3ZE2A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze2A00
3VI3A 4WK4A 1M1XA 3FCUA 4MMYA 4O02A 3IJEA 1U8CA 1L5GA 2VDPA 3V4VA 1JV2A 3K72A 5E6SA 5FFOA 3NIGA 3ZE1A 3NIFA 4WK0A 3ZDYA 4IRZA 3K6SA 5FFGA 4NENA 4WK2A 2VDOA 4G1EA 2VDQA 3T3MA 4WJKA 2VDMA 3ZDZA 4UM8A 4Z7NA 3K71A 3VI4A 5HDBA 3V4PA 2VDLA 2VDNA 2VC2A 5E6UA 3ZE2A 4G1MA 4UM9A 2VDKA 3T3PA 3ZE0A 3NIDA 1TYEA 2VDRA 4MMXA 4MMZA 5E6RA 3ZDXA 3FCSA 4Z7QA 4Z7OA
chains in the Genus database with same CATH superfamily
4CI2A 4WK4A 1XHMA 2EBSA 4QAMA 4JT6C 3I7NA 3MKQA 5H1MA 2AGXA 4A7JA 4AX4A 1H2WA 4G56B 4PXWA 4O1QD 5CXCB 2P9PC 2VDOA 4AEZA 5HE1B 2B4EA 3SBPA 4CZVA 4FAND 2PM9A 2Z2OA 2EIBA 3DDUA 4D9SA 2VZ1A 4J73A 1L0QA 1PEVA 4H5JA 2H9LA 2OVPB 3MZKA 2VDRA 2CE9A 5TEEA 3VI3A 4ERQA 1NEXB 1SHYB 4AOWA 2G9AA 4PNKB 2IURA 1VYHC 2QXVA 4QT8A 5HYNB 4FAVD 1GXRA 1FWXA 3CIKB 2IUQA 4WK2A 2HKRA 3T3MA 1E8MA 4GGDA 5GMKn 3K71A 1NR0A 1H2XA 2YB8B 3UVMA 2PBIB 5AMSA 5E6UA 3ZE2A 3SVWD 1E8NA 4GM8A 4GZ8A 3N0DA 4QRJA 3I8CA 5TEFA 4BCCA 3SLED 1GOTB 2YMUA 4Z7QA 3K27A 4J86A 4BP8A 2CNXA 4X63B 2XYIA 2VZ3A 2P9SC 4MMYA 2XZGA 4FA4D 2AH1A 1JOFA 3V5WB 3NIFA 4Y5RD 4CZXA 3K6SA 1B9XA 4NENA 3FGBA 4G1EA 4EWRA 2AGYA 3MUNA 1N6DA 3I89A 3BG0A 4ERZA 5EMMB 2I0RA 3W15A 1PI6A 3F3GA 2VDLA 5M5SA 1MDAH 5HE3B 5HE2B 2TRCB 3SCYA 3PVUB 3EWEA 3I7PA 3NIDA 2H9NA 3RRMC 4J82A 5IJ7E 3EI1B 5FA5B 2P9IC 1JMZB 4GQBB 4L1MA 2CE8A 1I2MB 2Z2PA 3ZE1A 4DNVA 3C99A 3V7DB 3AFCA 4PBYA 4JSVC 4ERYA 2CN2A 4AMZA 3AH8B 4J0WA 2I0SA 5M5RA 3UVNA 2VDQA 4BCDA 5GXIA 2AGZA 4GQ1A 4MK0B 4D0KA 3N0EA 2HJBA 1A0RB 5TDHB 4JT5C 1H2YA 5FKTA 2J56H 4E54A 3ZDXA 3IJ0A 4NSXA 4LG8A 1JTDB 3L4OD 3OKWA 3PE7A 3E0CA 4JSXC 4J79A 2H6KA 4A2LA 1JV2A 2XL3A 2H14A 2H9PA 4X61B 4Z8LA 3F3PA 4FB1D 3V9FA 5K1CC 4ZOXA 5AJAA 3DWLC 2AGLA 5IGOA 5CXCA 2PM7B 4L1QD 2HU7A 2P9NC 4L3GD 5EAMA 3KRWB 3VGZA 3KCIA 1K8KC 3VA6A 3UVKA 4JHPC 3PSCB 2YBAA 3RFHA 3UR4A 2J57G 5GXHA 1UOOA 2G99A 3EQ8A 2AH0A 1TBGA 2H13A 2B5LA 1N6FA 5HE0B 3NIGA 3JPXA 2GC4A 4CC9A 2YNPA 3EQ7A 4J78A 3EU7A 3SBRA 4JD2C 4Z7NA 2AGWA 1O6FA 3DM0A 2IAAA 4BUJC 4A09B 1QFMA 3O4GA 3RSEC 2VDKA 3OKYB 3I7LA 3P4FA 1O6GA 1BPOA 4GM9A 3SHFA 3O4JA 2I0TA 3I8EA 2OVRB 5M5VA 4J8GA 3GC3B 3UVOA 4UI9R 3FM0A 4GMBA 3IJEA 4O02A 5FLXg 4JXMA 5FKSA 1VE6A 3I7OA 3J80g 3EMHA 3IIWA 4OZUA 3JB9L 4U7AA 1U2VC 2OVQB 4D6VA 1U4CA 4N14A 2H3XA 3ZE0A 5AFU3 4FWWA 1TYEA 5E6RA 2QC5A 4GGAA 3IVMA 4X60B 3NVQA 1GOGA 3DXMC 1QNIA 5I5IA 2EICA 2VDPA 4PSXB 5FKQA 5IJ8E 3EI1A 2IUPA 3QI0A 1JJUB 1K32A 3OTTA 4GGCA 1MG2A 3ODTA 2XU7A 3MKSB 5THAA 1GOHA 4FHLA 2Z2NA 4LG9A 2IWFA 4L3HD 2VC2A 3PXTD 2IUVA 3J81g 2GC7A 4E5ZA 3EI3B 1TYQC 2OK4A 3OL2B 3UVLA 3VH0A 1UTCA 3C9CA 4O9DA 2HU5A 3JZNA 3OKTA 5KDOB 4ZOZA 3IJCA 5CXBA 3V4VA 1H2ZA 4K3ID 3OF7A 5CYKA 2UZXB 1QFSA 3EG6A 4AN1A 2WQ8A 5C9ZB 4E5ZB 4DNWA 3SJLD 4ESGA 4H5IA 3C5MA 4YVDA 4O2WA 1MG3A 4GM3A 2J55H 3KRXB 3AL8A 2P9UC 4FA9D 4ZOYA 1S4UX 2I3TA 4J8BA 3MZLA 5CXBB 1XKSA 3AL9A 3IUNA 2Q7QA 5CYKB 5EALA 3JRPA 3JROA 4XYIA 5EM2A 3IUQA 3MUOA 1K3IA 4JHNA 1UOPA 3SBQA 3DSMA 2EIDA 4OWRA 4CY1A 4A0AA 3O4HA 3PVWB 2B5NA 2HYEA 4ZN4A 5FFGA 2PM6B 3IJ1A 5TF2A 2XDWA 4QQEA 1E5TA 4FA5D 3QHYB 1R5MA 3AL8B 3GREA 1C9LA 2YNNA 4ZOVA 3RN0D 4FA1D 5EM2B 4MMZA 2O9KA 5I5MA 1P22A 1B9YA 1SQJA 4CY5A 4A09A 3ORVD 3SN6B 3UKUC 1M1XA 5M5TA 4A0AB 3OKYA 1VZ2A 1T2XA 4L9OA 3EI2A 2UZYB 3JAMg 2HKMA 4QL1A 3RFGA 2OJYA 3NVXA 5HQGA 4O3TB 1RI6A 3OW8A 4AMYA 4UM8A 1GP2B 1ERJA 3MMYA 4UM9A 5GSAA 3I7HA 5JWZA 5EMJB 3F3FA 1OMWB 2H47A 3EI2B 3FCSA 5B4WA 2MTAH 2CO0C 4JSNC 2P9KC 4K3JB 3FCUA 1C9IA 1SQ9A 5EMKB 3C75H 3IULA 3MXXA 3ZDYA 5IT9g 1VE7A 3BWSA 3PXWD 5C2VB 4WJKA 3ZDZA 2QR5A 3EI4A 3GD1I 3CFSB 1PBYB 2H6NA 2P9LC 4A11A 3CFVA 2H9MA 1XIPA 5EAPA 2BKLA 3HFQA 3EI3A 5FXYA 2HESX 2B5MA 1N6EA 4XYHA 5H14A 1U8CA 3OL2A 1GG2B 1PGUA 5FKRA 4BL0A 2BBKH 2PM9B 3IURA 2GNQA 5EMLB 2JKXA 4NBMA 5H17A 4GQ2P 3EI4B 1VZ3A 4PSWB 3SMRA 4A11B 2W18A 3VI4A 2CO0A 3V4PA 3EQ9A 3IKOA 2HJ4A 4G1MA 5IC7A 3U4YA 1YFQA 4J81A 3RMZD 3ULEC 1JMXB 4J87A 3SWSD 4O45A 5K19A 5I5JA 4Z7OA 4R7AB 2BCJB 3O4IA 4A2MA 4CZYA 3MVDK 4A08A 5A2Qg 1A12A 4PC0A 5M61A 5C2WB 2XL2A 3K72A 3BG1A 1GOFA 3JZHA 3ZWLB 5FQDA 4X3EA 1OLZA 2OK6A 2VDNA 3RN1D 2YNOA 3T3PA 4J84A 3RLMD 4MMXA 4A08B 4KFMB 3I2NA 2XE4A 2IWKA 3PXSD 4Y7RA 2AQ5A 4TZ4A 5SXMA 4CY2A 4O3UB 2OIZA 4RE6A 1UOQA 3NVNA 5C92A 5C86A 4CI3A 4IA9A 3SXTD 4IMMA 2I3SA 3SFZA 3IUMA 5HDBA 4DNUA 4NAAA 3DXKC 4BP9A 4A0BA 3GFCA 1YR2A 2EIEA 2H68A 4NC4A 2CN3A 5IGQA 3PSLA 4ES0A 4BH6A 4CI8A 1L5GA 4XEIC 3K26A 3FRXA 5E6SA 5FFOA 2HXCA 3IUJA 3A0FA 4WK0A 3JZGA 4IRZA 4J77A 4I79A 4BCBA 2QZPA 4CY3A 3L4MD 4CI1A 1Q47A 2VDMA 4J0XA 4A0BB 4E54B 4U1EI 3I7KA 3UKRC 4AN0A 2HU8A 5M5UA 4LGNA 3B7FA 5EARA 3IIYA 4RE5A 4G55A 4HDJA 4JSPC 2H6QA 4PBZA
chains in the Genus database with same CATH topology
3VI3A 4WK4A 1M1XA 3FCUA 4MMYA 4O02A 3IJEA 1U8CA 1L5GA 2VDPA 3V4VA 1JV2A 3K72A 5E6SA 5FFOA 3NIGA 3ZE1A 3NIFA 4WK0A 3ZDYA 4IRZA 3K6SA 5FFGA 4NENA 4WK2A 2VDOA 4G1EA 2VDQA 3T3MA 4WJKA 2VDMA 3ZDZA 4UM8A 4Z7NA 3K71A 3VI4A 5HDBA 3V4PA 2VDLA 2VDNA 2VC2A 5E6UA 3ZE2A 4G1MA 4UM9A 2VDKA 3T3PA 3ZE0A 3NIDA 1TYEA 2VDRA 4MMXA 4MMZA 5E6RA 3ZDXA 3FCSA 4Z7QA 4Z7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI3 A;  4WK4 A;  1M1X A;  3FCU A;  4MMY A;  4O02 A;  3IJE A;  1U8C A;  1L5G A;  2VDP A;  3V4V A;  1JV2 A;  3K72 A;  5E6S A;  5FFO A;  3NIG A;  3ZE1 A;  3NIF A;  4WK0 A;  3ZDY A;  4IRZ A;  3K6S A;  5FFG A;  4NEN A;  4WK2 A;  2VDO A;  4G1E A;  2VDQ A;  3T3M A;  4WJK A;  2VDM A;  3ZDZ A;  4UM8 A;  4Z7N A;  3K71 A;  3VI4 A;  5HDB A;  3V4P A;  2VDL A;  2VDN A;  2VC2 A;  5E6U A;  3ZE2 A;  4G1M A;  4UM9 A;  2VDK A;  3T3P A;  3ZE0 A;  3NID A;  1TYE A;  2VDR A;  4MMX A;  4MMZ A;  5E6R A;  3ZDX A;  3FCS A;  4Z7Q A;  4Z7O A; 
#chains in the Genus database with same CATH topology
 4CI2 A;  4WK4 A;  1XHM A;  2EBS A;  4QAM A;  4JT6 C;  3I7N A;  3MKQ A;  5H1M A;  2AGX A;  4A7J A;  4AX4 A;  1H2W A;  4G56 B;  4PXW A;  4O1Q D;  5CXC B;  2P9P C;  2VDO A;  4AEZ A;  5HE1 B;  2B4E A;  3SBP A;  4CZV A;  4FAN D;  2PM9 A;  2Z2O A;  2EIB A;  3DDU A;  4D9S A;  2VZ1 A;  4J73 A;  1L0Q A;  1PEV A;  4H5J A;  2H9L A;  2OVP B;  3MZK A;  2VDR A;  2CE9 A;  5TEE A;  3VI3 A;  4ERQ A;  1NEX B;  1SHY B;  4AOW A;  2G9A A;  4PNK B;  2IUR A;  1VYH C;  2QXV A;  4QT8 A;  5HYN B;  4FAV D;  1GXR A;  1FWX A;  3CIK B;  2IUQ A;  4WK2 A;  2HKR A;  3T3M A;  1E8M A;  4GGD A;  5GMK n;  3K71 A;  1NR0 A;  1H2X A;  2YB8 B;  3UVM A;  2PBI B;  5AMS A;  5E6U A;  3ZE2 A;  3SVW D;  1E8N A;  4GM8 A;  4GZ8 A;  3N0D A;  4QRJ A;  3I8C A;  5TEF A;  4BCC A;  3SLE D;  1GOT B;  2YMU A;  4Z7Q A;  3K27 A;  4J86 A;  4BP8 A;  2CNX A;  4X63 B;  2XYI A;  2VZ3 A;  2P9S C;  4MMY A;  2XZG A;  4FA4 D;  2AH1 A;  1JOF A;  3V5W B;  3NIF A;  4Y5R D;  4CZX A;  3K6S A;  1B9X A;  4NEN A;  3FGB A;  4G1E A;  4EWR A;  2AGY A;  3MUN A;  1N6D A;  3I89 A;  3BG0 A;  4ERZ A;  5EMM B;  2I0R A;  3W15 A;  1PI6 A;  3F3G A;  2VDL A;  5M5S A;  1MDA H;  5HE3 B;  5HE2 B;  2TRC B;  3SCY A;  3PVU B;  3EWE A;  3I7P A;  3NID A;  2H9N A;  3RRM C;  4J82 A;  5IJ7 E;  3EI1 B;  5FA5 B;  2P9I C;  1JMZ B;  4GQB B;  4L1M A;  2CE8 A;  1I2M B;  2Z2P A;  3ZE1 A;  4DNV A;  3C99 A;  3V7D B;  3AFC A;  4PBY A;  4JSV C;  4ERY A;  2CN2 A;  4AMZ A;  3AH8 B;  4J0W A;  2I0S A;  5M5R A;  3UVN A;  2VDQ A;  4BCD A;  5GXI A;  2AGZ A;  4GQ1 A;  4MK0 B;  4D0K A;  3N0E A;  2HJB A;  1A0R B;  5TDH B;  4JT5 C;  1H2Y A;  5FKT A;  2J56 H;  4E54 A;  3ZDX A;  3IJ0 A;  4NSX A;  4LG8 A;  1JTD B;  3L4O D;  3OKW A;  3PE7 A;  3E0C A;  4JSX C;  4J79 A;  2H6K A;  4A2L A;  1JV2 A;  2XL3 A;  2H14 A;  2H9P A;  4X61 B;  4Z8L A;  3F3P A;  4FB1 D;  3V9F A;  5K1C C;  4ZOX A;  5AJA A;  3DWL C;  2AGL A;  5IGO A;  5CXC A;  2PM7 B;  4L1Q D;  2HU7 A;  2P9N C;  4L3G D;  5EAM A;  3KRW B;  3VGZ A;  3KCI A;  1K8K C;  3VA6 A;  3UVK A;  4JHP C;  3PSC B;  2YBA A;  3RFH A;  3UR4 A;  2J57 G;  5GXH A;  1UOO A;  2G99 A;  3EQ8 A;  2AH0 A;  1TBG A;  2H13 A;  2B5L A;  1N6F A;  5HE0 B;  3NIG A;  3JPX A;  2GC4 A;  4CC9 A;  2YNP A;  3EQ7 A;  4J78 A;  3EU7 A;  3SBR A;  4JD2 C;  4Z7N A;  2AGW A;  1O6F A;  3DM0 A;  2IAA A;  4BUJ C;  4A09 B;  1QFM A;  3O4G A;  3RSE C;  2VDK A;  3OKY B;  3I7L A;  3P4F A;  1O6G A;  1BPO A;  4GM9 A;  3SHF A;  3O4J A;  2I0T A;  3I8E A;  2OVR B;  5M5V A;  4J8G A;  3GC3 B;  3UVO A;  4UI9 R;  3FM0 A;  4GMB A;  3IJE A;  4O02 A;  5FLX g;  4JXM A;  5FKS A;  1VE6 A;  3I7O A;  3J80 g;  3EMH A;  3IIW A;  4OZU A;  3JB9 L;  4U7A A;  1U2V C;  2OVQ B;  4D6V A;  1U4C A;  4N14 A;  2H3X A;  3ZE0 A;  5AFU 3;  4FWW A;  1TYE A;  5E6R A;  2QC5 A;  4GGA A;  3IVM A;  4X60 B;  3NVQ A;  1GOG A;  3DXM C;  1QNI A;  5I5I A;  2EIC A;  2VDP A;  4PSX B;  5FKQ A;  5IJ8 E;  3EI1 A;  2IUP A;  3QI0 A;  1JJU B;  1K32 A;  3OTT A;  4GGC A;  1MG2 A;  3ODT A;  2XU7 A;  3MKS B;  5THA A;  1GOH A;  4FHL A;  2Z2N A;  4LG9 A;  2IWF A;  4L3H D;  2VC2 A;  3PXT D;  2IUV A;  3J81 g;  2GC7 A;  4E5Z A;  3EI3 B;  1TYQ C;  2OK4 A;  3OL2 B;  3UVL A;  3VH0 A;  1UTC A;  3C9C A;  4O9D A;  2HU5 A;  3JZN A;  3OKT A;  5KDO B;  4ZOZ A;  3IJC A;  5CXB A;  3V4V A;  1H2Z A;  4K3I D;  3OF7 A;  5CYK A;  2UZX B;  1QFS A;  3EG6 A;  4AN1 A;  2WQ8 A;  5C9Z B;  4E5Z B;  4DNW A;  3SJL D;  4ESG A;  4H5I A;  3C5M A;  4YVD A;  4O2W A;  1MG3 A;  4GM3 A;  2J55 H;  3KRX B;  3AL8 A;  2P9U C;  4FA9 D;  4ZOY A;  1S4U X;  2I3T A;  4J8B A;  3MZL A;  5CXB B;  1XKS A;  3AL9 A;  3IUN A;  2Q7Q A;  5CYK B;  5EAL A;  3JRP A;  3JRO A;  4XYI A;  5EM2 A;  3IUQ A;  3MUO A;  1K3I A;  4JHN A;  1UOP A;  3SBQ A;  3DSM A;  2EID A;  4OWR A;  4CY1 A;  4A0A A;  3O4H A;  3PVW B;  2B5N A;  2HYE A;  4ZN4 A;  5FFG A;  2PM6 B;  3IJ1 A;  5TF2 A;  2XDW A;  4QQE A;  1E5T A;  4FA5 D;  3QHY B;  1R5M A;  3AL8 B;  3GRE A;  1C9L A;  2YNN A;  4ZOV A;  3RN0 D;  4FA1 D;  5EM2 B;  4MMZ A;  2O9K A;  5I5M A;  1P22 A;  1B9Y A;  1SQJ A;  4CY5 A;  4A09 A;  3ORV D;  3SN6 B;  3UKU C;  1M1X A;  5M5T A;  4A0A B;  3OKY A;  1VZ2 A;  1T2X A;  4L9O A;  3EI2 A;  2UZY B;  3JAM g;  2HKM A;  4QL1 A;  3RFG A;  2OJY A;  3NVX A;  5HQG A;  4O3T B;  1RI6 A;  3OW8 A;  4AMY A;  4UM8 A;  1GP2 B;  1ERJ A;  3MMY A;  4UM9 A;  5GSA A;  3I7H A;  5JWZ A;  5EMJ B;  3F3F A;  1OMW B;  2H47 A;  3EI2 B;  3FCS A;  5B4W A;  2MTA H;  2CO0 C;  4JSN C;  2P9K C;  4K3J B;  3FCU A;  1C9I A;  1SQ9 A;  5EMK B;  3C75 H;  3IUL A;  3MXX A;  3ZDY A;  5IT9 g;  1VE7 A;  3BWS A;  3PXW D;  5C2V B;  4WJK A;  3ZDZ A;  2QR5 A;  3EI4 A;  3GD1 I;  3CFS B;  1PBY B;  2H6N A;  2P9L C;  4A11 A;  3CFV A;  2H9M A;  1XIP A;  5EAP A;  2BKL A;  3HFQ A;  3EI3 A;  5FXY A;  2HES X;  2B5M A;  1N6E A;  4XYH A;  5H14 A;  1U8C A;  3OL2 A;  1GG2 B;  1PGU A;  5FKR A;  4BL0 A;  2BBK H;  2PM9 B;  3IUR A;  2GNQ A;  5EML B;  2JKX A;  4NBM A;  5H17 A;  4GQ2 P;  3EI4 B;  1VZ3 A;  4PSW B;  3SMR A;  4A11 B;  2W18 A;  3VI4 A;  2CO0 A;  3V4P A;  3EQ9 A;  3IKO A;  2HJ4 A;  4G1M A;  5IC7 A;  3U4Y A;  1YFQ A;  4J81 A;  3RMZ D;  3ULE C;  1JMX B;  4J87 A;  3SWS D;  4O45 A;  5K19 A;  5I5J A;  4Z7O A;  4R7A B;  2BCJ B;  3O4I A;  4A2M A;  4CZY A;  3MVD K;  4A08 A;  5A2Q g;  1A12 A;  4PC0 A;  5M61 A;  5C2W B;  2XL2 A;  3K72 A;  3BG1 A;  1GOF A;  3JZH A;  3ZWL B;  5FQD A;  4X3E A;  1OLZ A;  2OK6 A;  2VDN A;  3RN1 D;  2YNO A;  3T3P A;  4J84 A;  3RLM D;  4MMX A;  4A08 B;  4KFM B;  3I2N A;  2XE4 A;  2IWK A;  3PXS D;  4Y7R A;  2AQ5 A;  4TZ4 A;  5SXM A;  4CY2 A;  4O3U B;  2OIZ A;  4RE6 A;  1UOQ A;  3NVN A;  5C92 A;  5C86 A;  4CI3 A;  4IA9 A;  3SXT D;  4IMM A;  2I3S A;  3SFZ A;  3IUM A;  5HDB A;  4DNU A;  4NAA A;  3DXK C;  4BP9 A;  4A0B A;  3GFC A;  1YR2 A;  2EIE A;  2H68 A;  4NC4 A;  2CN3 A;  5IGQ A;  3PSL A;  4ES0 A;  4BH6 A;  4CI8 A;  1L5G A;  4XEI C;  3K26 A;  3FRX A;  5E6S A;  5FFO A;  2HXC A;  3IUJ A;  3A0F A;  4WK0 A;  3JZG A;  4IRZ A;  4J77 A;  4I79 A;  4BCB A;  2QZP A;  4CY3 A;  3L4M D;  4CI1 A;  1Q47 A;  2VDM A;  4J0X A;  4A0B B;  4E54 B;  4U1E I;  3I7K A;  3UKR C;  4AN0 A;  2HU8 A;  5M5U A;  4LGN A;  3B7F A;  5EAR A;  3IIY A;  4RE5 A;  4G55 A;  4HDJ A;  4JSP C;  2H6Q A;  4PBZ A; 
#chains in the Genus database with same CATH homology
 3VI3 A;  4WK4 A;  1M1X A;  3FCU A;  4MMY A;  4O02 A;  3IJE A;  1U8C A;  1L5G A;  2VDP A;  3V4V A;  1JV2 A;  3K72 A;  5E6S A;  5FFO A;  3NIG A;  3ZE1 A;  3NIF A;  4WK0 A;  3ZDY A;  4IRZ A;  3K6S A;  5FFG A;  4NEN A;  4WK2 A;  2VDO A;  4G1E A;  2VDQ A;  3T3M A;  4WJK A;  2VDM A;  3ZDZ A;  4UM8 A;  4Z7N A;  3K71 A;  3VI4 A;  5HDB A;  3V4P A;  2VDL A;  2VDN A;  2VC2 A;  5E6U A;  3ZE2 A;  4G1M A;  4UM9 A;  2VDK A;  3T3P A;  3ZE0 A;  3NID A;  1TYE A;  2VDR A;  4MMX A;  4MMZ A;  5E6R A;  3ZDX A;  3FCS A;  4Z7Q A;  4Z7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...