3ZE2A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze2A00
3T3MA 4G1EA 4MMYA 5E6RA 4MMXA 5FFOA 3ZE1A 3K6SA 1U8CA 4UM8A 3ZE2A 1JV2A 3ZDYA 2VDMA 4Z7OA 5HDBA 1TYEA 3V4PA 2VC2A 4O02A 3FCUA 3V4VA 3ZE0A 5FFGA 2VDNA 2VDLA 3IJEA 4UM9A 3VI4A 3NIGA 3FCSA 4WK2A 2VDPA 3ZDZA 4WJKA 4NENA 5E6SA 2VDRA 4WK4A 4IRZA 3T3PA 2VDKA 5E6UA 4G1MA 2VDOA 1M1XA 3K71A 1L5GA 3NIFA 4Z7NA 3K72A 4Z7QA 3ZDXA 4MMZA 3VI3A 3NIDA 4WK0A 2VDQA
chains in the Genus database with same CATH superfamily
3C99A 1U2VC 4KFMB 4NBMA 2O9KA 3PSCB 2Z2NA 4G55A 2J56H 2HKRA 5FA5B 4GQ1A 1Q47A 5CXBA 2AGYA 1UTCA 3FCSA 4PC0A 4J81A 4K3JB 5HE3B 3RN1D 2YNPA 1P22A 5IJ8E 4J8GA 3AL8B 3SCYA 4A2MA 2H3XA 1PI6A 3NIFA 1XIPA 4AN1A 4MMZA 4ESGA 3JROA 1O6GA 2P9SC 4G1EA 2OVPB 2I3TA 2CE8A 3MZLA 2OK4A 2B4EA 3JZHA 3IULA 4HDJA 1GOFA 2H68A 3FCUA 2B5LA 5A2Qg 3MXXA 2VDLA 2J57G 4A11A 3IJEA 4EWRA 2TRCB 3E0CA 2AH1A 1GOTB 4IRZA 3OW8A 5GSAA 4CZYA 3I89A 1PGUA 1RI6A 1JJUB 5I5IA 2H6QA 2H14A 4ES0A 3VI3A 3NIDA 5FQDA 4BH6A 3PXWD 2HJ4A 2XU7A 3EI3A 1PEVA 3MKSB 2CO0A 3UVNA 1U8CA 1O6FA 2BBKH 5HDBA 4D0KA 4J0WA 3UKUC 2PBIB 1K3IA 3BWSA 4GZ8A 4IA9A 3ZE0A 5EMKB 4E5ZB 4JHPC 4A0AB 3V5WB 2XDWA 3EI2B 4GMBA 2Z2PA 5FKRA 5EMMB 3ZWLB 2H6NA 2XZGA 4JSXC 2CE9A 2G99A 4FB1D 3ZDXA 4PSWB 5H14A 5HE0B 1QFMA 4ZN4A 2VDQA 3L4MD 3F3FA 4JHNA 3IUJA 2HXCA 4YVDA 5FFOA 3V9FA 5EAMA 3DSMA 3IVMA 3NVXA 4IMMA 4GGCA 3ZDYA 4GGDA 2HESX 2AGZA 3NVNA 3EQ8A 1TBGA 3CFVA 2YMUA 3IURA 4AMYA 3GREA 1YFQA 2CNXA 1JOFA 4WK4A 2AQ5A 4A0BA 1QNIA 3PSLA 4J87A 3T3PA 2CN2A 4O45A 1JMZB 3EMHA 3C5MA 3C9CA 4E54B 3MMYA 5FLXg 3JPXA 3AL9A 4L1QD 4O2WA 4PSXB 3J81g 3PVWB 5CXBB 4JSVC 5CYKB 5IT9g 5EALA 5TF2A 4CY2A 1UOQA 3EI1A 3N0DA 4FAND 4N14A 4J0XA 4UM9A 4E5ZA 5I5JA 3NIGA 5CXCA 3O4HA 2VDPA 1I2MB 4L9OA 1XHMA 3O4IA 4XEIC 4AEZA 2QR5A 1GP2B 3SXTD 5KDOB 3F3PA 2H9NA 5H1MA 3L4OD 5B4WA 3P4FA 4ZOYA 4U1EI 3RFHA 3KRXB 5THAA 3ZE1A 1A12A 1GG2B 4D9SA 1XKSA 1H2YA 3PVUB 1JV2A 5M5RA 2OVQB 2VC2A 3DXKC 1UOPA 5AFU3 5HE2B 4AMZA 1N6FA 3J80g 1E8MA 3ZDZA 5M5VA 1ERJA 2YBAA 2GC4A 3OL2B 4QAMA 1N6EA 4X3EA 4L1MA 5EMLB 1PBYB 4ZOVA 1R5MA 3EI2A 5C9ZB 3VH0A 1VYHC 3I7PA 4CI3A 4A09B 3ORVD 2J55H 4JSNC 3UVOA 3EG6A 2CO0C 2AGWA 2QZPA 2VDMA 1VE7A 2B5NA 4TZ4A 4ERYA 4Y7RA 5CXCB 3IUMA 3I2NA 2JKXA 3I7HA 4LG8A 1FWXA 3F3GA 3IUQA 2EIDA 5M5SA 1SQJA 3JB9L 2P9IC 5C2WB 2VDKA 2IWKA 4H5JA 4FA9D 3K71A 3UVLA 5CYKA 2UZYB 4FA5D 3RRMC 3AH8B 4CI1A 5EARA 4A11B 5IJ7E 3T3MA 4K3ID 2H9LA 3FGBA 4R7AB 3OKTA 3EWEA 5EM2A 5GMKn 4UI9R 2P9KC 1SHYB 2GC7A 4I79A 2IURA 3KCIA 2VDNA 3OL2A 2W18A 5EM2B 2I0RA 4CI2A 3CFSB 3JZGA 3SMRA 2EBSA 4FA4D 1JMXB 3AL8A 5K19A 2I0SA 3MVDK 3QHYB 3RMZD 2GNQA 1M1XA 4Z7QA 4RE5A 2IUQA 4PBZA 2VZ3A 5I5MA 4FAVD 5HYNB 1E8NA 5AMSA 2QC5A 2P9UC 1QFSA 3DDUA 3SWSD 4A0AA 4GQBB 4QL1A 3QI0A 1VZ2A 4O02A 2H9MA 3V4VA 4L3GD 3O4JA 3ULEC 2BKLA 4J78A 1SQ9A 3U4YA 4WJKA 2Q7QA 2XE4A 4BCDA 2IUVA 2VDOA 2PM9A 4CY5A 1OLZA 3MKQA 3EI3B 4NAAA 4U7AA 4Z8LA 3VGZA 5HQGA 4AX4A 4JT5C 4GM3A 5IC7A 4PXWA 1MDAH 4X60B 3UVMA 5M61A 3OKWA 4JXMA 2IUPA 3HFQA 5JWZA 2XL3A 1OMWB 4QRJA 4E54A 3PE7A 3DWLC 4GQ2P 3SBRA 1C9IA 2B5MA 4H5IA 3SFZA 1H2WA 1VZ3A 5FKQA 4A08B 3RN0D 5GXHA 1S4UX 2I0TA 3IJ1A 1T2XA 4DNVA 1GOGA 2P9LC 2H6KA 2OIZA 2I3SA 4DNUA 1H2XA 2HYEA 3OTTA 1GXRA 4CZXA 4MMYA 1K8KC 4GM9A 2XL2A 3K6SA 3RSEC 2MTAH 4PBYA 4J82A 4MK0B 3EI1B 3BG1A 4O3TB 1GOHA 3I7KA 1C9LA 3I8CA 4WK2A 3DXMC 3EI4B 4NC4A 4XYIA 3RFGA 3K27A 5K1CC 4A08A 5FXYA 5IGOA 3SHFA 4A7JA 5FKTA 2YB8B 4OWRA 5M5TA 3BG0A 4A0BB 3UKRC 3OF7A 5FKSA 2WQ8A 2HU7A 3IUNA 3GFCA 3EU7A 2AH0A 4A2LA 4JD2C 1NEXB 3I7NA 1B9XA 4ZOXA 4BCCA 3I8EA 3MUNA 3JRPA 4FA1D 4O9DA 4PNKB 3IJ0A 2BCJB 5M5UA 4BP9A 3KRWB 2H13A 3OKYA 2HKMA 1A0RB 4Y5RD 4CI8A 4ERQA 4O3UB 4Z7NA 2OVRB 3GC3B 5EAPA 3SBPA 3N0EA 4DNWA 3CIKB 2EIEA 3EQ7A 3SN6B 4G56B 4UM8A 2CN3A 4Z7OA 5EMJB 2Z2OA 5FFGA 3IIYA 1K32A 4CY1A 4D6VA 4QQEA 4J84A 1TYQC 2P9PC 2VDRA 1NR0A 3I7OA 1L0QA 5GXIA 4J8BA 4CZVA 3SVWD 5C2VB 2HU5A 4X61B 1L5GA 1BPOA 1MG3A 4LG9A 1UOOA 4WK0A 2AGLA 3I7LA 4BCBA 4CY3A 3PXSD 5E6RA 4NSXA 4OZUA 2H47A 5TEFA 2QXVA 2UZXB 3SJLD 3K26A 4J73A 3UR4A 1B9YA 2YNOA 4AN0A 2HJBA 2EICA 2VZ1A 5HE1B 3O4GA 3EQ9A 1JTDB 5TEEA 3SBQA 3SLED 3MUOA 2P9NC 3ODTA 3EI4A 3NVQA 5SXMA 2YNNA 3VA6A 1E5TA 5IGQA 4ERZA 3FRXA 3GD1I 1MG2A 4J77A 4MMXA 4O1QD 2IAAA 2H9PA 2AGXA 3ZE2A 4RE6A 5AJAA 3RLMD 2PM7B 2OK6A 4A09A 3VI4A 3A0FA 3AFCA 3B7FA 4J86A 4NENA 4L3HD 5E6SA 4BUJC 2IWFA 1H2ZA 4BL0A 4J79A 4BP8A 3JZNA 4LGNA 2PM6B 3V7DB 3K72A 2G9AA 3OKYB 3IKOA 4FHLA 4AOWA 1N6DA 3IJCA 4QT8A 3JAMg 3V4PA 1TYEA 1U4CA 2EIBA 4ZOZA 2HU8A 4X63B 4FWWA 4XYHA 4GM8A 2OJYA 3FM0A 4CC9A 1VE6A 2PM9B 4JT6C 3PXTD 2XYIA 3UVKA 4JSPC 5E6UA 3C75H 4G1MA 5C86A 3W15A 3DM0A 4GGAA 5C92A 5TDHB 3MZKA 5H17A 3IIWA 1YR2A
chains in the Genus database with same CATH topology
3T3MA 4G1EA 4MMYA 5E6RA 4MMXA 5FFOA 3ZE1A 3K6SA 1U8CA 4UM8A 3ZE2A 1JV2A 3ZDYA 2VDMA 4Z7OA 5HDBA 1TYEA 3V4PA 2VC2A 4O02A 3FCUA 3V4VA 3ZE0A 5FFGA 2VDNA 2VDLA 3IJEA 4UM9A 3VI4A 3NIGA 3FCSA 4WK2A 2VDPA 3ZDZA 4WJKA 4NENA 5E6SA 2VDRA 4WK4A 4IRZA 3T3PA 2VDKA 5E6UA 4G1MA 2VDOA 1M1XA 3K71A 1L5GA 3NIFA 4Z7NA 3K72A 4Z7QA 3ZDXA 4MMZA 3VI3A 3NIDA 4WK0A 2VDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3M A;  4G1E A;  4MMY A;  5E6R A;  4MMX A;  5FFO A;  3ZE1 A;  3K6S A;  1U8C A;  4UM8 A;  3ZE2 A;  1JV2 A;  3ZDY A;  2VDM A;  4Z7O A;  5HDB A;  1TYE A;  3V4P A;  2VC2 A;  4O02 A;  3FCU A;  3V4V A;  3ZE0 A;  5FFG A;  2VDN A;  2VDL A;  3IJE A;  4UM9 A;  3VI4 A;  3NIG A;  3FCS A;  4WK2 A;  2VDP A;  3ZDZ A;  4WJK A;  4NEN A;  5E6S A;  2VDR A;  4WK4 A;  4IRZ A;  3T3P A;  2VDK A;  5E6U A;  4G1M A;  2VDO A;  1M1X A;  3K71 A;  1L5G A;  3NIF A;  4Z7N A;  3K72 A;  4Z7Q A;  3ZDX A;  4MMZ A;  3VI3 A;  3NID A;  4WK0 A;  2VDQ A; 
#chains in the Genus database with same CATH topology
 3C99 A;  1U2V C;  4KFM B;  4NBM A;  2O9K A;  3PSC B;  2Z2N A;  4G55 A;  2J56 H;  2HKR A;  5FA5 B;  4GQ1 A;  1Q47 A;  5CXB A;  2AGY A;  1UTC A;  3FCS A;  4PC0 A;  4J81 A;  4K3J B;  5HE3 B;  3RN1 D;  2YNP A;  1P22 A;  5IJ8 E;  4J8G A;  3AL8 B;  3SCY A;  4A2M A;  2H3X A;  1PI6 A;  3NIF A;  1XIP A;  4AN1 A;  4MMZ A;  4ESG A;  3JRO A;  1O6G A;  2P9S C;  4G1E A;  2OVP B;  2I3T A;  2CE8 A;  3MZL A;  2OK4 A;  2B4E A;  3JZH A;  3IUL A;  4HDJ A;  1GOF A;  2H68 A;  3FCU A;  2B5L A;  5A2Q g;  3MXX A;  2VDL A;  2J57 G;  4A11 A;  3IJE A;  4EWR A;  2TRC B;  3E0C A;  2AH1 A;  1GOT B;  4IRZ A;  3OW8 A;  5GSA A;  4CZY A;  3I89 A;  1PGU A;  1RI6 A;  1JJU B;  5I5I A;  2H6Q A;  2H14 A;  4ES0 A;  3VI3 A;  3NID A;  5FQD A;  4BH6 A;  3PXW D;  2HJ4 A;  2XU7 A;  3EI3 A;  1PEV A;  3MKS B;  2CO0 A;  3UVN A;  1U8C A;  1O6F A;  2BBK H;  5HDB A;  4D0K A;  4J0W A;  3UKU C;  2PBI B;  1K3I A;  3BWS A;  4GZ8 A;  4IA9 A;  3ZE0 A;  5EMK B;  4E5Z B;  4JHP C;  4A0A B;  3V5W B;  2XDW A;  3EI2 B;  4GMB A;  2Z2P A;  5FKR A;  5EMM B;  3ZWL B;  2H6N A;  2XZG A;  4JSX C;  2CE9 A;  2G99 A;  4FB1 D;  3ZDX A;  4PSW B;  5H14 A;  5HE0 B;  1QFM A;  4ZN4 A;  2VDQ A;  3L4M D;  3F3F A;  4JHN A;  3IUJ A;  2HXC A;  4YVD A;  5FFO A;  3V9F A;  5EAM A;  3DSM A;  3IVM A;  3NVX A;  4IMM A;  4GGC A;  3ZDY A;  4GGD A;  2HES X;  2AGZ A;  3NVN A;  3EQ8 A;  1TBG A;  3CFV A;  2YMU A;  3IUR A;  4AMY A;  3GRE A;  1YFQ A;  2CNX A;  1JOF A;  4WK4 A;  2AQ5 A;  4A0B A;  1QNI A;  3PSL A;  4J87 A;  3T3P A;  2CN2 A;  4O45 A;  1JMZ B;  3EMH A;  3C5M A;  3C9C A;  4E54 B;  3MMY A;  5FLX g;  3JPX A;  3AL9 A;  4L1Q D;  4O2W A;  4PSX B;  3J81 g;  3PVW B;  5CXB B;  4JSV C;  5CYK B;  5IT9 g;  5EAL A;  5TF2 A;  4CY2 A;  1UOQ A;  3EI1 A;  3N0D A;  4FAN D;  4N14 A;  4J0X A;  4UM9 A;  4E5Z A;  5I5J A;  3NIG A;  5CXC A;  3O4H A;  2VDP A;  1I2M B;  4L9O A;  1XHM A;  3O4I A;  4XEI C;  4AEZ A;  2QR5 A;  1GP2 B;  3SXT D;  5KDO B;  3F3P A;  2H9N A;  5H1M A;  3L4O D;  5B4W A;  3P4F A;  4ZOY A;  4U1E I;  3RFH A;  3KRX B;  5THA A;  3ZE1 A;  1A12 A;  1GG2 B;  4D9S A;  1XKS A;  1H2Y A;  3PVU B;  1JV2 A;  5M5R A;  2OVQ B;  2VC2 A;  3DXK C;  1UOP A;  5AFU 3;  5HE2 B;  4AMZ A;  1N6F A;  3J80 g;  1E8M A;  3ZDZ A;  5M5V A;  1ERJ A;  2YBA A;  2GC4 A;  3OL2 B;  4QAM A;  1N6E A;  4X3E A;  4L1M A;  5EML B;  1PBY B;  4ZOV A;  1R5M A;  3EI2 A;  5C9Z B;  3VH0 A;  1VYH C;  3I7P A;  4CI3 A;  4A09 B;  3ORV D;  2J55 H;  4JSN C;  3UVO A;  3EG6 A;  2CO0 C;  2AGW A;  2QZP A;  2VDM A;  1VE7 A;  2B5N A;  4TZ4 A;  4ERY A;  4Y7R A;  5CXC B;  3IUM A;  3I2N A;  2JKX A;  3I7H A;  4LG8 A;  1FWX A;  3F3G A;  3IUQ A;  2EID A;  5M5S A;  1SQJ A;  3JB9 L;  2P9I C;  5C2W B;  2VDK A;  2IWK A;  4H5J A;  4FA9 D;  3K71 A;  3UVL A;  5CYK A;  2UZY B;  4FA5 D;  3RRM C;  3AH8 B;  4CI1 A;  5EAR A;  4A11 B;  5IJ7 E;  3T3M A;  4K3I D;  2H9L A;  3FGB A;  4R7A B;  3OKT A;  3EWE A;  5EM2 A;  5GMK n;  4UI9 R;  2P9K C;  1SHY B;  2GC7 A;  4I79 A;  2IUR A;  3KCI A;  2VDN A;  3OL2 A;  2W18 A;  5EM2 B;  2I0R A;  4CI2 A;  3CFS B;  3JZG A;  3SMR A;  2EBS A;  4FA4 D;  1JMX B;  3AL8 A;  5K19 A;  2I0S A;  3MVD K;  3QHY B;  3RMZ D;  2GNQ A;  1M1X A;  4Z7Q A;  4RE5 A;  2IUQ A;  4PBZ A;  2VZ3 A;  5I5M A;  4FAV D;  5HYN B;  1E8N A;  5AMS A;  2QC5 A;  2P9U C;  1QFS A;  3DDU A;  3SWS D;  4A0A A;  4GQB B;  4QL1 A;  3QI0 A;  1VZ2 A;  4O02 A;  2H9M A;  3V4V A;  4L3G D;  3O4J A;  3ULE C;  2BKL A;  4J78 A;  1SQ9 A;  3U4Y A;  4WJK A;  2Q7Q A;  2XE4 A;  4BCD A;  2IUV A;  2VDO A;  2PM9 A;  4CY5 A;  1OLZ A;  3MKQ A;  3EI3 B;  4NAA A;  4U7A A;  4Z8L A;  3VGZ A;  5HQG A;  4AX4 A;  4JT5 C;  4GM3 A;  5IC7 A;  4PXW A;  1MDA H;  4X60 B;  3UVM A;  5M61 A;  3OKW A;  4JXM A;  2IUP A;  3HFQ A;  5JWZ A;  2XL3 A;  1OMW B;  4QRJ A;  4E54 A;  3PE7 A;  3DWL C;  4GQ2 P;  3SBR A;  1C9I A;  2B5M A;  4H5I A;  3SFZ A;  1H2W A;  1VZ3 A;  5FKQ A;  4A08 B;  3RN0 D;  5GXH A;  1S4U X;  2I0T A;  3IJ1 A;  1T2X A;  4DNV A;  1GOG A;  2P9L C;  2H6K A;  2OIZ A;  2I3S A;  4DNU A;  1H2X A;  2HYE A;  3OTT A;  1GXR A;  4CZX A;  4MMY A;  1K8K C;  4GM9 A;  2XL2 A;  3K6S A;  3RSE C;  2MTA H;  4PBY A;  4J82 A;  4MK0 B;  3EI1 B;  3BG1 A;  4O3T B;  1GOH A;  3I7K A;  1C9L A;  3I8C A;  4WK2 A;  3DXM C;  3EI4 B;  4NC4 A;  4XYI A;  3RFG A;  3K27 A;  5K1C C;  4A08 A;  5FXY A;  5IGO A;  3SHF A;  4A7J A;  5FKT A;  2YB8 B;  4OWR A;  5M5T A;  3BG0 A;  4A0B B;  3UKR C;  3OF7 A;  5FKS A;  2WQ8 A;  2HU7 A;  3IUN A;  3GFC A;  3EU7 A;  2AH0 A;  4A2L A;  4JD2 C;  1NEX B;  3I7N A;  1B9X A;  4ZOX A;  4BCC A;  3I8E A;  3MUN A;  3JRP A;  4FA1 D;  4O9D A;  4PNK B;  3IJ0 A;  2BCJ B;  5M5U A;  4BP9 A;  3KRW B;  2H13 A;  3OKY A;  2HKM A;  1A0R B;  4Y5R D;  4CI8 A;  4ERQ A;  4O3U B;  4Z7N A;  2OVR B;  3GC3 B;  5EAP A;  3SBP A;  3N0E A;  4DNW A;  3CIK B;  2EIE A;  3EQ7 A;  3SN6 B;  4G56 B;  4UM8 A;  2CN3 A;  4Z7O A;  5EMJ B;  2Z2O A;  5FFG A;  3IIY A;  1K32 A;  4CY1 A;  4D6V A;  4QQE A;  4J84 A;  1TYQ C;  2P9P C;  2VDR A;  1NR0 A;  3I7O A;  1L0Q A;  5GXI A;  4J8B A;  4CZV A;  3SVW D;  5C2V B;  2HU5 A;  4X61 B;  1L5G A;  1BPO A;  1MG3 A;  4LG9 A;  1UOO A;  4WK0 A;  2AGL A;  3I7L A;  4BCB A;  4CY3 A;  3PXS D;  5E6R A;  4NSX A;  4OZU A;  2H47 A;  5TEF A;  2QXV A;  2UZX B;  3SJL D;  3K26 A;  4J73 A;  3UR4 A;  1B9Y A;  2YNO A;  4AN0 A;  2HJB A;  2EIC A;  2VZ1 A;  5HE1 B;  3O4G A;  3EQ9 A;  1JTD B;  5TEE A;  3SBQ A;  3SLE D;  3MUO A;  2P9N C;  3ODT A;  3EI4 A;  3NVQ A;  5SXM A;  2YNN A;  3VA6 A;  1E5T A;  5IGQ A;  4ERZ A;  3FRX A;  3GD1 I;  1MG2 A;  4J77 A;  4MMX A;  4O1Q D;  2IAA A;  2H9P A;  2AGX A;  3ZE2 A;  4RE6 A;  5AJA A;  3RLM D;  2PM7 B;  2OK6 A;  4A09 A;  3VI4 A;  3A0F A;  3AFC A;  3B7F A;  4J86 A;  4NEN A;  4L3H D;  5E6S A;  4BUJ C;  2IWF A;  1H2Z A;  4BL0 A;  4J79 A;  4BP8 A;  3JZN A;  4LGN A;  2PM6 B;  3V7D B;  3K72 A;  2G9A A;  3OKY B;  3IKO A;  4FHL A;  4AOW A;  1N6D A;  3IJC A;  4QT8 A;  3JAM g;  3V4P A;  1TYE A;  1U4C A;  2EIB A;  4ZOZ A;  2HU8 A;  4X63 B;  4FWW A;  4XYH A;  4GM8 A;  2OJY A;  3FM0 A;  4CC9 A;  1VE6 A;  2PM9 B;  4JT6 C;  3PXT D;  2XYI A;  3UVK A;  4JSP C;  5E6U A;  3C75 H;  4G1M A;  5C86 A;  3W15 A;  3DM0 A;  4GGA A;  5C92 A;  5TDH B;  3MZK A;  5H17 A;  3IIW A;  1YR2 A; 
#chains in the Genus database with same CATH homology
 3T3M A;  4G1E A;  4MMY A;  5E6R A;  4MMX A;  5FFO A;  3ZE1 A;  3K6S A;  1U8C A;  4UM8 A;  3ZE2 A;  1JV2 A;  3ZDY A;  2VDM A;  4Z7O A;  5HDB A;  1TYE A;  3V4P A;  2VC2 A;  4O02 A;  3FCU A;  3V4V A;  3ZE0 A;  5FFG A;  2VDN A;  2VDL A;  3IJE A;  4UM9 A;  3VI4 A;  3NIG A;  3FCS A;  4WK2 A;  2VDP A;  3ZDZ A;  4WJK A;  4NEN A;  5E6S A;  2VDR A;  4WK4 A;  4IRZ A;  3T3P A;  2VDK A;  5E6U A;  4G1M A;  2VDO A;  1M1X A;  3K71 A;  1L5G A;  3NIF A;  4Z7N A;  3K72 A;  4Z7Q A;  3ZDX A;  4MMZ A;  3VI3 A;  3NID A;  4WK0 A;  2VDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...