3ZE2A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze2A00
4UM8A 3ZDZA 3ZDYA 4WK4A 5HDBA 5FFGA 3NIGA 3ZE2A 2VDNA 3T3PA 3VI4A 5E6RA 1TYEA 1U8CA 4O02A 4NENA 3FCUA 3IJEA 1JV2A 4MMZA 1L5GA 3NIDA 1M1XA 2VDOA 4MMYA 2VDMA 2VDKA 4Z7QA 4Z7NA 4IRZA 3K72A 4Z7OA 3VI3A 2VC2A 2VDQA 4G1EA 4G1MA 4MMXA 5E6UA 3T3MA 3K71A 2VDLA 4UM9A 4WJKA 3K6SA 2VDRA 3ZE0A 3ZDXA 3V4PA 3V4VA 4WK0A 3FCSA 2VDPA 4WK2A 5FFOA 3ZE1A 3NIFA 5E6SA
chains in the Genus database with same CATH superfamily
3IUMA 4JT5C 2IUVA 4WK4A 1YFQA 2EICA 4E54A 1JJUB 4E54B 4BL0A 3MUNA 3JPXA 4GM9A 2JKXA 4CZVA 1MDAH 2YNOA 3PXWD 4ERZA 2Z2PA 3F3FA 3DDUA 4CI3A 5IJ7E 3V9FA 3PSCB 1BPOA 1GG2B 1JTDB 2VC2A 3RFGA 2IWKA 2OVQB 4O45A 4CY2A 4DNWA 2BCJB 4ERQA 1T2XA 2PM6B 3CFSB 4XEIC 3EI4A 2Z2OA 2CE9A 1PGUA 3C9CA 3IVMA 5I5IA 3EI4B 4KFMB 3I7LA 3I7HA 2CE8A 3NVNA 5E6RA 2IUPA 2IURA 3EU7A 1PI6A 3IJCA 3FCUA 4QQEA 4CY5A 3JZHA 1ERJA 2VDMA 5CYKA 5EARA 2H6KA 2OK6A 5CYKB 3UVLA 4Y7RA 4AMYA 2XE4A 5B4WA 3B7FA 4O9DA 1MG2A 5HQGA 3GREA 3IJ0A 3K26A 5FLXg 5TDHB 3K6SA 3ZDXA 3V4PA 2VDPA 2P9SC 1VZ2A 3ZDZA 4AX4A 2OVRB 4XYHA 4BH6A 5IT9g 5A2Qg 4O02A 3C99A 4O3TB 3QHYB 3MMYA 4ZOVA 3O4HA 1GOFA 4D9SA 3SBRA 1GOGA 4ZN4A 5CXBB 1H2ZA 2H68A 3FGBA 4WJKA 4CY1A 5EMLB 5E6SA 1E8NA 3PVUB 2CO0A 3OTTA 3MKQA 1XHMA 1VYHC 3SBPA 1QFSA 3DXMC 3UVNA 3SVWD 3NVQA 3KRWB 1RI6A 5EMKB 4FHLA 5FQDA 4JHNA 1M1XA 2HESX 3GD1I 4J81A 2G9AA 1JMXB 4TZ4A 3SFZA 4GQBB 1FWXA 3DXKC 2AGLA 4K3ID 2QXVA 5EAPA 5FKTA 3O4IA 3FM0A 3GC3B 3AL8A 3JRPA 4QRJA 5E6UA 3RN1D 3CFVA 3AL8B 2VDRA 1E5TA 1SHYB 1SQJA 4JT6C 4J78A 2XL3A 4BCDA 5HE1B 1UOQA 3ZDYA 4BP9A 3IUQA 1H2YA 1GXRA 2J56H 4A0AB 5IGOA 2QC5A 1SQ9A 5AJAA 4D0KA 1VE7A 3DSMA 5TEEA 5GMKn 3AH8B 3AL9A 4J86A 5THAA 2GC4A 2HJBA 4J87A 2H9PA 3V7DB 5HE3B 5IGQA 4ERYA 3EI2A 2BKLA 2EIEA 4GM8A 3EI2B 4X63B 3KRXB 3ZE0A 4CI1A 4CZXA 2HU7A 3NIFA 5K1CC 2AGXA 2IWFA 1S4UX 4OZUA 3IIWA 3KCIA 1UOOA 3EWEA 5HE2B 3JZNA 3HFQA 4EWRA 3U4YA 4Z7NA 2OK4A 4LG9A 5EMMB 3VA6A 2YBAA 2H9LA 2EIDA 2AGZA 3OKTA 4BP8A 4GGCA 4A08A 1I2MB 1P22A 3MZKA 4J73A 4NAAA 3V4VA 4CI2A 4A08B 3I8CA 4UM8A 2EBSA 2TRCB 2VZ1A 3FRXA 5HYNB 3SBQA 1E8MA 3IIYA 3JAMg 1GP2B 2H6QA 3VH0A 4LGNA 4ESGA 2J55H 5TEFA 3RSEC 5HE0B 4Z7QA 5KDOB 4A11A 4IRZA 3MUOA 1K32A 3OW8A 2AGYA 2P9LC 2VDQA 4O2WA 4BUJC 4J8BA 5EMJB 5FA5B 3E0CA 1VZ3A 1UTCA 3N0DA 2EIBA 3PXTD 3EI1A 4IA9A 4N14A 5FFOA 1QFMA 4HDJA 3EI1B 5HDBA 4E5ZA 3ZE2A 2VDNA 1PBYB 4E5ZB 4OWRA 3I2NA 4JSXC 3RFHA 2B5LA 2QR5A 1XIPA 4D6VA 4AN0A 2H9MA 1O6FA 2OJYA 5C9ZB 4PXWA 3UVOA 2QZPA 4IMMA 2PBIB 3L4OD 4QAMA 2HKRA 3T3MA 4PBYA 3CIKB 5CXCA 4K3JB 2HU5A 3P4FA 2OIZA 5CXCB 3I7NA 3EQ7A 4JSPC 5SXMA 4L3GD 4YVDA 1NEXB 2HXCA 4U1EI 2AGWA 2UZXB 3EQ9A 4JHPC 4ES0A 4L1QD 5EM2A 1Q47A 5EM2B 3W15A 4Z7OA 1UOPA 5M5RA 4CI8A 3C75H 4G1EA 2I0SA 2XU7A 3SLED 4UM9A 3PXSD 5M61A 2VZ3A 2H47A 2CNXA 1K3IA 3I7OA 4WK0A 3ZE1A 1C9LA 2Z2NA 4JD2C 2HYEA 3PSLA 4O1QD 4BCBA 4A7JA 3SMRA 4PSWB 4FAND 3SXTD 4NENA 1L5GA 2Q7QA 4NBMA 3SHFA 3EQ8A 3ZWLB 4FB1D 3MXXA 2YB8B 4A0BA 2P9KC 2YNPA 3I7PA 4RE6A 4RE5A 4U7AA 5FKRA 4X61B 1H2WA 3SWSD 1PEVA 4X3EA 3UKRC 4AEZA 5IJ8E 4FAVD 3IJ1A 3ODTA 4QT8A 1O6GA 4X60B 1A0RB 1JMZB 2XYIA 3OF7A 1C9IA 5M5VA 2CN2A 5FKQA 3JZGA 1B9YA 1TYEA 3IJEA 2H14A 2XZGA 2B5MA 4GQ2P 3MZLA 2I3SA 2H6NA 4L3HD 3V5WB 2AH1A 3MVDK 3QI0A 3PE7A 5GXIA 3EI3A 3VI3A 4GMBA 2P9IC 2IUQA 5AMSA 1MG3A 4H5IA 3I8EA 4XYIA 4L9OA 3EI3B 2H13A 4A09A 1XKSA 5TF2A 1A12A 5AFU3 2HJ4A 3NVXA 4A09B 3UVKA 1TBGA 3UKUC 2GNQA 2P9PC 1R5MA 4J79A 1H2XA 2PM7B 2GC7A 4J8GA 3OKYA 2H9NA 2OVPB 4I79A 5FFGA 3OKYB 2AH0A 2MTAH 3O4JA 3F3GA 2H3XA 4UI9R 1GOHA 3RN0D 3NIDA 2XL2A 5H1MA 2HU8A 3BG1A 2G99A 2IAAA 3K72A 5IC7A 5C92A 2P9NC 4A11B 5EALA 4MMXA 3K71A 4GZ8A 3IUNA 1B9XA 1TYQC 5M5TA 2CN3A 3RLMD 3FCSA 4GM3A 1N6DA 2I0TA 4BCCA 2YMUA 4NSXA 4CY3A 3I89A 1VE6A 4NC4A 1L0QA 4CC9A 4JSVC 5GSAA 2VDKA 3BG0A 4DNVA 3ORVD 4J0XA 4J84A 4FA9D 5H17A 4AN1A 1U4CA 3J80g 3DWLC 3OKWA 4WK2A 4GGAA 3F3PA 4G1MA 4FWWA 3K27A 2I0RA 3MKSB 2PM9A 3AFCA 2PM9B 1OLZA 4MMZA 3EG6A 4LG8A 2O9KA 3SN6B 4MMYA 1K8KC 4PSXB 2BBKH 3IULA 3OL2A 4J0WA 4O3UB 5EAMA 4QL1A 5FXYA 5CXBA 3C5MA 3OL2B 3EMHA 2WQ8A 5C2VB 4J82A 3JB9L 4AOWA 3VGZA 2I3TA 5M5SA 3BWSA 4H5JA 5C2WB 1JOFA 2YNNA 4G56B 3UVMA 3RMZD 3DM0A 2J57G 3L4MD 3PVWB 3NIGA 3T3PA 5M5UA 4L1MA 4J77A 2CO0C 4GQ1A 4PC0A 3A0FA 2W18A 4JSNC 3UR4A 2UZYB 1JV2A 4MK0B 5JWZA 3IKOA 5I5MA 2HKMA 4A2MA 4FA5D 1NR0A 1N6EA 5I5JA 2B5NA 3RRMC 5GXHA 3SCYA 2P9UC 5K19A 4A0BB 1GOTB 3I7KA 3IUJA 2VDLA 5FKSA 4A2LA 4FA1D 4ZOXA 5C86A 1U2VC 4FA4D 3O4GA 3IURA 3JROA 1YR2A 4A0AA 4GGDA 4JXMA 4ZOZA 1OMWB 4PNKB 3J81g 1U8CA 4DNUA 2AQ5A 1N6FA 4R7AB 2XDWA 3N0EA 4PBZA 2VDOA 4G55A 4Y5RD 4ZOYA 4Z8LA 4CZYA 1QNIA 3GFCA 2B4EA 4AMZA 3VI4A 3ULEC 3SJLD 5H14A
chains in the Genus database with same CATH topology
4UM8A 3ZDZA 3ZDYA 4WK4A 5HDBA 5FFGA 3NIGA 3ZE2A 2VDNA 3T3PA 3VI4A 5E6RA 1TYEA 1U8CA 4O02A 4NENA 3FCUA 3IJEA 1JV2A 4MMZA 1L5GA 3NIDA 1M1XA 2VDOA 4MMYA 2VDMA 2VDKA 4Z7QA 4Z7NA 4IRZA 3K72A 4Z7OA 3VI3A 2VC2A 2VDQA 4G1EA 4G1MA 4MMXA 5E6UA 3T3MA 3K71A 2VDLA 4UM9A 4WJKA 3K6SA 2VDRA 3ZE0A 3ZDXA 3V4PA 3V4VA 4WK0A 3FCSA 2VDPA 4WK2A 5FFOA 3ZE1A 3NIFA 5E6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM8 A;  3ZDZ A;  3ZDY A;  4WK4 A;  5HDB A;  5FFG A;  3NIG A;  3ZE2 A;  2VDN A;  3T3P A;  3VI4 A;  5E6R A;  1TYE A;  1U8C A;  4O02 A;  4NEN A;  3FCU A;  3IJE A;  1JV2 A;  4MMZ A;  1L5G A;  3NID A;  1M1X A;  2VDO A;  4MMY A;  2VDM A;  2VDK A;  4Z7Q A;  4Z7N A;  4IRZ A;  3K72 A;  4Z7O A;  3VI3 A;  2VC2 A;  2VDQ A;  4G1E A;  4G1M A;  4MMX A;  5E6U A;  3T3M A;  3K71 A;  2VDL A;  4UM9 A;  4WJK A;  3K6S A;  2VDR A;  3ZE0 A;  3ZDX A;  3V4P A;  3V4V A;  4WK0 A;  3FCS A;  2VDP A;  4WK2 A;  5FFO A;  3ZE1 A;  3NIF A;  5E6S A; 
#chains in the Genus database with same CATH topology
 3IUM A;  4JT5 C;  2IUV A;  4WK4 A;  1YFQ A;  2EIC A;  4E54 A;  1JJU B;  4E54 B;  4BL0 A;  3MUN A;  3JPX A;  4GM9 A;  2JKX A;  4CZV A;  1MDA H;  2YNO A;  3PXW D;  4ERZ A;  2Z2P A;  3F3F A;  3DDU A;  4CI3 A;  5IJ7 E;  3V9F A;  3PSC B;  1BPO A;  1GG2 B;  1JTD B;  2VC2 A;  3RFG A;  2IWK A;  2OVQ B;  4O45 A;  4CY2 A;  4DNW A;  2BCJ B;  4ERQ A;  1T2X A;  2PM6 B;  3CFS B;  4XEI C;  3EI4 A;  2Z2O A;  2CE9 A;  1PGU A;  3C9C A;  3IVM A;  5I5I A;  3EI4 B;  4KFM B;  3I7L A;  3I7H A;  2CE8 A;  3NVN A;  5E6R A;  2IUP A;  2IUR A;  3EU7 A;  1PI6 A;  3IJC A;  3FCU A;  4QQE A;  4CY5 A;  3JZH A;  1ERJ A;  2VDM A;  5CYK A;  5EAR A;  2H6K A;  2OK6 A;  5CYK B;  3UVL A;  4Y7R A;  4AMY A;  2XE4 A;  5B4W A;  3B7F A;  4O9D A;  1MG2 A;  5HQG A;  3GRE A;  3IJ0 A;  3K26 A;  5FLX g;  5TDH B;  3K6S A;  3ZDX A;  3V4P A;  2VDP A;  2P9S C;  1VZ2 A;  3ZDZ A;  4AX4 A;  2OVR B;  4XYH A;  4BH6 A;  5IT9 g;  5A2Q g;  4O02 A;  3C99 A;  4O3T B;  3QHY B;  3MMY A;  4ZOV A;  3O4H A;  1GOF A;  4D9S A;  3SBR A;  1GOG A;  4ZN4 A;  5CXB B;  1H2Z A;  2H68 A;  3FGB A;  4WJK A;  4CY1 A;  5EML B;  5E6S A;  1E8N A;  3PVU B;  2CO0 A;  3OTT A;  3MKQ A;  1XHM A;  1VYH C;  3SBP A;  1QFS A;  3DXM C;  3UVN A;  3SVW D;  3NVQ A;  3KRW B;  1RI6 A;  5EMK B;  4FHL A;  5FQD A;  4JHN A;  1M1X A;  2HES X;  3GD1 I;  4J81 A;  2G9A A;  1JMX B;  4TZ4 A;  3SFZ A;  4GQB B;  1FWX A;  3DXK C;  2AGL A;  4K3I D;  2QXV A;  5EAP A;  5FKT A;  3O4I A;  3FM0 A;  3GC3 B;  3AL8 A;  3JRP A;  4QRJ A;  5E6U A;  3RN1 D;  3CFV A;  3AL8 B;  2VDR A;  1E5T A;  1SHY B;  1SQJ A;  4JT6 C;  4J78 A;  2XL3 A;  4BCD A;  5HE1 B;  1UOQ A;  3ZDY A;  4BP9 A;  3IUQ A;  1H2Y A;  1GXR A;  2J56 H;  4A0A B;  5IGO A;  2QC5 A;  1SQ9 A;  5AJA A;  4D0K A;  1VE7 A;  3DSM A;  5TEE A;  5GMK n;  3AH8 B;  3AL9 A;  4J86 A;  5THA A;  2GC4 A;  2HJB A;  4J87 A;  2H9P A;  3V7D B;  5HE3 B;  5IGQ A;  4ERY A;  3EI2 A;  2BKL A;  2EIE A;  4GM8 A;  3EI2 B;  4X63 B;  3KRX B;  3ZE0 A;  4CI1 A;  4CZX A;  2HU7 A;  3NIF A;  5K1C C;  2AGX A;  2IWF A;  1S4U X;  4OZU A;  3IIW A;  3KCI A;  1UOO A;  3EWE A;  5HE2 B;  3JZN A;  3HFQ A;  4EWR A;  3U4Y A;  4Z7N A;  2OK4 A;  4LG9 A;  5EMM B;  3VA6 A;  2YBA A;  2H9L A;  2EID A;  2AGZ A;  3OKT A;  4BP8 A;  4GGC A;  4A08 A;  1I2M B;  1P22 A;  3MZK A;  4J73 A;  4NAA A;  3V4V A;  4CI2 A;  4A08 B;  3I8C A;  4UM8 A;  2EBS A;  2TRC B;  2VZ1 A;  3FRX A;  5HYN B;  3SBQ A;  1E8M A;  3IIY A;  3JAM g;  1GP2 B;  2H6Q A;  3VH0 A;  4LGN A;  4ESG A;  2J55 H;  5TEF A;  3RSE C;  5HE0 B;  4Z7Q A;  5KDO B;  4A11 A;  4IRZ A;  3MUO A;  1K32 A;  3OW8 A;  2AGY A;  2P9L C;  2VDQ A;  4O2W A;  4BUJ C;  4J8B A;  5EMJ B;  5FA5 B;  3E0C A;  1VZ3 A;  1UTC A;  3N0D A;  2EIB A;  3PXT D;  3EI1 A;  4IA9 A;  4N14 A;  5FFO A;  1QFM A;  4HDJ A;  3EI1 B;  5HDB A;  4E5Z A;  3ZE2 A;  2VDN A;  1PBY B;  4E5Z B;  4OWR A;  3I2N A;  4JSX C;  3RFH A;  2B5L A;  2QR5 A;  1XIP A;  4D6V A;  4AN0 A;  2H9M A;  1O6F A;  2OJY A;  5C9Z B;  4PXW A;  3UVO A;  2QZP A;  4IMM A;  2PBI B;  3L4O D;  4QAM A;  2HKR A;  3T3M A;  4PBY A;  3CIK B;  5CXC A;  4K3J B;  2HU5 A;  3P4F A;  2OIZ A;  5CXC B;  3I7N A;  3EQ7 A;  4JSP C;  5SXM A;  4L3G D;  4YVD A;  1NEX B;  2HXC A;  4U1E I;  2AGW A;  2UZX B;  3EQ9 A;  4JHP C;  4ES0 A;  4L1Q D;  5EM2 A;  1Q47 A;  5EM2 B;  3W15 A;  4Z7O A;  1UOP A;  5M5R A;  4CI8 A;  3C75 H;  4G1E A;  2I0S A;  2XU7 A;  3SLE D;  4UM9 A;  3PXS D;  5M61 A;  2VZ3 A;  2H47 A;  2CNX A;  1K3I A;  3I7O A;  4WK0 A;  3ZE1 A;  1C9L A;  2Z2N A;  4JD2 C;  2HYE A;  3PSL A;  4O1Q D;  4BCB A;  4A7J A;  3SMR A;  4PSW B;  4FAN D;  3SXT D;  4NEN A;  1L5G A;  2Q7Q A;  4NBM A;  3SHF A;  3EQ8 A;  3ZWL B;  4FB1 D;  3MXX A;  2YB8 B;  4A0B A;  2P9K C;  2YNP A;  3I7P A;  4RE6 A;  4RE5 A;  4U7A A;  5FKR A;  4X61 B;  1H2W A;  3SWS D;  1PEV A;  4X3E A;  3UKR C;  4AEZ A;  5IJ8 E;  4FAV D;  3IJ1 A;  3ODT A;  4QT8 A;  1O6G A;  4X60 B;  1A0R B;  1JMZ B;  2XYI A;  3OF7 A;  1C9I A;  5M5V A;  2CN2 A;  5FKQ A;  3JZG A;  1B9Y A;  1TYE A;  3IJE A;  2H14 A;  2XZG A;  2B5M A;  4GQ2 P;  3MZL A;  2I3S A;  2H6N A;  4L3H D;  3V5W B;  2AH1 A;  3MVD K;  3QI0 A;  3PE7 A;  5GXI A;  3EI3 A;  3VI3 A;  4GMB A;  2P9I C;  2IUQ A;  5AMS A;  1MG3 A;  4H5I A;  3I8E A;  4XYI A;  4L9O A;  3EI3 B;  2H13 A;  4A09 A;  1XKS A;  5TF2 A;  1A12 A;  5AFU 3;  2HJ4 A;  3NVX A;  4A09 B;  3UVK A;  1TBG A;  3UKU C;  2GNQ A;  2P9P C;  1R5M A;  4J79 A;  1H2X A;  2PM7 B;  2GC7 A;  4J8G A;  3OKY A;  2H9N A;  2OVP B;  4I79 A;  5FFG A;  3OKY B;  2AH0 A;  2MTA H;  3O4J A;  3F3G A;  2H3X A;  4UI9 R;  1GOH A;  3RN0 D;  3NID A;  2XL2 A;  5H1M A;  2HU8 A;  3BG1 A;  2G99 A;  2IAA A;  3K72 A;  5IC7 A;  5C92 A;  2P9N C;  4A11 B;  5EAL A;  4MMX A;  3K71 A;  4GZ8 A;  3IUN A;  1B9X A;  1TYQ C;  5M5T A;  2CN3 A;  3RLM D;  3FCS A;  4GM3 A;  1N6D A;  2I0T A;  4BCC A;  2YMU A;  4NSX A;  4CY3 A;  3I89 A;  1VE6 A;  4NC4 A;  1L0Q A;  4CC9 A;  4JSV C;  5GSA A;  2VDK A;  3BG0 A;  4DNV A;  3ORV D;  4J0X A;  4J84 A;  4FA9 D;  5H17 A;  4AN1 A;  1U4C A;  3J80 g;  3DWL C;  3OKW A;  4WK2 A;  4GGA A;  3F3P A;  4G1M A;  4FWW A;  3K27 A;  2I0R A;  3MKS B;  2PM9 A;  3AFC A;  2PM9 B;  1OLZ A;  4MMZ A;  3EG6 A;  4LG8 A;  2O9K A;  3SN6 B;  4MMY A;  1K8K C;  4PSX B;  2BBK H;  3IUL A;  3OL2 A;  4J0W A;  4O3U B;  5EAM A;  4QL1 A;  5FXY A;  5CXB A;  3C5M A;  3OL2 B;  3EMH A;  2WQ8 A;  5C2V B;  4J82 A;  3JB9 L;  4AOW A;  3VGZ A;  2I3T A;  5M5S A;  3BWS A;  4H5J A;  5C2W B;  1JOF A;  2YNN A;  4G56 B;  3UVM A;  3RMZ D;  3DM0 A;  2J57 G;  3L4M D;  3PVW B;  3NIG A;  3T3P A;  5M5U A;  4L1M A;  4J77 A;  2CO0 C;  4GQ1 A;  4PC0 A;  3A0F A;  2W18 A;  4JSN C;  3UR4 A;  2UZY B;  1JV2 A;  4MK0 B;  5JWZ A;  3IKO A;  5I5M A;  2HKM A;  4A2M A;  4FA5 D;  1NR0 A;  1N6E A;  5I5J A;  2B5N A;  3RRM C;  5GXH A;  3SCY A;  2P9U C;  5K19 A;  4A0B B;  1GOT B;  3I7K A;  3IUJ A;  2VDL A;  5FKS A;  4A2L A;  4FA1 D;  4ZOX A;  5C86 A;  1U2V C;  4FA4 D;  3O4G A;  3IUR A;  3JRO A;  1YR2 A;  4A0A A;  4GGD A;  4JXM A;  4ZOZ A;  1OMW B;  4PNK B;  3J81 g;  1U8C A;  4DNU A;  2AQ5 A;  1N6F A;  4R7A B;  2XDW A;  3N0E A;  4PBZ A;  2VDO A;  4G55 A;  4Y5R D;  4ZOY A;  4Z8L A;  4CZY A;  1QNI A;  3GFC A;  2B4E A;  4AMZ A;  3VI4 A;  3ULE C;  3SJL D;  5H14 A; 
#chains in the Genus database with same CATH homology
 4UM8 A;  3ZDZ A;  3ZDY A;  4WK4 A;  5HDB A;  5FFG A;  3NIG A;  3ZE2 A;  2VDN A;  3T3P A;  3VI4 A;  5E6R A;  1TYE A;  1U8C A;  4O02 A;  4NEN A;  3FCU A;  3IJE A;  1JV2 A;  4MMZ A;  1L5G A;  3NID A;  1M1X A;  2VDO A;  4MMY A;  2VDM A;  2VDK A;  4Z7Q A;  4Z7N A;  4IRZ A;  3K72 A;  4Z7O A;  3VI3 A;  2VC2 A;  2VDQ A;  4G1E A;  4G1M A;  4MMX A;  5E6U A;  3T3M A;  3K71 A;  2VDL A;  4UM9 A;  4WJK A;  3K6S A;  2VDR A;  3ZE0 A;  3ZDX A;  3V4P A;  3V4V A;  4WK0 A;  3FCS A;  2VDP A;  4WK2 A;  5FFO A;  3ZE1 A;  3NIF A;  5E6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...