3ZE2A

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3ze2A00
2VDNA 4NENA 3V4VA 1JV2A 2VDPA 3ZDZA 2VDRA 2VDOA 4WK4A 3FCSA 3ZDXA 4O02A 1L5GA 4Z7OA 2VDLA 1TYEA 3NIDA 3NIGA 3NIFA 3ZE1A 3ZE0A 1U8CA 3V4PA 4G1MA 4Z7NA 2VDMA 2VDQA 4WK0A 2VC2A 3VI3A 4WJKA 4MMXA 4MMYA 3FCUA 5E6UA 4G1EA 3IJEA 4UM9A 2VDKA 5FFGA 3K6SA 4UM8A 4MMZA 5FFOA 3VI4A 4WK2A 3ZE2A 3ZDYA 1M1XA 4IRZA 3T3MA 3K71A 3K72A 3T3PA 5HDBA 4Z7QA 5E6SA 5E6RA
chains in the Genus database with same CATH superfamily
2VDNA 1TBGA 4HDJA 3KRWB 4WK4A 3GFCA 5M5TA 1H2XA 1QFSA 2IUVA 3VA6A 2VDLA 3AH8B 3F3FA 1GXRA 4AN1A 4FA9D 4J84A 4ES0A 4AN0A 5C9ZB 3PXSD 5H17A 3JRPA 3EI2B 4J81A 2YNOA 3AL9A 4X3EA 2EICA 3I7KA 3EQ8A 4J0XA 2P9IC 3SWSD 2QZPA 3IUJA 2AGZA 3IUQA 3V5WB 2AGWA 5IJ7E 4CZVA 3JB9L 3CFVA 3SBQA 3FRXA 3FM0A 2I0RA 3I7NA 5CXCA 4GMBA 4Z8LA 3EI4A 2AGLA 4J8BA 1O6FA 4D9SA 4O3TB 4ZOVA 2VZ1A 4I79A 4AMZA 3IJ1A 1VYHC 4PSXB 3SVWD 2I0TA 3MUOA 2PM9A 3BG0A 2PM6B 2IWFA 3EQ7A 3IVMA 3MZKA 3UKUC 3ZWLB 1UTCA 4LGNA 2B4EA 2IAAA 4G1EA 3EI3B 3IUMA 4QRJA 4O2WA 3IIWA 1UOQA 5M5UA 3K72A 2YB8B 4JHPC 2P9UC 2P9NC 4NENA 3V4VA 1K32A 3N0DA 4J82A 3JAMg 5TDHB 3OKWA 3DSMA 1BPOA 1OLZA 3MKSB 4XEIC 5HE0B 5GXHA 3QI0A 3HFQA 4AEZA 5GMKn 4GQ2P 4K3ID 2CNXA 1NR0A 3MUNA 4J87A 4MMXA 1E8MA 1VE6A 5E6UA 2HU7A 4GGCA 4BL0A 4BP8A 4ERQA 2P9KC 4R7AB 3PSCB 3T3MA 2H9MA 5FKSA 4A08B 3OL2A 2H9NA 2UZYB 1R5MA 2Z2OA 5M5VA 2EIEA 2GC7A 4PBZA 4Z7OA 3DXKC 2WQ8A 1T2XA 3C99A 4G56B 2P9SC 3EI2A 3I8EA 2VDQA 4WK0A 3VI3A 4G55A 4JSVC 3U4YA 1XHMA 1E5TA 3DM0A 2I0SA 1XIPA 1GOTB 2OK4A 4NBMA 4J78A 4ERZA 4WK2A 5TF2A 3I7LA 1GOHA 1MG2A 5FKQA 4E54B 4A7JA 4L1QD 1UOPA 1S4UX 3RFHA 2VDRA 1PBYB 3ZDXA 3KCIA 2VZ3A 1A12A 3SFZA 3NVNA 4CY3A 2HJBA 4PSWB 3ZE0A 2OJYA 1N6EA 2XDWA 2VDMA 2QC5A 1K3IA 5M61A 2OVQB 4O1QD 4O45A 1O6GA 3FCUA 4K3JB 3RN1D 3J80g 5H14A 3L4MD 4AX4A 3K6SA 5CYKB 3ZE2A 3SCYA 4A0AA 5H1MA 4BUJC 3L4OD 4GM3A 5KDOB 2AGXA 3DWLC 3NIFA 4J73A 4LG8A 4CI2A 4RE5A 4JT6C 5I5MA 3CIKB 1GOGA 5FXYA 5FKTA 5JWZA 5IC7A 4A08A 4MK0B 4N14A 1XKSA 3UVMA 2YNPA 3F3GA 4UM8A 5GSAA 5EMLB 2BKLA 3MVDK 3IULA 3EWEA 2HU8A 5IGOA 1N6DA 4J0WA 5EMMB 3NVXA 3NIDA 1OMWB 4A09B 5GXIA 4Z7NA 2I3TA 4ESGA 4QAMA 2XZGA 1VZ2A 2OK6A 3OF7A 2AGYA 1A0RB 3O4HA 4CI8A 4GQ1A 5IJ8E 2QXVA 5FFGA 3SLED 4EWRA 3E0CA 5AFU3 1VZ3A 5HE1B 2H6QA 2PM7B 3JROA 1RI6A 5HQGA 4L1MA 5HYNB 4GZ8A 3I7PA 3ZE1A 5CXBB 3I7HA 4CZXA 5EMJB 2B5LA 4E5ZB 3PXTD 5CYKA 5C2WB 5M5SA 2J57G 4A0BA 5AMSA 3W15A 1C9LA 5I5JA 5IGQA 4U7AA 3MKQA 4JSPC 5FQDA 4X60B 3I7OA 3I2NA 3JZGA 2VDOA 2CO0C 2H68A 3B7FA 3KRXB 4XYIA 2HXCA 2P9LC 2Q7QA 5I5IA 1B9YA 3RSEC 3SXTD 2CN3A 2YBAA 4BCBA 2AH1A 3K26A 4GGAA 5C86A 1JMZB 3SBRA 2BCJB 2XE4A 1ERJA 3IJEA 2HYEA 1QNIA 4GM8A 3C5MA 3UVKA 5A2Qg 4ZN4A 4BH6A 1PGUA 2O9KA 3V9FA 3ODTA 5TEFA 4FA1D 3PVWB 4A09A 2J56H 2VDPA 3OKYB 4O9DA 5EALA 3MZLA 1L0QA 3EU7A 4NC4A 5HE3B 5EAPA 1C9IA 4UI9R 4CI1A 3EI3A 1UOOA 2YMUA 2H47A 3O4GA 3UR4A 4FA4D 2CO0A 5EMKB 4NAAA 3VH0A 3UVNA 4Y5RD 4AOWA 2EIDA 4MMZA 5FFOA 4A2LA 3ORVD 4IRZA 4H5JA 2HU5A 4JHNA 3PE7A 5CXBA 1GOFA 2IURA 5FA5B 3OTTA 4E5ZA 4FAVD 4JXMA 1TYEA 3RFGA 2I3SA 3OKTA 4JSXC 4Y7RA 1QFMA 5C2VB 3O4IA 3IUNA 2GC4A 2UZXB 4O3UB 5EM2B 3SN6B 1MG3A 2YNNA 1JOFA 1N6FA 2P9PC 2XL3A 3F3PA 1YFQA 5B4WA 5K1CC 4PBYA 4TZ4A 5M5RA 4A11B 5E6SA 3EI1B 2EIBA 4XYHA 4NSXA 3RLMD 1H2ZA 3ZDZA 2W18A 4J86A 3AL8B 1TYQC 3EMHA 2HKRA 3JPXA 4FB1D 3OL2B 3AFCA 2XL2A 4L9OA 1SHYB 5IT9g 2AH0A 5SXMA 1FWXA 2H6NA 3OW8A 3RRMC 1JJUB 2OVRB 2PBIB 3C9CA 4QT8A 3MMYA 3VGZA 4DNVA 2TRCB 4GGDA 1Q47A 4E54A 3OKYA 3C75H 3GC3B 5TEEA 1E8NA 4Z7QA 3QHYB 3CFSB 1JTDB 3DDUA 3FCSA 2JKXA 2H9PA 3RMZD 3PXWD 1SQJA 3NIGA 3V4PA 2AQ5A 4JT5C 4FA5D 4FAND 2XU7A 3BG1A 3IJ0A 4WJKA 3JZHA 4MMYA 3SHFA 2H9LA 3EG6A 2B5NA 1I2MB 3A0FA 2VDKA 3EQ9A 3GREA 4L3GD 3SJLD 3DXMC 4YVDA 2J55H 4DNUA 1JMXB 4JD2C 2CN2A 3NVQA 4QQEA 4QL1A 5EM2A 4A0AB 4O02A 1L5GA 2IUPA 4LG9A 4OWRA 2Z2PA 3JZNA 4PXWA 2EBSA 2IWKA 4BCCA 4FHLA 5THAA 1GG2B 1MDAH 3K27A 4DNWA 4RE6A 3I8CA 4CC9A 3ULEC 4D0KA 4ZOYA 1PI6A 4H5IA 2H6KA 3IURA 4A11A 4X61B 5C92A 3EI1A 2G9AA 4J79A 3UKRC 3IJCA 4ZOZA 3VI4A 1H2YA 4X63B 3N0EA 3FGBA 3AL8A 3ZDYA 2BBKH 3K71A 3PVUB 5HDBA 3T3PA 2H14A 4CY1A 5E6RA 5FLXg 4ERYA 2CE8A 1JV2A 4AMYA 2MTAH 4U1EI 4J8GA 2H13A 2HESX 3I89A 4L3HD 1PEVA 4KFMB 2XYIA 2G99A 3IIYA 1U8CA 4CI3A 2HKMA 2Z2NA 4G1MA 5EARA 3UVLA 4IMMA 5CXCB 3EI4B 1NEXB 3PSLA 4CY2A 1YR2A 3P4FA 3RN0D 3V7DB 4UM9A 4GM9A 1GP2B 4IA9A 2PM9B 3BWSA 1U4CA 3GD1I 4BCDA 5HE2B 2QR5A 4FWWA 1M1XA 2H3XA 4A2MA 3IKOA 2HJ4A 2OVPB 3MXXA 2B5MA 3UVOA 4J77A 2IUQA 4OZUA 5AJAA 4JSNC 4PNKB 5EAMA 5FKRA 3SBPA 1U2VC 4ZOXA 4GQBB 2VC2A 1K8KC 4PC0A 2GNQA 1H2WA 2OIZA 2CE9A 5K19A 1VE7A 3SMRA 4CZYA 1B9XA 4D6VA 3J81g 1P22A 4BP9A 4A0BB 3O4JA 1SQ9A 4CY5A
chains in the Genus database with same CATH topology
2VDNA 4NENA 3V4VA 1JV2A 2VDPA 3ZDZA 2VDRA 2VDOA 4WK4A 3FCSA 3ZDXA 4O02A 1L5GA 4Z7OA 2VDLA 1TYEA 3NIDA 3NIGA 3NIFA 3ZE1A 3ZE0A 1U8CA 3V4PA 4G1MA 4Z7NA 2VDMA 2VDQA 4WK0A 2VC2A 3VI3A 4WJKA 4MMXA 4MMYA 3FCUA 5E6UA 4G1EA 3IJEA 4UM9A 2VDKA 5FFGA 3K6SA 4UM8A 4MMZA 5FFOA 3VI4A 4WK2A 3ZE2A 3ZDYA 1M1XA 4IRZA 3T3MA 3K71A 3K72A 3T3PA 5HDBA 4Z7QA 5E6SA 5E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDN A;  4NEN A;  3V4V A;  1JV2 A;  2VDP A;  3ZDZ A;  2VDR A;  2VDO A;  4WK4 A;  3FCS A;  3ZDX A;  4O02 A;  1L5G A;  4Z7O A;  2VDL A;  1TYE A;  3NID A;  3NIG A;  3NIF A;  3ZE1 A;  3ZE0 A;  1U8C A;  3V4P A;  4G1M A;  4Z7N A;  2VDM A;  2VDQ A;  4WK0 A;  2VC2 A;  3VI3 A;  4WJK A;  4MMX A;  4MMY A;  3FCU A;  5E6U A;  4G1E A;  3IJE A;  4UM9 A;  2VDK A;  5FFG A;  3K6S A;  4UM8 A;  4MMZ A;  5FFO A;  3VI4 A;  4WK2 A;  3ZE2 A;  3ZDY A;  1M1X A;  4IRZ A;  3T3M A;  3K71 A;  3K72 A;  3T3P A;  5HDB A;  4Z7Q A;  5E6S A;  5E6R A; 
#chains in the Genus database with same CATH topology
 2VDN A;  1TBG A;  4HDJ A;  3KRW B;  4WK4 A;  3GFC A;  5M5T A;  1H2X A;  1QFS A;  2IUV A;  3VA6 A;  2VDL A;  3AH8 B;  3F3F A;  1GXR A;  4AN1 A;  4FA9 D;  4J84 A;  4ES0 A;  4AN0 A;  5C9Z B;  3PXS D;  5H17 A;  3JRP A;  3EI2 B;  4J81 A;  2YNO A;  3AL9 A;  4X3E A;  2EIC A;  3I7K A;  3EQ8 A;  4J0X A;  2P9I C;  3SWS D;  2QZP A;  3IUJ A;  2AGZ A;  3IUQ A;  3V5W B;  2AGW A;  5IJ7 E;  4CZV A;  3JB9 L;  3CFV A;  3SBQ A;  3FRX A;  3FM0 A;  2I0R A;  3I7N A;  5CXC A;  4GMB A;  4Z8L A;  3EI4 A;  2AGL A;  4J8B A;  1O6F A;  4D9S A;  4O3T B;  4ZOV A;  2VZ1 A;  4I79 A;  4AMZ A;  3IJ1 A;  1VYH C;  4PSX B;  3SVW D;  2I0T A;  3MUO A;  2PM9 A;  3BG0 A;  2PM6 B;  2IWF A;  3EQ7 A;  3IVM A;  3MZK A;  3UKU C;  3ZWL B;  1UTC A;  4LGN A;  2B4E A;  2IAA A;  4G1E A;  3EI3 B;  3IUM A;  4QRJ A;  4O2W A;  3IIW A;  1UOQ A;  5M5U A;  3K72 A;  2YB8 B;  4JHP C;  2P9U C;  2P9N C;  4NEN A;  3V4V A;  1K32 A;  3N0D A;  4J82 A;  3JAM g;  5TDH B;  3OKW A;  3DSM A;  1BPO A;  1OLZ A;  3MKS B;  4XEI C;  5HE0 B;  5GXH A;  3QI0 A;  3HFQ A;  4AEZ A;  5GMK n;  4GQ2 P;  4K3I D;  2CNX A;  1NR0 A;  3MUN A;  4J87 A;  4MMX A;  1E8M A;  1VE6 A;  5E6U A;  2HU7 A;  4GGC A;  4BL0 A;  4BP8 A;  4ERQ A;  2P9K C;  4R7A B;  3PSC B;  3T3M A;  2H9M A;  5FKS A;  4A08 B;  3OL2 A;  2H9N A;  2UZY B;  1R5M A;  2Z2O A;  5M5V A;  2EIE A;  2GC7 A;  4PBZ A;  4Z7O A;  3DXK C;  2WQ8 A;  1T2X A;  3C99 A;  4G56 B;  2P9S C;  3EI2 A;  3I8E A;  2VDQ A;  4WK0 A;  3VI3 A;  4G55 A;  4JSV C;  3U4Y A;  1XHM A;  1E5T A;  3DM0 A;  2I0S A;  1XIP A;  1GOT B;  2OK4 A;  4NBM A;  4J78 A;  4ERZ A;  4WK2 A;  5TF2 A;  3I7L A;  1GOH A;  1MG2 A;  5FKQ A;  4E54 B;  4A7J A;  4L1Q D;  1UOP A;  1S4U X;  3RFH A;  2VDR A;  1PBY B;  3ZDX A;  3KCI A;  2VZ3 A;  1A12 A;  3SFZ A;  3NVN A;  4CY3 A;  2HJB A;  4PSW B;  3ZE0 A;  2OJY A;  1N6E A;  2XDW A;  2VDM A;  2QC5 A;  1K3I A;  5M61 A;  2OVQ B;  4O1Q D;  4O45 A;  1O6G A;  3FCU A;  4K3J B;  3RN1 D;  3J80 g;  5H14 A;  3L4M D;  4AX4 A;  3K6S A;  5CYK B;  3ZE2 A;  3SCY A;  4A0A A;  5H1M A;  4BUJ C;  3L4O D;  4GM3 A;  5KDO B;  2AGX A;  3DWL C;  3NIF A;  4J73 A;  4LG8 A;  4CI2 A;  4RE5 A;  4JT6 C;  5I5M A;  3CIK B;  1GOG A;  5FXY A;  5FKT A;  5JWZ A;  5IC7 A;  4A08 A;  4MK0 B;  4N14 A;  1XKS A;  3UVM A;  2YNP A;  3F3G A;  4UM8 A;  5GSA A;  5EML B;  2BKL A;  3MVD K;  3IUL A;  3EWE A;  2HU8 A;  5IGO A;  1N6D A;  4J0W A;  5EMM B;  3NVX A;  3NID A;  1OMW B;  4A09 B;  5GXI A;  4Z7N A;  2I3T A;  4ESG A;  4QAM A;  2XZG A;  1VZ2 A;  2OK6 A;  3OF7 A;  2AGY A;  1A0R B;  3O4H A;  4CI8 A;  4GQ1 A;  5IJ8 E;  2QXV A;  5FFG A;  3SLE D;  4EWR A;  3E0C A;  5AFU 3;  1VZ3 A;  5HE1 B;  2H6Q A;  2PM7 B;  3JRO A;  1RI6 A;  5HQG A;  4L1M A;  5HYN B;  4GZ8 A;  3I7P A;  3ZE1 A;  5CXB B;  3I7H A;  4CZX A;  5EMJ B;  2B5L A;  4E5Z B;  3PXT D;  5CYK A;  5C2W B;  5M5S A;  2J57 G;  4A0B A;  5AMS A;  3W15 A;  1C9L A;  5I5J A;  5IGQ A;  4U7A A;  3MKQ A;  4JSP C;  5FQD A;  4X60 B;  3I7O A;  3I2N A;  3JZG A;  2VDO A;  2CO0 C;  2H68 A;  3B7F A;  3KRX B;  4XYI A;  2HXC A;  2P9L C;  2Q7Q A;  5I5I A;  1B9Y A;  3RSE C;  3SXT D;  2CN3 A;  2YBA A;  4BCB A;  2AH1 A;  3K26 A;  4GGA A;  5C86 A;  1JMZ B;  3SBR A;  2BCJ B;  2XE4 A;  1ERJ A;  3IJE A;  2HYE A;  1QNI A;  4GM8 A;  3C5M A;  3UVK A;  5A2Q g;  4ZN4 A;  4BH6 A;  1PGU A;  2O9K A;  3V9F A;  3ODT A;  5TEF A;  4FA1 D;  3PVW B;  4A09 A;  2J56 H;  2VDP A;  3OKY B;  4O9D A;  5EAL A;  3MZL A;  1L0Q A;  3EU7 A;  4NC4 A;  5HE3 B;  5EAP A;  1C9I A;  4UI9 R;  4CI1 A;  3EI3 A;  1UOO A;  2YMU A;  2H47 A;  3O4G A;  3UR4 A;  4FA4 D;  2CO0 A;  5EMK B;  4NAA A;  3VH0 A;  3UVN A;  4Y5R D;  4AOW A;  2EID A;  4MMZ A;  5FFO A;  4A2L A;  3ORV D;  4IRZ A;  4H5J A;  2HU5 A;  4JHN A;  3PE7 A;  5CXB A;  1GOF A;  2IUR A;  5FA5 B;  3OTT A;  4E5Z A;  4FAV D;  4JXM A;  1TYE A;  3RFG A;  2I3S A;  3OKT A;  4JSX C;  4Y7R A;  1QFM A;  5C2V B;  3O4I A;  3IUN A;  2GC4 A;  2UZX B;  4O3U B;  5EM2 B;  3SN6 B;  1MG3 A;  2YNN A;  1JOF A;  1N6F A;  2P9P C;  2XL3 A;  3F3P A;  1YFQ A;  5B4W A;  5K1C C;  4PBY A;  4TZ4 A;  5M5R A;  4A11 B;  5E6S A;  3EI1 B;  2EIB A;  4XYH A;  4NSX A;  3RLM D;  1H2Z A;  3ZDZ A;  2W18 A;  4J86 A;  3AL8 B;  1TYQ C;  3EMH A;  2HKR A;  3JPX A;  4FB1 D;  3OL2 B;  3AFC A;  2XL2 A;  4L9O A;  1SHY B;  5IT9 g;  2AH0 A;  5SXM A;  1FWX A;  2H6N A;  3OW8 A;  3RRM C;  1JJU B;  2OVR B;  2PBI B;  3C9C A;  4QT8 A;  3MMY A;  3VGZ A;  4DNV A;  2TRC B;  4GGD A;  1Q47 A;  4E54 A;  3OKY A;  3C75 H;  3GC3 B;  5TEE A;  1E8N A;  4Z7Q A;  3QHY B;  3CFS B;  1JTD B;  3DDU A;  3FCS A;  2JKX A;  2H9P A;  3RMZ D;  3PXW D;  1SQJ A;  3NIG A;  3V4P A;  2AQ5 A;  4JT5 C;  4FA5 D;  4FAN D;  2XU7 A;  3BG1 A;  3IJ0 A;  4WJK A;  3JZH A;  4MMY A;  3SHF A;  2H9L A;  3EG6 A;  2B5N A;  1I2M B;  3A0F A;  2VDK A;  3EQ9 A;  3GRE A;  4L3G D;  3SJL D;  3DXM C;  4YVD A;  2J55 H;  4DNU A;  1JMX B;  4JD2 C;  2CN2 A;  3NVQ A;  4QQE A;  4QL1 A;  5EM2 A;  4A0A B;  4O02 A;  1L5G A;  2IUP A;  4LG9 A;  4OWR A;  2Z2P A;  3JZN A;  4PXW A;  2EBS A;  2IWK A;  4BCC A;  4FHL A;  5THA A;  1GG2 B;  1MDA H;  3K27 A;  4DNW A;  4RE6 A;  3I8C A;  4CC9 A;  3ULE C;  4D0K A;  4ZOY A;  1PI6 A;  4H5I A;  2H6K A;  3IUR A;  4A11 A;  4X61 B;  5C92 A;  3EI1 A;  2G9A A;  4J79 A;  3UKR C;  3IJC A;  4ZOZ A;  3VI4 A;  1H2Y A;  4X63 B;  3N0E A;  3FGB A;  3AL8 A;  3ZDY A;  2BBK H;  3K71 A;  3PVU B;  5HDB A;  3T3P A;  2H14 A;  4CY1 A;  5E6R A;  5FLX g;  4ERY A;  2CE8 A;  1JV2 A;  4AMY A;  2MTA H;  4U1E I;  4J8G A;  2H13 A;  2HES X;  3I89 A;  4L3H D;  1PEV A;  4KFM B;  2XYI A;  2G99 A;  3IIY A;  1U8C A;  4CI3 A;  2HKM A;  2Z2N A;  4G1M A;  5EAR A;  3UVL A;  4IMM A;  5CXC B;  3EI4 B;  1NEX B;  3PSL A;  4CY2 A;  1YR2 A;  3P4F A;  3RN0 D;  3V7D B;  4UM9 A;  4GM9 A;  1GP2 B;  4IA9 A;  2PM9 B;  3BWS A;  1U4C A;  3GD1 I;  4BCD A;  5HE2 B;  2QR5 A;  4FWW A;  1M1X A;  2H3X A;  4A2M A;  3IKO A;  2HJ4 A;  2OVP B;  3MXX A;  2B5M A;  3UVO A;  4J77 A;  2IUQ A;  4OZU A;  5AJA A;  4JSN C;  4PNK B;  5EAM A;  5FKR A;  3SBP A;  1U2V C;  4ZOX A;  4GQB B;  2VC2 A;  1K8K C;  4PC0 A;  2GNQ A;  1H2W A;  2OIZ A;  2CE9 A;  5K19 A;  1VE7 A;  3SMR A;  4CZY A;  1B9X A;  4D6V A;  3J81 g;  1P22 A;  4BP9 A;  4A0B B;  3O4J A;  1SQ9 A;  4CY5 A; 
#chains in the Genus database with same CATH homology
 2VDN A;  4NEN A;  3V4V A;  1JV2 A;  2VDP A;  3ZDZ A;  2VDR A;  2VDO A;  4WK4 A;  3FCS A;  3ZDX A;  4O02 A;  1L5G A;  4Z7O A;  2VDL A;  1TYE A;  3NID A;  3NIG A;  3NIF A;  3ZE1 A;  3ZE0 A;  1U8C A;  3V4P A;  4G1M A;  4Z7N A;  2VDM A;  2VDQ A;  4WK0 A;  2VC2 A;  3VI3 A;  4WJK A;  4MMX A;  4MMY A;  3FCU A;  5E6U A;  4G1E A;  3IJE A;  4UM9 A;  2VDK A;  5FFG A;  3K6S A;  4UM8 A;  4MMZ A;  5FFO A;  3VI4 A;  4WK2 A;  3ZE2 A;  3ZDY A;  1M1X A;  4IRZ A;  3T3M A;  3K71 A;  3K72 A;  3T3P A;  5HDB A;  4Z7Q A;  5E6S A;  5E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...