKn 4FAVD 1SHYB 1NR0A 3EI3A 3OL2A 4O1QD 2AH0A 1B9XA 3EU7A 4BL0A 3OW8A 2UZXB 3BWSA 4PSXB 4QL1A 4JSPC 4JSXC 5EMMB 4A0AB 2AGYA 2IUPA 2YMUA 4L3HD 5GXHA 4A0BA 4FA5D 3OTTA 3EI1A 3EMHA 5FXYA 4IMMA 5CXBA 5FA5B 2H68A 1GG2B 5EM2B 4BH6A 5HE2B 1PBYB 4NSXA 4ZOVA 2Z2OA 2YBAA 5I5IA 5K19A 2GC7A 4PC0A 5THAA 4AEZA 4CZVA 4LG8A 4G56B 3V5WB 2HJ4A 3OKYB 1SQ9A 5HE1B 3NVQA 4CI3A 5FKTA 3E0CA 4A2MA 3I7NA 2IAAA 2W18A 2J57G 3SBQA 3W15A 5HYNB 5A2Qg 3RN1D 4FWWA 4GM9A 4PNKB 4Y5RD 2UZYB 2HKMA 5CXCA 4GGAA 2H9LA 5TDHB 5K1CC 3NVXA 3SHFA 2TRCB 4OWRA 5CYKB 4J73A 2AQ5A 2HKRA 5H17A 1N6EA 5EAPA 1Q47A 1S4UX 2O9KA 4ESGA 3RLMD 3RSEC 4ZN4A 3I8EA 4E5ZB 5IJ7E 4J0XA 1L0QA 4H5IA 5B4WA 3MZLA 3B7FA 3UVNA 1MG3A 2XL2A 4I79A 3C99A 3EI4B 1MG2A 1GOTB 4GZ8A 3JZGA 4FAND 3I7LA 5IT9g 2BBKH 1XHMA 3N0DA 3A0FA 1QNIA 2H9MA 3PXTD 4H5JA 3HFQA 2OVRB 4A0AA 3AH8B 4ERZA 5EMKB 2OJYA 4YVDA 5GSAA 2PM6B 5EM2A 3MZKA 4CY3A 3MMYA 2EBSA 3EG6A 4J87A 3MKSB 4X61B 2P9KC 2H3XA 4GM8A 4JT6C 4LGNA 4EWRA 4QQEA 3CFSB 4A08B 3OKYA 3J80g 3RRMC 5AJAA 2HXCA 4QT8A 5EMLB 4LG9A 3IIYA 2GC4A 2J56H 1MDAH 3L4OD 5AFU3 4FB1D 4O3UB 2I3SA 2P9UC 3ODTA 4HDJA 2AGZA 1U4CA 2B4EA 3PXSD 2P9SC 2AH1A 5CYKA 4CI8A 2H6NA 3K27A 3U4YA 1TYQC 3I7PA 3I7KA 2H47A 4CC9A 4L3GD 3J81g 2GNQA 4JT5C 2B5MA 1ERJA 2CE8A 3IJ0A 5IC7A 4E5ZA 2YNNA 4U7AA 5H1MA 2OK6A 2I0RA 3EI2A 3EI4A 1R5MA 2XL3A 4OZUA 4J8BA 2IURA 4PBZA 2HYEA 1PI6A 4CZYA 3DSMA 5HE3B 4CI1A 4CY5A 2PM9B 3RFGA 2H9PA 4J0WA 3SMRA 2OK4A 4J78A 3JB9L 2H14A 2G9AA 4Z8LA 3F3GA 2Z2PA 3I7OA 4FA9D 4CY2A 3SN6B 1OLZA 4L1QD 1N6DA 3JRPA 2CN3A 3BG1A 5GXIA 4X63B 1GP2B 2HESX 2CE9A 5FKQA 2H9NA 3PXWD 4J77A 5TF2A 5IGQA 4MK0B 4A08A 3PSCB 4PSWB 2H6QA 2P9IC 2P9PC 4R7AB 4GQ1A 3EI2B 3EWEA 2CNXA 5TEEA 3F3PA 5I5MA 2AGLA 2QC5A 2Z2NA 3IKOA 2PBIB 5FKRA 4CY1A 1TBGA 3CIKB 3UVKA 4ZOYA 2HJBA 4A11B 3SJLD 5AMSA 4E54B 3PSLA 1JMXB 4K3JB 4UI9R 4FA4D 3L4MD 3SWSD 4ZOZA 4TZ4A 1N6FA 1GXRA 3UR4A 2MTAH 2I0SA 4JXMA 3I7HA 3IIWA 4JSVC 3C75H 4JSNC 2YNPA 3AL8B 3VA6A 3ZWLB 5FLXg 3RMZD 1K32A 4A09B 3PVWB 2I0TA 3FM0A 3DWLC 3VH0A 5FKSA 3UVOA 5I5JA 4K3ID 1JJUB 4CI2A 4CZXA 4N14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFC A;  3IJC A;  4ZOX A;  2PM9 A;  3UKR C;  4KFM B;  5C2W B;  1XIP A;  4J82 A;  3GFC A;  2IWK A;  4O45 A;  3SLE D;  2H6K A;  2OVQ B;  5EAM A;  3C5M A;  5TEF A;  2YNO A;  2XYI A;  1U2V C;  4PXW A;  4XEI C;  4GGD A;  3OKW A;  4A7J A;  3JPX A;  3SVW D;  1XKS A;  5C2V B;  3C9C A;  3I8C A;  3ORV D;  4ERY A;  3I2N A;  4D0K A;  4U1E I;  2AGX A;  4ES0 A;  1FWX A;  2H13 A;  1B9Y A;  2PM7 B;  3ULE C;  3V9F A;  2OIZ A;  3RFH A;  3SFZ A;  3PVU B;  3UVL A;  2AGW A;  3MXX A;  5HQG A;  1A0R B;  1NEX B;  2B5L A;  4QRJ A;  2IUV A;  4A11 A;  4E54 A;  3MKQ A;  4J84 A;  4A2L A;  3RN0 D;  3DM0 A;  5C9Z B;  4PBY A;  5EAR A;  3CFV A;  3V7D B;  4GMB A;  3UVM A;  4FA1 D;  3IJ1 A;  3FGB A;  4GQ2 P;  4ERQ A;  3JZH A;  3AL9 A;  4GM3 A;  1VYH C;  3EI3 B;  3OL2 B;  5FQD A;  1YFQ A;  3AL8 A;  2G99 A;  1SQJ A;  4FHL A;  4J86 A;  3FRX A;  2QXV A;  5EMJ B;  4AOW A;  4X3E A;  3SXT D;  3N0E A;  4A09 A;  3I89 A;  4XYH A;  5IJ8 E;  3JAM g;  4A0B B;  2I3T A;  3EI1 B;  4X60 B;  2P9L C;  3K26 A;  5CXB B;  1JMZ B;  4J8G A;  4XYI A;  2CN2 A;  1PEV A;  2YB8 B;  1P22 A;  4JD2 C;  5EAL A;  4J79 A;  4Y7R A;  3SBP A;  1K8K C;  2B5N A;  5H14 A;  3PE7 A;  3JZN A;  4GGC A;  3DXM C;  3KRW B;  4J81 A;  3BG0 A;  5IGO A;  4D6V A;  2CO0 A;  2OVP B;  2XU7 A;  4GQB B;  1OMW B;  2Q7Q A;  4BUJ C;  4O9D A;  2IWF A;  4O3T B;  5KDO B;  3VGZ A;  3DXK C;  2P9N C;  5CXC B;  4L9O A;  2IUQ A;  3SBR A;  3NVN A;  5SXM A;  5JWZ A;  3P4F A;  1RI6 A;  3UKU C;  1JOF A;  3JRO A;  2BCJ B;  3KRX B;  2CO0 C;  2J55 H;  3OKT A;  3GRE A;  3F3F A;  5HE0 B;  1PGU A;  4IA9 A;  3SCY A;  5GMK n;  4FAV D;  1SHY B;  1NR0 A;  3EI3 A;  3OL2 A;  4O1Q D;  2AH0 A;  1B9X A;  3EU7 A;  4BL0 A;  3OW8 A;  2UZX B;  3BWS A;  4PSX B;  4QL1 A;  4JSP C;  4JSX C;  5EMM B;  4A0A B;  2AGY A;  2IUP A;  2YMU A;  4L3H D;  5GXH A;  4A0B A;  4FA5 D;  3OTT A;  3EI1 A;  3EMH A;  5FXY A;  4IMM A;  5CXB A;  5FA5 B;  2H68 A;  1GG2 B;  5EM2 B;  4BH6 A;  5HE2 B;  1PBY B;  4NSX A;  4ZOV A;  2Z2O A;  2YBA A;  5I5I A;  5K19 A;  2GC7 A;  4PC0 A;  5THA A;  4AEZ A;  4CZV A;  4LG8 A;  4G56 B;  3V5W B;  2HJ4 A;  3OKY B;  1SQ9 A;  5HE1 B;  3NVQ A;  4CI3 A;  5FKT A;  3E0C A;  4A2M A;  3I7N A;  2IAA A;  2W18 A;  2J57 G;  3SBQ A;  3W15 A;  5HYN B;  5A2Q g;  3RN1 D;  4FWW A;  4GM9 A;  4PNK B;  4Y5R D;  2UZY B;  2HKM A;  5CXC A;  4GGA A;  2H9L A;  5TDH B;  5K1C C;  3NVX A;  3SHF A;  2TRC B;  4OWR A;  5CYK B;  4J73 A;  2AQ5 A;  2HKR A;  5H17 A;  1N6E A;  5EAP A;  1Q47 A;  1S4U X;  2O9K A;  4ESG A;  3RLM D;  3RSE C;  4ZN4 A;  3I8E A;  4E5Z B;  5IJ7 E;  4J0X A;  1L0Q A;  4H5I A;  5B4W A;  3MZL A;  3B7F A;  3UVN A;  1MG3 A;  2XL2 A;  4I79 A;  3C99 A;  3EI4 B;  1MG2 A;  1GOT B;  4GZ8 A;  3JZG A;  4FAN D;  3I7L A;  5IT9 g;  2BBK H;  1XHM A;  3N0D A;  3A0F A;  1QNI A;  2H9M A;  3PXT D;  4H5J A;  3HFQ A;  2OVR B;  4A0A A;  3AH8 B;  4ERZ A;  5EMK B;  2OJY A;  4YVD A;  5GSA A;  2PM6 B;  5EM2 A;  3MZK A;  4CY3 A;  3MMY A;  2EBS A;  3EG6 A;  4J87 A;  3MKS B;  4X61 B;  2P9K C;  2H3X A;  4GM8 A;  4JT6 C;  4LGN A;  4EWR A;  4QQE A;  3CFS B;  4A08 B;  3OKY A;  3J80 g;  3RRM C;  5AJA A;  2HXC A;  4QT8 A;  5EML B;  4LG9 A;  3IIY A;  2GC4 A;  2J56 H;  1MDA H;  3L4O D;  5AFU 3;  4FB1 D;  4O3U B;  2I3S A;  2P9U C;  3ODT A;  4HDJ A;  2AGZ A;  1U4C A;  2B4E A;  3PXS D;  2P9S C;  2AH1 A;  5CYK A;  4CI8 A;  2H6N A;  3K27 A;  3U4Y A;  1TYQ C;  3I7P A;  3I7K A;  2H47 A;  4CC9 A;  4L3G D;  3J81 g;  2GNQ A;  4JT5 C;  2B5M A;  1ERJ A;  2CE8 A;  3IJ0 A;  5IC7 A;  4E5Z A;  2YNN A;  4U7A A;  5H1M A;  2OK6 A;  2I0R A;  3EI2 A;  3EI4 A;  1R5M A;  2XL3 A;  4OZU A;  4J8B A;  2IUR A;  4PBZ A;  2HYE A;  1PI6 A;  4CZY A;  3DSM A;  5HE3 B;  4CI1 A;  4CY5 A;  2PM9 B;  3RFG A;  2H9P A;  4J0W A;  3SMR A;  2OK4 A;  4J78 A;  3JB9 L;  2H14 A;  2G9A A;  4Z8L A;  3F3G A;  2Z2P A;  3I7O A;  4FA9 D;  4CY2 A;  3SN6 B;  1OLZ A;  4L1Q D;  1N6D A;  3JRP A;  2CN3 A;  3BG1 A;  5GXI A;  4X63 B;  1GP2 B;  2HES X;  2CE9 A;  5FKQ A;  2H9N A;  3PXW D;  4J77 A;  5TF2 A;  5IGQ A;  4MK0 B;  4A08 A;  3PSC B;  4PSW B;  2H6Q A;  2P9I C;  2P9P C;  4R7A B;  4GQ1 A;  3EI2 B;  3EWE A;  2CNX A;  5TEE A;  3F3P A;  5I5M A;  2AGL A;  2QC5 A;  2Z2N A;  3IKO A;  2PBI B;  5FKR A;  4CY1 A;  1TBG A;  3CIK B;  3UVK A;  4ZOY A;  2HJB A;  4A11 B;  3SJL D;  5AMS A;  4E54 B;  3PSL A;  1JMX B;  4K3J B;  4UI9 R;  4FA4 D;  3L4M D;  3SWS D;  4ZOZ A;  4TZ4 A;  1N6F A;  1GXR A;  3UR4 A;  2MTA H;  2I0S A;  4JXM A;  3I7H A;  3IIW A;  4JSV C;  3C75 H;  4JSN C;  2YNP A;  3AL8 B;  3VA6 A;  3ZWL B;  5FLX g;  3RMZ D;  1K32 A;  4A09 B;  3PVW B;  2I0T A;  3FM0 A;  3DWL C;  3VH0 A;  5FKS A;  3UVO A;  5I5J A;  4K3I D;  1JJU B;  4CI2 A;  4CZX A;  4N14 A; 
#chains in the Genus database with same CATH topology
 3AFC A;  2EID A;  3IJC A;  4ZOX A;  2PM9 A;  3UKR C;  4KFM B;  5C2W B;  1XIP A;  4J82 A;  3GFC A;  2IWK A;  4O45 A;  3SLE D;  2H6K A;  2BKL A;  3DDU A;  3O4H A;  2OVQ B;  5EAM A;  3C5M A;  5TEF A;  2YNO A;  1UTC A;  2XYI A;  1YR2 A;  1U2V C;  4G1M A;  4PXW A;  2VZ3 A;  4RE5 A;  4XEI C;  4GGD A;  3OKW A;  4A7J A;  3JPX A;  3SVW D;  3EQ9 A;  1H2Y A;  1XKS A;  5C2V B;  3C9C A;  3I8C A;  3ORV D;  4ERY A;  1UOP A;  3I2N A;  4D0K A;  4U1E I;  2AGX A;  4ES0 A;  1FWX A;  2H13 A;  1B9Y A;  2PM7 B;  3ULE C;  3V9F A;  2OIZ A;  3RFH A;  3SFZ A;  3PVU B;  3UVL A;  2AGW A;  3MXX A;  3O4I A;  4MMY A;  3IUN A;  5HQG A;  1M1X A;  1A0R B;  1NEX B;  4BP9 A;  2B5L A;  4QRJ A;  2IUV A;  4A11 A;  4E54 A;  3MKQ A;  4J84 A;  4A2L A;  3RN0 D;  3DM0 A;  5C9Z B;  4PBY A;  5EAR A;  3CFV A;  3V7D B;  4GMB A;  3UVM A;  4FA1 D;  3VI3 A;  3IJ1 A;  3FGB A;  1O6G A;  4GQ2 P;  4ERQ A;  1VE6 A;  3JZH A;  4NEN A;  3AL9 A;  4GM3 A;  1VYH C;  3EI3 B;  3OL2 B;  5FQD A;  1YFQ A;  3AL8 A;  3IJE A;  2G99 A;  1SQJ A;  4FHL A;  4J86 A;  3FRX A;  2QXV A;  3FCS A;  5EMJ B;  4AOW A;  4X3E A;  3SXT D;  4A09 A;  3I89 A;  4XYH A;  5IJ8 E;  3ZE0 A;  3JAM g;  4A0B B;  2I3T A;  4BCB A;  3ZDZ A;  3EI1 B;  4X60 B;  2P9L C;  3K26 A;  1JTD B;  5CXB B;  1JMZ B;  4J8G A;  4XYI A;  5M5V A;  2CN2 A;  1PEV A;  3MUN A;  2YB8 B;  1P22 A;  1E5T A;  2EIB A;  4JD2 C;  5EAL A;  4J79 A;  4Y7R A;  1VZ2 A;  2HU8 A;  3SBP A;  1K8K C;  2B5N A;  5H14 A;  3PE7 A;  3JZN A;  4GGC A;  3DXM C;  5FFG A;  3KRW B;  3NIG A;  3NID A;  4J81 A;  3BG0 A;  5IGO A;  4D6V A;  2CO0 A;  2OVP B;  2XU7 A;  4GQB B;  1OMW B;  2Q7Q A;  4BUJ C;  4O9D A;  2IWF A;  4O3T B;  5KDO B;  4JHP C;  3QI0 A;  3VGZ A;  1U8C A;  3DXK C;  2P9N C;  3K6S A;  5CXC B;  4L9O A;  2EIE A;  5E6U A;  2IUQ A;  3SBR A;  1C9I A;  3NVN A;  5SXM A;  5JWZ A;  3P4F A;  1RI6 A;  1GOF A;  3UKU C;  1JOF A;  3JRO A;  3GD1 I;  4NAA A;  2BCJ B;  3KRX B;  2CO0 C;  2J55 H;  3O4G A;  3OKT A;  3GRE A;  3F3F A;  3T3M A;  5HE0 B;  1PGU A;  4IA9 A;  4UM9 A;  3SCY A;  5GMK n;  4FAV D;  1SHY B;  1NR0 A;  4BCD A;  3EI3 A;  3OF7 A;  3OL2 A;  4AMZ A;  4L1M A;  4O1Q D;  1L5G A;  3EQ8 A;  1B9X A;  2AH0 A;  3EU7 A;  4BL0 A;  3OW8 A;  2UZX B;  3BWS A;  1O6F A;  4PSX B;  4QAM A;  4QL1 A;  4DNV A;  4Z7N A;  4JSP C;  4JSX C;  4Z7Q A;  5EMM B;  4A0A B;  2VDM A;  2AGY A;  4D9S A;  2IUP A;  2YMU A;  4L3H D;  5GXH A;  4A0B A;  4FA5 D;  3OTT A;  3EI1 A;  3EMH A;  5FXY A;  4IMM A;  5CXB A;  5FA5 B;  2H68 A;  1GG2 B;  5EM2 B;  4BH6 A;  2VDQ A;  5HE2 B;  4AX4 A;  1PBY B;  4UM8 A;  4NSX A;  2VDR A;  4ZOV A;  2Z2O A;  2YBA A;  5I5I A;  5K19 A;  2GC7 A;  4PC0 A;  3ZE2 A;  4WK4 A;  1H2Z A;  5THA A;  4AEZ A;  4CZV A;  4LG8 A;  2EIC A;  4G56 B;  1QFS A;  2HJ4 A;  3V5W B;  3OKY B;  1SQ9 A;  5HE1 B;  3NVQ A;  4CI3 A;  5FKT A;  3E0C A;  4A2M A;  3I7N A;  3MUO A;  2HU7 A;  2IAA A;  3FCU A;  2W18 A;  2J57 G;  4JHN A;  3SBQ A;  3W15 A;  5HYN B;  5A2Q g;  3RN1 D;  4NBM A;  4FWW A;  4GM9 A;  4PNK B;  4Y5R D;  2UZY B;  2HKM A;  5M61 A;  5CXC A;  4DNU A;  4GGA A;  2H9L A;  1H2X A;  5TDH B;  5K1C C;  3NVX A;  3SHF A;  5M5T A;  2TRC B;  3EQ7 A;  4OWR A;  5CYK B;  4J73 A;  2AQ5 A;  2HKR A;  1VE7 A;  5H17 A;  1N6E A;  5EAP A;  1Q47 A;  1S4U X;  2O9K A;  4ESG A;  3RLM D;  3RSE C;  2WQ8 A;  4ZN4 A;  3I8E A;  4E5Z B;  5IJ7 E;  4J0X A;  1L0Q A;  4WK0 A;  4H5I A;  5B4W A;  3IVM A;  3MZL A;  3T3P A;  3B7F A;  4WK2 A;  3UVN A;  1MG3 A;  5C92 A;  2VZ1 A;  2XL2 A;  4I79 A;  3C99 A;  2VC2 A;  3EI4 B;  1MG2 A;  1GOT B;  4GZ8 A;  3JZG A;  4FAN D;  3I7L A;  5IT9 g;  1UOQ A;  1H2W A;  2BBK H;  1XHM A;  3N0D A;  3A0F A;  1QNI A;  2H9M A;  3PXT D;  4H5J A;  3HFQ A;  2OVR B;  4A0A A;  3AH8 B;  4ERZ A;  5EMK B;  2OJY A;  4YVD A;  5GSA A;  1GOG A;  2PM6 B;  3IUR A;  5EM2 A;  3MZK A;  4CY3 A;  3MMY A;  2EBS A;  4MMX A;  3EG6 A;  4J87 A;  5E6S A;  3MKS B;  4X61 B;  2P9K C;  3GC3 B;  4AMY A;  1I2M B;  2H3X A;  4GM8 A;  4JT6 C;  4LGN A;  4Z7O A;  4EWR A;  4QQE A;  3CFS B;  3IUQ A;  3V4P A;  4A08 B;  4BCC A;  3OKY A;  3J80 g;  3RRM C;  5AJA A;  2HXC A;  4QT8 A;  5M5S A;  5EML B;  4LG9 A;  3IIY A;  2GC4 A;  2J56 H;  1MDA H;  3NIF A;  3L4O D;  5AFU 3;  4FB1 D;  4O3U B;  2I3S A;  4G1E A;  2P9U C;  3ODT A;  5M5U A;  4HDJ A;  2AGZ A;  1U4C A;  2B4E A;  3PXS D;  2P9S C;  2AH1 A;  4IRZ A;  5CYK A;  4CI8 A;  3K71 A;  2H6N A;  1JV2 A;  3K27 A;  3U4Y A;  1TYQ C;  3I7P A;  3I7K A;  2H47 A;  1BPO A;  2VDP A;  4L3G D;  4CC9 A;  3J81 g;  1VZ3 A;  2GNQ A;  4JT5 C;  2B5M A;  1ERJ A;  2CE8 A;  3IJ0 A;  2XDW A;  1A12 A;  5IC7 A;  4E5Z A;  3IUL A;  4WJK A;  2YNN A;  4U7A A;  5H1M A;  2OK6 A;  2I0R A;  1UOO A;  3EI2 A;  3EI4 A;  1R5M A;  3QHY B;  2XL3 A;  4OZU A;  4J8B A;  2IUR A;  4PBZ A;  3ZDX A;  2XE4 A;  2HYE A;  1PI6 A;  4CZY A;  3DSM A;  5HE3 B;  4CI1 A;  4CY5 A;  2PM9 B;  3IUJ A;  3RFG A;  2H9P A;  4J0W A;  2JKX A;  3SMR A;  2OK4 A;  4O02 A;  4G55 A;  4J78 A;  5M5R A;  1TYE A;  2H14 A;  3JB9 L;  2G9A A;  4Z8L A;  3F3G A;  3VI4 A;  2Z2P A;  3I7O A;  4FA9 D;  4CY2 A;  3SN6 B;  1OLZ A;  4L1Q D;  3JRP A;  1N6D A;  2VDK A;  2VDO A;  2XZG A;  2CN3 A;  3BG1 A;  1E8M A;  5GXI A;  4X63 B;  1GP2 B;  2HES X;  2CE9 A;  5FKQ A;  2H9N A;  3KCI A;  4NC4 A;  3IUM A;  3PXW D;  4J77 A;  4MMZ A;  4AN0 A;  5C86 A;  5FFO A;  5TF2 A;  5IGQ A;  4MK0 B;  4A08 A;  3MVD K;  3PSC B;  4PSW B;  2QR5 A;  2H6Q A;  2P9I C;  3V4V A;  2P9P C;  1K3I A;  4R7A B;  4GQ1 A;  3EI2 B;  3EWE A;  2CNX A;  4O2W A;  5TEE A;  3F3P A;  3O4J A;  1C9L A;  5I5M A;  2AGL A;  2QC5 A;  2Z2N A;  1GOH A;  3IKO A;  2PBI B;  5FKR A;  4CY1 A;  1TBG A;  3CIK B;  3UVK A;  4ZOY A;  3ZDY A;  4DNW A;  2HJB A;  2VDN A;  4A11 B;  3SJL D;  5AMS A;  4E54 B;  3PSL A;  1JMX B;  4K3J B;  4UI9 R;  4FA4 D;  3L4M D;  2QZP A;  2VDL A;  3SWS D;  3K72 A;  4ZOZ A;  4TZ4 A;  1N6F A;  1GXR A;  3UR4 A;  2MTA H;  2I0S A;  4JXM A;  3I7H A;  3ZE1 A;  3IIW A;  4JSV C;  1QFM A;  3C75 H;  4JSN C;  2YNP A;  4N14 A;  3AL8 B;  1E8N A;  3VA6 A;  3ZWL B;  4AN1 A;  5FLX g;  5E6R A;  3RMZ D;  1K32 A;  4A09 B;  3PVW B;  2I0T A;  2HU5 A;  3FM0 A;  3DWL C;  3VH0 A;  5FKS A;  3UVO A;  1T2X A;  4BP8 A;  5HDB A;  4RE6 A;  5I5J A;  4K3I D;  1JJU B;  4CI2 A;  4CZX A;  3N0E A; 
#chains in the Genus database with same CATH homology
 3AFC A;  3IJC A;  4ZOX A;  2PM9 A;  3UKR C;  4KFM B;  5C2W B;  1XIP A;  4J82 A;  3GFC A;  2IWK A;  4O45 A;  3SLE D;  2H6K A;  2OVQ B;  5EAM A;  3C5M A;  5TEF A;  2YNO A;  2XYI A;  1U2V C;  4PXW A;  4XEI C;  4GGD A;  3OKW A;  4A7J A;  3JPX A;  3SVW D;  1XKS A;  5C2V B;  3C9C A;  3I8C A;  3ORV D;  4ERY A;  3I2N A;  4D0K A;  4U1E I;  2AGX A;  4ES0 A;  1FWX A;  2H13 A;  1B9Y A;  2PM7 B;  3ULE C;  3V9F A;  2OIZ A;  3RFH A;  3SFZ A;  3PVU B;  3UVL A;  2AGW A;  3MXX A;  5HQG A;  1A0R B;  1NEX B;  2B5L A;  4QRJ A;  2IUV A;  4A11 A;  4E54 A;  3MKQ A;  4J84 A;  4A2L A;  3RN0 D;  3DM0 A;  5C9Z B;  4PBY A;  5EAR A;  3CFV A;  3V7D B;  4GMB A;  3UVM A;  4FA1 D;  3IJ1 A;  3FGB A;  4GQ2 P;  4ERQ A;  3JZH A;  3AL9 A;  4GM3 A;  1VYH C;  3EI3 B;  3OL2 B;  5FQD A;  1YFQ A;  3AL8 A;  2G99 A;  1SQJ A;  4FHL A;  4J86 A;  3FRX A;  2QXV A;  5EMJ B;  4AOW A;  4X3E A;  3SXT D;  3N0E A;  4A09 A;  3I89 A;  4XYH A;  5IJ8 E;  3JAM g;  4A0B B;  2I3T A;  3EI1 B;  4X60 B;  2P9L C;  3K26 A;  5CXB B;  1JMZ B;  4J8G A;  4XYI A;  2CN2 A;  1PEV A;  2YB8 B;  1P22 A;  4JD2 C;  5EAL A;  4J79 A;  4Y7R A;  3SBP A;  1K8K C;  2B5N A;  5H14 A;  3PE7 A;  3JZN A;  4GGC A;  3DXM C;  3KRW B;  4J81 A;  3BG0 A;  5IGO A;  4D6V A;  2CO0 A;  2OVP B;  2XU7 A;  4GQB B;  1OMW B;  2Q7Q A;  4BUJ C;  4O9D A;  2IWF A;  4O3T B;  5KDO B;  3VGZ A;  3DXK C;  2P9N C;  5CXC B;  4L9O A;  2IUQ A;  3SBR A;  3NVN A;  5SXM A;  5JWZ A;  3P4F A;  1RI6 A;  3UKU C;  1JOF A;  3JRO A;  2BCJ B;  3KRX B;  2CO0 C;  2J55 H;  3OKT A;  3GRE A;  3F3F A;  5HE0 B;  1PGU A;  4IA9 A;  3SCY A;  5GMK n;  4FAV D;  1SHY B;  1NR0 A;  3EI3 A;  3OL2 A;  4O1Q D;  2AH0 A;  1B9X A;  3EU7 A;  4BL0 A;  3OW8 A;  2UZX B;  3BWS A;  4PSX B;  4QL1 A;  4JSP C;  4JSX C;  5EMM B;  4A0A B;  2AGY A;  2IUP A;  2YMU A;  4L3H D;  5GXH A;  4A0B A;  4FA5 D;  3OTT A;  3EI1 A;  3EMH A;  5FXY A;  4IMM A;  5CXB A;  5FA5 B;  2H68 A;  1GG2 B;  5EM2 B;  4BH6 A;  5HE2 B;  1PBY B;  4NSX A;  4ZOV A;  2Z2O A;  2YBA A;  5I5I A;  5K19 A;  2GC7 A;  4PC0 A;  5THA A;  4AEZ A;  4CZV A;  4LG8 A;  4G56 B;  3V5W B;  2HJ4 A;  3OKY B;  1SQ9 A;  5HE1 B;  3NVQ A;  4CI3 A;  5FKT A;  3E0C A;  4A2M A;  3I7N A;  2IAA A;  2W18 A;  2J57 G;  3SBQ A;  3W15 A;  5HYN B;  5A2Q g;  3RN1 D;  4FWW A;  4GM9 A;  4PNK B;  4Y5R D;  2UZY B;  2HKM A;  5CXC A;  4GGA A;  2H9L A;  5TDH B;  5K1C C;  3NVX A;  3SHF A;  2TRC B;  4OWR A;  5CYK B;  4J73 A;  2AQ5 A;  2HKR A;  5H17 A;  1N6E A;  5EAP A;  1Q47 A;  1S4U X;  2O9K A;  4ESG A;  3RLM D;  3RSE C;  4ZN4 A;  3I8E A;  4E5Z B;  5IJ7 E;  4J0X A;  1L0Q A;  4H5I A;  5B4W A;  3MZL A;  3B7F A;  3UVN A;  1MG3 A;  2XL2 A;  4I79 A;  3C99 A;  3EI4 B;  1MG2 A;  1GOT B;  4GZ8 A;  3JZG A;  4FAN D;  3I7L A;  5IT9 g;  2BBK H;  1XHM A;  3N0D A;  3A0F A;  1QNI A;  2H9M A;  3PXT D;  4H5J A;  3HFQ A;  2OVR B;  4A0A A;  3AH8 B;  4ERZ A;  5EMK B;  2OJY A;  4YVD A;  5GSA A;  2PM6 B;  5EM2 A;  3MZK A;  4CY3 A;  3MMY A;  2EBS A;  3EG6 A;  4J87 A;  3MKS B;  4X61 B;  2P9K C;  2H3X A;  4GM8 A;  4JT6 C;  4LGN A;  4EWR A;  4QQE A;  3CFS B;  4A08 B;  3OKY A;  3J80 g;  3RRM C;  5AJA A;  2HXC A;  4QT8 A;  5EML B;  4LG9 A;  3IIY A;  2GC4 A;  2J56 H;  1MDA H;  3L4O D;  5AFU 3;  4FB1 D;  4O3U B;  2I3S A;  2P9U C;  3ODT A;  4HDJ A;  2AGZ A;  1U4C A;  2B4E A;  3PXS D;  2P9S C;  2AH1 A;  5CYK A;  4CI8 A;  2H6N A;  3K27 A;  3U4Y A;  1TYQ C;  3I7P A;  3I7K A;  2H47 A;  4CC9 A;  4L3G D;  3J81 g;  2GNQ A;  4JT5 C;  2B5M A;  1ERJ A;  2CE8 A;  3IJ0 A;  5IC7 A;  4E5Z A;  2YNN A;  4U7A A;  5H1M A;  2OK6 A;  2I0R A;  3EI2 A;  3EI4 A;  1R5M A;  2XL3 A;  4OZU A;  4J8B A;  2IUR A;  4PBZ A;  2HYE A;  1PI6 A;  4CZY A;  3DSM A;  5HE3 B;  4CI1 A;  4CY5 A;  2PM9 B;  3RFG A;  2H9P A;  4J0W A;  3SMR A;  2OK4 A;  4J78 A;  3JB9 L;  2H14 A;  2G9A A;  4Z8L A;  3F3G A;  2Z2P A;  3I7O A;  4FA9 D;  4CY2 A;  3SN6 B;  1OLZ A;  4L1Q D;  1N6D A;  3JRP A;  2CN3 A;  3BG1 A;  5GXI A;  4X63 B;  1GP2 B;  2HES X;  2CE9 A;  5FKQ A;  2H9N A;  3PXW D;  4J77 A;  5TF2 A;  5IGQ A;  4MK0 B;  4A08 A;  3PSC B;  4PSW B;  2H6Q A;  2P9I C;  2P9P C;  4R7A B;  4GQ1 A;  3EI2 B;  3EWE A;  2CNX A;  5TEE A;  3F3P A;  5I5M A;  2AGL A;  2QC5 A;  2Z2N A;  3IKO A;  2PBI B;  5FKR A;  4CY1 A;  1TBG A;  3CIK B;  3UVK A;  4ZOY A;  2HJB A;  4A11 B;  3SJL D;  5AMS A;  4E54 B;  3PSL A;  1JMX B;  4K3J B;  4UI9 R;  4FA4 D;  3L4M D;  3SWS D;  4ZOZ A;  4TZ4 A;  1N6F A;  1GXR A;  3UR4 A;  2MTA H;  2I0S A;  4JXM A;  3I7H A;  3IIW A;  4JSV C;  3C75 H;  4JSN C;  2YNP A;  3AL8 B;  3VA6 A;  3ZWL B;  5FLX g;  3RMZ D;  1K32 A;  4A09 B;  3PVW B;  2I0T A;  3FM0 A;  3DWL C;  3VH0 A;  5FKS A;  3UVO A;  5I5J A;  4K3I D;  1JJU B;  4CI2 A;  4CZX A;  4N14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...