3ZE2A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze2A00
3FCSA 3VI3A 1U8CA 1M1XA 5FFGA 4Z7OA 4Z7NA 2VDMA 4G1EA 5E6UA 4MMXA 5FFOA 4UM8A 3VI4A 3ZDYA 4WK2A 3V4PA 4UM9A 5E6SA 3NIFA 4WK4A 3ZE0A 2VDLA 3FCUA 2VDQA 3ZE2A 2VDPA 4MMYA 3K72A 3IJEA 4MMZA 4WJKA 4WK0A 2VDNA 4O02A 1TYEA 3T3PA 3K6SA 3V4VA 4IRZA 3K71A 3ZDZA 2VDKA 3T3MA 1JV2A 3ZDXA 2VC2A 4G1MA 4NENA 5E6RA 5HDBA 4Z7QA 3NIDA 1L5GA 3NIGA 3ZE1A 2VDRA 2VDOA
chains in the Genus database with same CATH superfamily
3L4OD 3I2NA 4PXWA 4A2MA 3I7NA 3VI3A 3UVKA 4ERQA 5FFGA 3O4HA 3OTTA 1MG2A 2IWFA 3I8CA 4DNVA 2WQ8A 5I5MA 3O4IA 4NBMA 4PBZA 2XL2A 3DSMA 4L9OA 1K32A 4ES0A 1JJUB 1YFQA 4X60B 1B9XA 1I2MB 3JRPA 5AFU3 3IJ1A 1GXRA 4U1EI 4G1MA 4CI2A 4Z7QA 5M61A 3MZLA 5FKRA 2HYEA 4J77A 3KRXB 4ZOZA 3OKWA 3DWLC 4RE5A 3RN1D 3VI4A 3I7HA 3NVNA 3ZE0A 1RI6A 2XDWA 2XE4A 1O6GA 3SWSD 4JSPC 2YMUA 5CXBB 2G9AA 3PSCB 3JAMg 4L3GD 3T3MA 4QRJA 4JHPC 3DXKC 3N0EA 4A11A 2P9KC 4PBYA 4A2LA 5EMLB 2CE8A 4I79A 5FFOA 3QHYB 4O2WA 1OLZA 2XYIA 1GOHA 2QC5A 4WK0A 5EAPA 2OK6A 4ZOXA 1XKSA 1SQJA 4D0KA 4BCDA 4D9SA 3A0FA 4JSXC 3KCIA 3EI3B 5HDBA 5H17A 1MG3A 1VE6A 1ERJA 4O45A 3IUNA 4QL1A 2QXVA 4PC0A 4ERZA 4E54A 1QFSA 2I0TA 2IURA 3ORVD 4ZOYA 3ZDYA 3I8EA 4XYHA 5C9ZB 4UM9A 5E6SA 5GSAA 4GM8A 4CI3A 5TEFA 4CZYA 3KRWB 4X63B 1U2VC 5IGQA 4J73A 3IJEA 2HU8A 4CZVA 2AGZA 5C92A 2CN2A 3UR4A 3VA6A 4JD2C 3RFGA 3IJCA 3I7LA 5M5TA 5EM2B 4A08B 4GQ1A 2AH1A 2VDKA 3IUMA 5FKTA 1H2WA 3DDUA 2GNQA 4CY3A 4CC9A 2VDOA 1U8CA 2I3SA 4JXMA 4N14A 4BH6A 1S4UX 4LG9A 1E5TA 4JT5C 3RLMD 2IUQA 3W15A 2HXCA 4A0AA 5AMSA 1UTCA 4FAVD 2H3XA 2VDPA 1C9IA 4WJKA 4AX4A 3BG1A 2MTAH 2VDNA 2YBAA 5HE0B 4ESGA 2HJ4A 1E8MA 4MK0B 4CY5A 3CFSB 1VE7A 3AL8A 4XYIA 3ZDXA 3JZNA 4NENA 1JMXB 1L5GA 3ZE1A 4GQ2P 5FKSA 1K3IA 4JSNC 1K8KC 4J87A 5FKQA 3FM0A 5C2VB 1NEXB 1JMZB 2PM7B 1VZ2A 4MMXA 2J55H 3IURA 4GZ8A 1GOTB 4AN1A 4AN0A 2P9IC 1QNIA 5HQGA 2B5MA 3V5WB 4CI1A 3UKUC 3PXWD 4J86A 3OKTA 2QZPA 3F3FA 1UOQA 3GREA 3MZKA 4JSVC 2H9PA 1JV2A 5E6RA 3JPXA 5HYNB 5IJ8E 5M5VA 1C9LA 3ODTA 4HDJA 3SVWD 5GXHA 2VDRA 5CXCB 1H2ZA 2VZ3A 5CXCA 2BCJB 2IAAA 2Z2OA 3EQ8A 4XEIC 3EI1A 3NVXA 4OWRA 4WK2A 2AQ5A 2B5LA 2EBSA 2OVPB 3I7PA 1GOGA 4BP9A 2H68A 3OKYA 3MVDK 3T3PA 2HU5A 5GMKn 4E5ZB 4IRZA 5TDHB 4ZOVA 5EMMB 2VC2A 4BCCA 3NIDA 3AFCA 4A11B 3UVNA 1A0RB 1QFMA 1M1XA 5IC7A 2P9NC 5I5IA 3C5MA 2I0RA 2OVQB 3EI4B 2CO0C 4AEZA 2VDLA 3QI0A 2VZ1A 4TZ4A 4AMZA 3HFQA 3IIWA 4J84A 3B7FA 4OZUA 3AL9A 3SJLD 1E8NA 3SBRA 2AGWA 4K3ID 5HE3B 3EI2B 4ERYA 4CY1A 4Y5RD 2TRCB 4GM9A 5CXBA 4J0WA 4FAND 4L1QD 3DM0A 4A09B 4U7AA 2GC7A 4X3EA 3CIKB 1N6DA 5E6UA 3K26A 5TF2A 1VYHC 2Z2NA 5I5JA 2CE9A 4FA9D 4A0BA 1N6FA 2EICA 4JHNA 2O9KA 3IUQA 4QQEA 2H14A 5M5SA 5H14A 5CYKB 2JKXA 1T2XA 2AH0A 3ULEC 1Q47A 3L4MD 3MUOA 3C75H 4KFMB 4DNUA 2AGXA 4G56B 4PNKB 4Y7RA 1SHYB 3EWEA 1TBGA 5FXYA 2GC4A 3F3GA 3GC3B 4J8GA 2H9LA 3N0DA 4J0XA 3RRMC 4BP8A 4Z8LA 5GXIA 3IUJA 2BKLA 1N6EA 3SFZA 4A0AB 4E54B 3PE7A 2W18A 3I89A 5KDOB 4IMMA 1NR0A 5IT9g 4ZN4A 1O6FA 2G99A 3AL8B 1GG2B 3NIGA 3UVOA 5K19A 2QR5A 3EMHA 3SLED 1H2YA 3OKYB 3AH8B 5AJAA 4Z7NA 2B4EA 2HJBA 3V7DB 2PBIB 4O9DA 2PM6B 3IKOA 4LGNA 5HE2B 1GOFA 3IJ0A 2HESX 2BBKH 3OF7A 3OL2A 4H5IA 4L1MA 4PSXB 1YR2A 3OL2B 4GMBA 4J8BA 3RN0D 3K6SA 4YVDA 5EMKB 3JZHA 5C86A 3IIYA 3PXSD 2HKRA 4NAAA 1JTDB 3PVWB 3ZDZA 4GGAA 3O4GA 2OJYA 5A2Qg 4FA1D 1PEVA 3I7OA 5C2WB 3J80g 1SQ9A 4JT6C 4X61B 2VDMA 4G1EA 3RMZD 2IWKA 2CN3A 5EALA 3EI1B 2EIBA 3CFVA 3GFCA 3JROA 4H5JA 4WK4A 5EM2A 4A08A 4EWRA 3JB9L 4UI9R 4MMYA 3PSLA 5K1CC 2B5NA 2HU7A 1BPOA 4A7JA 4AMYA 2J56H 2Z2PA 2IUPA 2H6NA 4NC4A 4J81A 2I0SA 3O4JA 2EIEA 3SBQA 5CYKA 4UM8A 3SBPA 1MDAH 4GQBB 3NIFA 3I7KA 1R5MA 3EG6A 4BL0A 3JZGA 4DNWA 4O02A 1XHMA 2AGYA 3V4VA 2P9PC 3MMYA 3BWSA 2AGLA 2XU7A 3J81g 4O3TB 1FWXA 3UKRC 1A12A 4FHLA 3MUNA 2UZYB 3PVUB 4IA9A 4E5ZA 1GP2B 3EQ7A 5IGOA 4A09A 5H1MA 5TEEA 2OK4A 4O3UB 1L0QA 5B4WA 4CZXA 4J79A 4A0BB 5EARA 2EIDA 3RFHA 3EI4A 3DXMC 4O1QD 1XIPA 2XL3A 3OW8A 4R7AB 3EQ9A 2J57G 3FGBA 1B9YA 5FA5B 4RE6A 5EMJB 4LG8A 2H9MA 3ZWLB 3EI3A 2YNNA 3EI2A 3P4FA 4G55A 2I3TA 4QAMA 4Z7OA 4FA5D 2H13A 2OVRB 2H9NA 2YNOA 4GGCA 1UOOA 2YB8B 3SN6B 1JOFA 3BG0A 4CY2A 3FRXA 3K27A 3V4PA 2YNPA 3PXTD 5EAMA 2H47A 4J78A 3VGZA 4D6VA 1PBYB 3MKSB 3SMRA 5FLXg 3C99A 3FCUA 2VDQA 3ZE2A 3VH0A 1TYQC 3NVQA 4CI8A 2PM9B 1U4CA 3MKQA 5HE1B 1PGUA 4J82A 2HKMA 1TYEA 2PM9A 1P22A 4GM3A 4NSXA 3C9CA 1PI6A 4FWWA 3SHFA 2OIZA 1OMWB 2P9LC 2H6QA 3MXXA 3SCYA 4FA4D 4L3HD 3IULA 2CO0A 4BCBA 3U4YA 3FCSA 3UVLA 3RSEC 2XZGA 2CNXA 4K3JB 2P9SC 3UVMA 5M5UA 5FQDA 1VZ3A 2UZXB 1UOPA 5THAA 3IVMA 3K72A 4MMZA 3V9FA 3F3PA 4GGDA 3EU7A 5M5RA 3SXTD 5SXMA 1H2XA 2IUVA 4FB1D 4PSWB 3K71A 2P9UC 4QT8A 2H6KA 4BUJC 5IJ7E 5JWZA 2Q7QA 3GD1I 3E0CA 4AOWA
chains in the Genus database with same CATH topology
3FCSA 3VI3A 1U8CA 1M1XA 5FFGA 4Z7OA 4Z7NA 2VDMA 4G1EA 5E6UA 4MMXA 5FFOA 4UM8A 3VI4A 3ZDYA 4WK2A 3V4PA 4UM9A 5E6SA 3NIFA 4WK4A 3ZE0A 2VDLA 3FCUA 2VDQA 3ZE2A 2VDPA 4MMYA 3K72A 3IJEA 4MMZA 4WJKA 4WK0A 2VDNA 4O02A 1TYEA 3T3PA 3K6SA 3V4VA 4IRZA 3K71A 3ZDZA 2VDKA 3T3MA 1JV2A 3ZDXA 2VC2A 4G1MA 4NENA 5E6RA 5HDBA 4Z7QA 3NIDA 1L5GA 3NIGA 3ZE1A 2VDRA 2VDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FCS A;  3VI3 A;  1U8C A;  1M1X A;  5FFG A;  4Z7O A;  4Z7N A;  2VDM A;  4G1E A;  5E6U A;  4MMX A;  5FFO A;  4UM8 A;  3VI4 A;  3ZDY A;  4WK2 A;  3V4P A;  4UM9 A;  5E6S A;  3NIF A;  4WK4 A;  3ZE0 A;  2VDL A;  3FCU A;  2VDQ A;  3ZE2 A;  2VDP A;  4MMY A;  3K72 A;  3IJE A;  4MMZ A;  4WJK A;  4WK0 A;  2VDN A;  4O02 A;  1TYE A;  3T3P A;  3K6S A;  3V4V A;  4IRZ A;  3K71 A;  3ZDZ A;  2VDK A;  3T3M A;  1JV2 A;  3ZDX A;  2VC2 A;  4G1M A;  4NEN A;  5E6R A;  5HDB A;  4Z7Q A;  3NID A;  1L5G A;  3NIG A;  3ZE1 A;  2VDR A;  2VDO A; 
#chains in the Genus database with same CATH topology
 3L4O D;  3I2N A;  4PXW A;  4A2M A;  3I7N A;  3VI3 A;  3UVK A;  4ERQ A;  5FFG A;  3O4H A;  3OTT A;  1MG2 A;  2IWF A;  3I8C A;  4DNV A;  2WQ8 A;  5I5M A;  3O4I A;  4NBM A;  4PBZ A;  2XL2 A;  3DSM A;  4L9O A;  1K32 A;  4ES0 A;  1JJU B;  1YFQ A;  4X60 B;  1B9X A;  1I2M B;  3JRP A;  5AFU 3;  3IJ1 A;  1GXR A;  4U1E I;  4G1M A;  4CI2 A;  4Z7Q A;  5M61 A;  3MZL A;  5FKR A;  2HYE A;  4J77 A;  3KRX B;  4ZOZ A;  3OKW A;  3DWL C;  4RE5 A;  3RN1 D;  3VI4 A;  3I7H A;  3NVN A;  3ZE0 A;  1RI6 A;  2XDW A;  2XE4 A;  1O6G A;  3SWS D;  4JSP C;  2YMU A;  5CXB B;  2G9A A;  3PSC B;  3JAM g;  4L3G D;  3T3M A;  4QRJ A;  4JHP C;  3DXK C;  3N0E A;  4A11 A;  2P9K C;  4PBY A;  4A2L A;  5EML B;  2CE8 A;  4I79 A;  5FFO A;  3QHY B;  4O2W A;  1OLZ A;  2XYI A;  1GOH A;  2QC5 A;  4WK0 A;  5EAP A;  2OK6 A;  4ZOX A;  1XKS A;  1SQJ A;  4D0K A;  4BCD A;  4D9S A;  3A0F A;  4JSX C;  3KCI A;  3EI3 B;  5HDB A;  5H17 A;  1MG3 A;  1VE6 A;  1ERJ A;  4O45 A;  3IUN A;  4QL1 A;  2QXV A;  4PC0 A;  4ERZ A;  4E54 A;  1QFS A;  2I0T A;  2IUR A;  3ORV D;  4ZOY A;  3ZDY A;  3I8E A;  4XYH A;  5C9Z B;  4UM9 A;  5E6S A;  5GSA A;  4GM8 A;  4CI3 A;  5TEF A;  4CZY A;  3KRW B;  4X63 B;  1U2V C;  5IGQ A;  4J73 A;  3IJE A;  2HU8 A;  4CZV A;  2AGZ A;  5C92 A;  2CN2 A;  3UR4 A;  3VA6 A;  4JD2 C;  3RFG A;  3IJC A;  3I7L A;  5M5T A;  5EM2 B;  4A08 B;  4GQ1 A;  2AH1 A;  2VDK A;  3IUM A;  5FKT A;  1H2W A;  3DDU A;  2GNQ A;  4CY3 A;  4CC9 A;  2VDO A;  1U8C A;  2I3S A;  4JXM A;  4N14 A;  4BH6 A;  1S4U X;  4LG9 A;  1E5T A;  4JT5 C;  3RLM D;  2IUQ A;  3W15 A;  2HXC A;  4A0A A;  5AMS A;  1UTC A;  4FAV D;  2H3X A;  2VDP A;  1C9I A;  4WJK A;  4AX4 A;  3BG1 A;  2MTA H;  2VDN A;  2YBA A;  5HE0 B;  4ESG A;  2HJ4 A;  1E8M A;  4MK0 B;  4CY5 A;  3CFS B;  1VE7 A;  3AL8 A;  4XYI A;  3ZDX A;  3JZN A;  4NEN A;  1JMX B;  1L5G A;  3ZE1 A;  4GQ2 P;  5FKS A;  1K3I A;  4JSN C;  1K8K C;  4J87 A;  5FKQ A;  3FM0 A;  5C2V B;  1NEX B;  1JMZ B;  2PM7 B;  1VZ2 A;  4MMX A;  2J55 H;  3IUR A;  4GZ8 A;  1GOT B;  4AN1 A;  4AN0 A;  2P9I C;  1QNI A;  5HQG A;  2B5M A;  3V5W B;  4CI1 A;  3UKU C;  3PXW D;  4J86 A;  3OKT A;  2QZP A;  3F3F A;  1UOQ A;  3GRE A;  3MZK A;  4JSV C;  2H9P A;  1JV2 A;  5E6R A;  3JPX A;  5HYN B;  5IJ8 E;  5M5V A;  1C9L A;  3ODT A;  4HDJ A;  3SVW D;  5GXH A;  2VDR A;  5CXC B;  1H2Z A;  2VZ3 A;  5CXC A;  2BCJ B;  2IAA A;  2Z2O A;  3EQ8 A;  4XEI C;  3EI1 A;  3NVX A;  4OWR A;  4WK2 A;  2AQ5 A;  2B5L A;  2EBS A;  2OVP B;  3I7P A;  1GOG A;  4BP9 A;  2H68 A;  3OKY A;  3MVD K;  3T3P A;  2HU5 A;  5GMK n;  4E5Z B;  4IRZ A;  5TDH B;  4ZOV A;  5EMM B;  2VC2 A;  4BCC A;  3NID A;  3AFC A;  4A11 B;  3UVN A;  1A0R B;  1QFM A;  1M1X A;  5IC7 A;  2P9N C;  5I5I A;  3C5M A;  2I0R A;  2OVQ B;  3EI4 B;  2CO0 C;  4AEZ A;  2VDL A;  3QI0 A;  2VZ1 A;  4TZ4 A;  4AMZ A;  3HFQ A;  3IIW A;  4J84 A;  3B7F A;  4OZU A;  3AL9 A;  3SJL D;  1E8N A;  3SBR A;  2AGW A;  4K3I D;  5HE3 B;  3EI2 B;  4ERY A;  4CY1 A;  4Y5R D;  2TRC B;  4GM9 A;  5CXB A;  4J0W A;  4FAN D;  4L1Q D;  3DM0 A;  4A09 B;  4U7A A;  2GC7 A;  4X3E A;  3CIK B;  1N6D A;  5E6U A;  3K26 A;  5TF2 A;  1VYH C;  2Z2N A;  5I5J A;  2CE9 A;  4FA9 D;  4A0B A;  1N6F A;  2EIC A;  4JHN A;  2O9K A;  3IUQ A;  4QQE A;  2H14 A;  5M5S A;  5H14 A;  5CYK B;  2JKX A;  1T2X A;  2AH0 A;  3ULE C;  1Q47 A;  3L4M D;  3MUO A;  3C75 H;  4KFM B;  4DNU A;  2AGX A;  4G56 B;  4PNK B;  4Y7R A;  1SHY B;  3EWE A;  1TBG A;  5FXY A;  2GC4 A;  3F3G A;  3GC3 B;  4J8G A;  2H9L A;  3N0D A;  4J0X A;  3RRM C;  4BP8 A;  4Z8L A;  5GXI A;  3IUJ A;  2BKL A;  1N6E A;  3SFZ A;  4A0A B;  4E54 B;  3PE7 A;  2W18 A;  3I89 A;  5KDO B;  4IMM A;  1NR0 A;  5IT9 g;  4ZN4 A;  1O6F A;  2G99 A;  3AL8 B;  1GG2 B;  3NIG A;  3UVO A;  5K19 A;  2QR5 A;  3EMH A;  3SLE D;  1H2Y A;  3OKY B;  3AH8 B;  5AJA A;  4Z7N A;  2B4E A;  2HJB A;  3V7D B;  2PBI B;  4O9D A;  2PM6 B;  3IKO A;  4LGN A;  5HE2 B;  1GOF A;  3IJ0 A;  2HES X;  2BBK H;  3OF7 A;  3OL2 A;  4H5I A;  4L1M A;  4PSX B;  1YR2 A;  3OL2 B;  4GMB A;  4J8B A;  3RN0 D;  3K6S A;  4YVD A;  5EMK B;  3JZH A;  5C86 A;  3IIY A;  3PXS D;  2HKR A;  4NAA A;  1JTD B;  3PVW B;  3ZDZ A;  4GGA A;  3O4G A;  2OJY A;  5A2Q g;  4FA1 D;  1PEV A;  3I7O A;  5C2W B;  3J80 g;  1SQ9 A;  4JT6 C;  4X61 B;  2VDM A;  4G1E A;  3RMZ D;  2IWK A;  2CN3 A;  5EAL A;  3EI1 B;  2EIB A;  3CFV A;  3GFC A;  3JRO A;  4H5J A;  4WK4 A;  5EM2 A;  4A08 A;  4EWR A;  3JB9 L;  4UI9 R;  4MMY A;  3PSL A;  5K1C C;  2B5N A;  2HU7 A;  1BPO A;  4A7J A;  4AMY A;  2J56 H;  2Z2P A;  2IUP A;  2H6N A;  4NC4 A;  4J81 A;  2I0S A;  3O4J A;  2EIE A;  3SBQ A;  5CYK A;  4UM8 A;  3SBP A;  1MDA H;  4GQB B;  3NIF A;  3I7K A;  1R5M A;  3EG6 A;  4BL0 A;  3JZG A;  4DNW A;  4O02 A;  1XHM A;  2AGY A;  3V4V A;  2P9P C;  3MMY A;  3BWS A;  2AGL A;  2XU7 A;  3J81 g;  4O3T B;  1FWX A;  3UKR C;  1A12 A;  4FHL A;  3MUN A;  2UZY B;  3PVU B;  4IA9 A;  4E5Z A;  1GP2 B;  3EQ7 A;  5IGO A;  4A09 A;  5H1M A;  5TEE A;  2OK4 A;  4O3U B;  1L0Q A;  5B4W A;  4CZX A;  4J79 A;  4A0B B;  5EAR A;  2EID A;  3RFH A;  3EI4 A;  3DXM C;  4O1Q D;  1XIP A;  2XL3 A;  3OW8 A;  4R7A B;  3EQ9 A;  2J57 G;  3FGB A;  1B9Y A;  5FA5 B;  4RE6 A;  5EMJ B;  4LG8 A;  2H9M A;  3ZWL B;  3EI3 A;  2YNN A;  3EI2 A;  3P4F A;  4G55 A;  2I3T A;  4QAM A;  4Z7O A;  4FA5 D;  2H13 A;  2OVR B;  2H9N A;  2YNO A;  4GGC A;  1UOO A;  2YB8 B;  3SN6 B;  1JOF A;  3BG0 A;  4CY2 A;  3FRX A;  3K27 A;  3V4P A;  2YNP A;  3PXT D;  5EAM A;  2H47 A;  4J78 A;  3VGZ A;  4D6V A;  1PBY B;  3MKS B;  3SMR A;  5FLX g;  3C99 A;  3FCU A;  2VDQ A;  3ZE2 A;  3VH0 A;  1TYQ C;  3NVQ A;  4CI8 A;  2PM9 B;  1U4C A;  3MKQ A;  5HE1 B;  1PGU A;  4J82 A;  2HKM A;  1TYE A;  2PM9 A;  1P22 A;  4GM3 A;  4NSX A;  3C9C A;  1PI6 A;  4FWW A;  3SHF A;  2OIZ A;  1OMW B;  2P9L C;  2H6Q A;  3MXX A;  3SCY A;  4FA4 D;  4L3H D;  3IUL A;  2CO0 A;  4BCB A;  3U4Y A;  3FCS A;  3UVL A;  3RSE C;  2XZG A;  2CNX A;  4K3J B;  2P9S C;  3UVM A;  5M5U A;  5FQD A;  1VZ3 A;  2UZX B;  1UOP A;  5THA A;  3IVM A;  3K72 A;  4MMZ A;  3V9F A;  3F3P A;  4GGD A;  3EU7 A;  5M5R A;  3SXT D;  5SXM A;  1H2X A;  2IUV A;  4FB1 D;  4PSW B;  3K71 A;  2P9U C;  4QT8 A;  2H6K A;  4BUJ C;  5IJ7 E;  5JWZ A;  2Q7Q A;  3GD1 I;  3E0C A;  4AOW A; 
#chains in the Genus database with same CATH homology
 3FCS A;  3VI3 A;  1U8C A;  1M1X A;  5FFG A;  4Z7O A;  4Z7N A;  2VDM A;  4G1E A;  5E6U A;  4MMX A;  5FFO A;  4UM8 A;  3VI4 A;  3ZDY A;  4WK2 A;  3V4P A;  4UM9 A;  5E6S A;  3NIF A;  4WK4 A;  3ZE0 A;  2VDL A;  3FCU A;  2VDQ A;  3ZE2 A;  2VDP A;  4MMY A;  3K72 A;  3IJE A;  4MMZ A;  4WJK A;  4WK0 A;  2VDN A;  4O02 A;  1TYE A;  3T3P A;  3K6S A;  3V4V A;  4IRZ A;  3K71 A;  3ZDZ A;  2VDK A;  3T3M A;  1JV2 A;  3ZDX A;  2VC2 A;  4G1M A;  4NEN A;  5E6R A;  5HDB A;  4Z7Q A;  3NID A;  1L5G A;  3NIG A;  3ZE1 A;  2VDR A;  2VDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...