3BG0A

Architecture of a coat for the nuclear pore membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
291
structure length
283
Chain Sequence
DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, hydrolase
molecule keywords Protein SEC13 homolog
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 283
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg0A00
3I89A 3V9FA 2HXCA 2HESX 3I8CA 2YNNA 3EG6A 3OKTA 3UVNA 4BH6A 2YB8B 2IUPA 3UVOA 5HE1B 4X63B 4I79A 2O9KA 2H9LA 2YMUA 2GC4A 4AEZA 5EMJB 1OLZA 3FM0A 3CFVA 4A11A 5GSAA 4LG9A 4O45A 3CFSB 2YNOA 3EI1A 3KRWB 1N6FA 3DXKC 3A0FA 3ODTA 5CXCA 5HE2B 4J78A 3DWLC 1K32A 4GM9A 5C2VB 4A2LA 2UZYB 5HYNB 4XYIA 2CE8A 4L1QD 3C75H 4XEIC 4GQ1A 4JSVC 2YBAA 5EM2A 3AFCA 5H14A 2H13A 3PXWD 4O3TB 3ORVD 2AGYA 5EALA 1TBGA 2MTAH 4D6VA 4H5JA 1GP2B 3AL9A 4CY5A 5HE0B 3F3GA 3JROA 3OKYB 5IT9g 5GXHA 2Q7QA 2PM7B 2GNQA 1U4CA 5H1MA 3UVMA 5H17A 3BWSA 3SBRA 3EI3B 2OK4A 2YNPA 3EI2A 3EMHA 5IJ8E 3AL8A 3SHFA 3VGZA 4PSXB 3SWSD 2B4EA 2Z2OA 4J8BA 3JAMg 3GFCA 4IA9A 1OMWB 4BUJC 4J0XA 4ERQA 1MG2A 4FHLA 3GREA 5EAPA 2J56H 4ERZA 3JZHA 4PNKB 2HJBA 3MKSB 4E5ZA 1L0QA 4GMBA 3VH0A 4GGDA 5I5IA 4Z8LA 4QRJA 2UZXB 5CYKA 5C2WB 3JZNA 3OL2B 4OWRA 3EU7A 4YVDA 2PBIB 4MK0B 3MKQA 2H9PA 4J86A 3UR4A 2OVRB 3B7FA 4PBZA 3RFHA 1FWXA 1PBYB 4J79A 5HQGA 3E0CA 2AGWA 1MG3A 5TDHB 1NEXB 4CI8A 2H14A 4R7AB 4E54B 3UVLA 3JRPA 5IJ7E 5KDOB 3V5WB 4A08B 4JXMA 3I7KA 5EAMA 3CIKB 2TRCB 5FXYA 1TYQC 4L9OA 4H5IA 4KFMB 3FGBA 3VA6A 2OVPB 4PSWB 2HJ4A 2XYIA 4ZOVA 4ERYA 3NVNA 3SBPA 4K3ID 4FA5D 3JZGA 4O1QD 4JT6C 4OZUA 5GMKn 4ZN4A 1XIPA 5I5JA 4X61B 2IUQA 2P9KC 3I7NA 4J82A 2H9NA 2PM9B 3I7LA 3F3FA 5FKRA 3UKRC 3V7DB 3IJCA 3SJLD 3RN1D 4FB1D 3AH8B 4QL1A 2W18A 2QXVA 2H3XA 1YFQA 1JMXB 5EMLB 4ZOYA 5AJAA 3KRXB 5IGQA 3NVXA 4JSNC 1A0RB 4A0AB 2I3SA 5HE3B 4JSXC 1PGUA 3PSLA 4PC0A 4JSPC 4J77A 4JD2C 5FA5B 2G99A 1N6DA 1JMZB 5FKTA 2P9IC 2CO0C 3U4YA 4A09A 3P4FA 1Q47A 1B9YA 2HKRA 3IIYA 3EI4A 2H6NA 3F3PA 4JT5C 4XYHA 5CXBB 4A7JA 2IURA 2H6KA 4J8GA 4A0BA 1GOTB 2BBKH 2HKMA 2I0SA 2QC5A 2PM6B 1MDAH 4ES0A 2AH0A 1NR0A 5EMKB 3SVWD 2B5NA 4GM3A 1R5MA 2IUVA 4GQBB 2G9AA 4FWWA 4FAND 1SQ9A 2J57G 2I0RA 4A11B 3W15A 2CO0A 3ULEC 2AGLA 3SLED 3EI1B 5CXCB 1XHMA 1K8KC 4FA9D 3C99A 1GG2B 4CY2A 1SQJA 3C9CA 5I5MA 2P9PC 5IC7A 2Z2NA 3SFZA 4EWRA 4Y5RD 2P9NC 5B4WA 1B9XA 4QQEA 3RFGA 2CNXA 5EM2B 1GXRA 5FLXg 4GZ8A 3C5MA 5TEFA 3RN0D 5EMMB 2IWFA 3RSEC 3PVUB 2AGXA 3BG0A 4QT8A 5A2Qg 5AMSA 3K27A 4A0BB 4CZYA 4U7AA 4J0WA 3DSMA 2BCJB 3OKYA 1SHYB 3N0DA 3RLMD 2H6QA 1ERJA 4A2MA 2XL2A 3RRMC 3EI2B 3OTTA 3SMRA 3PXTD 3BG1A 3RMZD 3AL8B 4J73A 2EBSA 3ZWLB 3EI3A 3HFQA 3JPXA 2GC7A 5THAA 2HYEA 2AGZA 4CC9A 5GXIA 4J87A 5C9ZB 4ZOZA 4E5ZB 1PI6A 4BL0A 3SBQA 5CYKB 4ZOXA 1VYHC 3PSCB 4CY3A 4TZ4A 4G56B 5TF2A 3PXSD 4CZXA 3OKWA 5FKQA 3NVQA 2P9SC 3OL2A 4GGCA 4U1EI 4UI9R 3I7PA 3OW8A 3I7OA 3SXTD 2P9LC 3DM0A 3MZLA 3DXMC 2I0TA 3J81g 1RI6A 2AQ5A 4CI3A 1P22A 5EARA 5FKSA 3J80g 2OIZA 3I7HA 2H9MA 4GQ2P 3N0EA 1XKSA 4GGAA 4GM8A 5K1CC 4FA4D 4X3EA 4FAVD 3FRXA 4PBYA 4L3GD 2XL3A 5IGOA 4E54A 3I8EA 3MXXA 3I2NA 4A08A 2AH1A 2J55H 4CI2A 5FQDA 2OVQB 2XU7A 2B5LA 3L4MD 5SXMA 1JOFA 3PE7A 2CE9A 4LG8A 2OJYA 2I3TA 4CZVA 2Z2PA 5AFU3 3IKOA 4J81A 2CN3A 2PM9A 1N6EA 3EWEA 4CY1A 4D0KA 4ESGA 4HDJA 4AOWA 4J84A 1S4UX 3MZKA 4CI1A 2OK6A 2IWKA 4A0AA 4O9DA 3UKUC 5K19A 1QNIA 4X60B 2B5MA 4K3JB 3UVKA 4Y7RA 4A09B 2P9UC 3IIWA 3L4OD 3SCYA 5TEEA 3SN6B 1JJUB 3EI4B 3K26A 2H68A 4L3HD 1PEVA 3IJ0A 3IJ1A 4LGNA 4FA1D 3PVWB 4NSXA 3JB9L 2IAAA 2CN2A 2H47A 4N14A 3MMYA 5CXBA 4IMMA 4PXWA 5JWZA 1U2VC 4O3UB
chains in the Genus database with same CATH superfamily
3I89A 5E6RA 3V9FA 1JTDB 2HXCA 2HESX 4G1MA 3I8CA 2YNNA 3EG6A 3OKTA 3UVNA 4BH6A 2YB8B 5E6SA 4Z7OA 2IUPA 3UVOA 5HE1B 4X63B 4I79A 2O9KA 2H9LA 2VC2A 2YMUA 2GC4A 4AEZA 5EMJB 1OLZA 3FM0A 3CFVA 2VZ3A 4A11A 5GSAA 4LG9A 4O45A 3CFSB 2YNOA 3EI1A 3KRWB 1UTCA 1N6FA 3DXKC 3A0FA 3ODTA 5CXCA 5HE2B 4J78A 3DWLC 4JHNA 1K32A 4AN0A 3MUNA 3O4JA 4GM9A 5C2VB 4A2LA 2UZYB 5HYNB 1H2XA 4XYIA 2CE8A 4L1QD 3C75H 4XEIC 2QZPA 4GQ1A 4JSVC 2YBAA 3MVDK 5EM2A 3AFCA 5H14A 3ZDXA 2H13A 3PXWD 4O3TB 3DDUA 2AGYA 3ORVD 5EALA 1I2MB 4AMZA 1TBGA 2MTAH 4D6VA 4H5JA 1GP2B 3AL9A 2EICA 4CY5A 5HE0B 2HU8A 4WK4A 3F3GA 3JROA 3OKYB 5M61A 5IT9g 4RE5A 4G55A 5GXHA 2Q7QA 2PM7B 2GNQA 4UM8A 3VI4A 1U4CA 5H1MA 3UVMA 5H17A 3BWSA 3SBRA 3EI3B 2OK4A 2YNPA 3EI2A 3EMHA 5IJ8E 1TYEA 3AL8A 3SHFA 3VGZA 4PSXB 3SWSD 2B4EA 2Z2OA 4J8BA 3JAMg 3GFCA 3NIDA 1M1XA 4IA9A 1OMWB 4BUJC 4J0XA 4ERQA 1MG2A 4MMZA 3O4IA 4FHLA 3GREA 5EAPA 2J56H 4ERZA 3JZHA 3O4GA 4PNKB 2HJBA 3ZE1A 3MKSB 4E5ZA 1L0QA 4GMBA 3VH0A 4GGDA 1UOOA 5I5IA 4NENA 3EQ8A 4Z8LA 4QRJA 1UOQA 2UZXB 5CYKA 5C2WB 3JZNA 3OL2B 4OWRA 3EU7A 4YVDA 3QHYB 2PBIB 4MK0B 3MKQA 4AX4A 2H9PA 4J86A 3UR4A 2OVRB 3B7FA 3V4VA 4PBZA 3RFHA 4WJKA 3K6SA 3GC3B 1FWXA 1PBYB 3IJEA 4BCBA 4J79A 5HQGA 3E0CA 2AGWA 4NC4A 1MG3A 2XE4A 5TDHB 1NEXB 4CI8A 2H14A 4R7AB 4E54B 3UVLA 5M5SA 3JRPA 5IJ7E 5KDOB 3V5WB 4A08B 4JXMA 3I7KA 5EAMA 3CIKB 1T2XA 2TRCB 5FXYA 1BPOA 1TYQC 4L9OA 4H5IA 4KFMB 5M5UA 3FGBA 3VA6A 5E6UA 2OVPB 4PSWB 2BKLA 2HJ4A 2XYIA 4ZOVA 4ERYA 3NVNA 3SBPA 4K3ID 4FA5D 3JZGA 4O1QD 4JT6C 4OZUA 5GMKn 4ZN4A 1XIPA 5I5JA 4X61B 1QFMA 2XDWA 2IUQA 2P9KC 3I7NA 4J82A 3K72A 2H9NA 2PM9B 3I7LA 3F3FA 1O6GA 3NIFA 2VDOA 5FKRA 3UKRC 3V7DB 2QR5A 3IJCA 3SJLD 3RN1D 4FB1D 3AH8B 4QL1A 2W18A 3FCSA 1GOGA 2QXVA 2H3XA 1YFQA 1JMXB 5EMLB 5HDBA 4ZOYA 3T3PA 5AJAA 3KRXB 3IURA 5IGQA 3NVXA 2EIBA 1A0RB 4JSNC 4A0AB 2I3SA 5HE3B 1H2ZA 4G1EA 4JSXC 3K71A 1PGUA 3PSLA 4PC0A 4JSPC 2EIEA 4J77A 1E8NA 4JD2C 5FA5B 2G99A 4O2WA 1N6DA 1JMZB 5FKTA 2P9IC 2CO0C 1UOPA 3U4YA 5M5TA 4A09A 3P4FA 4DNWA 1Q47A 1C9IA 1B9YA 2HKRA 3NIGA 3IIYA 1GOHA 2H6NA 3F3PA 3EI4A 4JT5C 3IUJA 4XYHA 5CXBB 4A7JA 2IURA 2H6KA 4J8GA 4A0BA 4UM9A 1GOTB 2BBKH 3IUNA 4BP8A 2HKMA 2I0SA 2QC5A 2PM6B 1QFSA 2HU5A 1MDAH 3O4HA 2HU7A 4DNVA 2AH0A 1NR0A 5EMKB 3FCUA 4ES0A 3SVWD 2B5NA 1A12A 4GM3A 1R5MA 2IUVA 4GQBB 2G9AA 4FWWA 1VE7A 4FAND 1SQ9A 2J57G 2VDRA 2I0RA 4A11B 4MMXA 3W15A 1VE6A 3GD1I 2CO0A 2JKXA 3ULEC 2AGLA 3SLED 3EI1B 1YR2A 5CXCB 1XHMA 1K8KC 4FA9D 3C99A 1GG2B 4CY2A 1SQJA 3C9CA 5I5MA 2P9PC 5IC7A 2Z2NA 3SFZA 4NAAA 3KCIA 4Y5RD 2P9NC 4EWRA 5B4WA 1B9XA 4QQEA 5FFOA 3RFGA 2CNXA 5EM2B 1GXRA 5FLXg 4GZ8A 4BCCA 3C5MA 5TEFA 3RN0D 5EMMB 2IWFA 3RSEC 3PVUB 3ZDZA 2AGXA 2VDKA 3BG0A 4QT8A 3V4PA 1VZ2A 4AN1A 5A2Qg 5AMSA 3K27A 4A0BB 4CZYA 4U7AA 4J0WA 4D9SA 3MUOA 3DSMA 2BCJB 3IULA 3OKYA 1SHYB 3N0DA 3RLMD 3EQ9A 2H6QA 1ERJA 4A2MA 2XL2A 3RRMC 3QI0A 3EI2B 3OTTA 3SMRA 3PXTD 3BG1A 3RMZD 3AL8B 4J73A 2EBSA 3ZWLB 3ZE0A 3EI3A 3HFQA 4DNUA 3JPXA 2GC7A 4Z7NA 5THAA 2HYEA 2AGZA 4CC9A 5GXIA 4J87A 3OF7A 3T3MA 5C9ZB 4ZOZA 4E5ZB 1PI6A 1L5GA 3IUMA 4BL0A 4QAMA 3SBQA 5CYKB 4WK0A 4ZOXA 1VYHC 3PSCB 4CY3A 4TZ4A 4Z7QA 4G56B 5TF2A 3PXSD 4CZXA 3OKWA 5FKQA 3NVQA 5C92A 2P9SC 3OL2A 4GGCA 4NBMA 4U1EI 4UI9R 3I7PA 3OW8A 3I7OA 3SXTD 2P9LC 3DM0A 3MZLA 3DXMC 2I0TA 3J81g 4L1MA 2VZ1A 1RI6A 2AQ5A 2XZGA 4CI3A 4BCDA 3IVMA 1P22A 5EARA 1O6FA 5FKSA 3J80g 4WK2A 2OIZA 3I7HA 5C86A 2H9MA 4GQ2P 3N0EA 4MMYA 1XKSA 4GGAA 2WQ8A 4GM8A 5K1CC 4FA4D 4X3EA 4FAVD 3FRXA 4PBYA 4L3GD 2XL3A 5IGOA 4E54A 2VDLA 3I8EA 1E5TA 3MXXA 3I2NA 4A08A 2AH1A 2J55H 4CI2A 5FQDA 1VZ3A 2OVQB 2XU7A 2B5LA 3L4MD 5SXMA 1JOFA 3PE7A 2CE9A 2VDMA 4IRZA 4LG8A 3ZE2A 3ZDYA 2OJYA 2I3TA 4JHPC 4CZVA 2Z2PA 5AFU3 4RE6A 4AMYA 4O02A 3IKOA 4J81A 2CN3A 2VDQA 2PM9A 1N6EA 3EWEA 2EIDA 5M5RA 4CY1A 4D0KA 4ESGA 4HDJA 4AOWA 4J84A 1S4UX 3MZKA 4CI1A 2OK6A 2IWKA 1H2YA 3VI3A 4BP9A 4A0AA 4O9DA 5M5VA 3UKUC 5K19A 1QNIA 1H2WA 4X60B 2B5MA 4K3JB 3UVKA 1GOFA 3EQ7A 4Y7RA 4A09B 2P9UC 1U8CA 2VDNA 3IIWA 3L4OD 3SCYA 5TEEA 1JV2A 3IUQA 1JJUB 3EI4B 3SN6B 3K26A 2H68A 1K3IA 4L3HD 1PEVA 3IJ0A 3IJ1A 4LGNA 4FA1D 2VDPA 3PVWB 4NSXA 3JB9L 2IAAA 2CN2A 2H47A 4N14A 1C9LA 1E8MA 3MMYA 5CXBA 5FFGA 4IMMA 4PXWA 5JWZA 1U2VC 4O3UB
chains in the Genus database with same CATH topology
3I89A 3V9FA 2HXCA 2HESX 3I8CA 2YNNA 3EG6A 3OKTA 3UVNA 4BH6A 2YB8B 2IUPA 3UVOA 5HE1B 4X63B 4I79A 2O9KA 2H9LA 2YMUA 2GC4A 4AEZA 5EMJB 1OLZA 3FM0A 3CFVA 4A11A 5GSAA 4LG9A 4O45A 3CFSB 2YNOA 3EI1A 3KRWB 1N6FA 3DXKC 3A0FA 3ODTA 5CXCA 5HE2B 4J78A 3DWLC 1K32A 4GM9A 5C2VB 4A2LA 2UZYB 5HYNB 4XYIA 2CE8A 4L1QD 3C75H 4XEIC 4GQ1A 4JSVC 2YBAA 5EM2A 3AFCA 5H14A 2H13A 3PXWD 4O3TB 3ORVD 2AGYA 5EALA 1TBGA 2MTAH 4D6VA 4H5JA 1GP2B 3AL9A 4CY5A 5HE0B 3F3GA 3JROA 3OKYB 5IT9g 5GXHA 2Q7QA 2PM7B 2GNQA 1U4CA 5H1MA 3UVMA 5H17A 3BWSA 3SBRA 3EI3B 2OK4A 2YNPA 3EI2A 3EMHA 5IJ8E 3AL8A 3SHFA 3VGZA 4PSXB 3SWSD 2B4EA 2Z2OA 4J8BA 3JAMg 3GFCA 4IA9A 1OMWB 4BUJC 4J0XA 4ERQA 1MG2A 4FHLA 3GREA 5EAPA 2J56H 4ERZA 3JZHA 4PNKB 2HJBA 3MKSB 4E5ZA 1L0QA 4GMBA 3VH0A 4GGDA 5I5IA 4Z8LA 4QRJA 2UZXB 5CYKA 5C2WB 3JZNA 3OL2B 4OWRA 3EU7A 4YVDA 2PBIB 4MK0B 3MKQA 2H9PA 4J86A 3UR4A 2OVRB 3B7FA 4PBZA 3RFHA 1FWXA 1PBYB 4J79A 5HQGA 3E0CA 2AGWA 1MG3A 5TDHB 1NEXB 4CI8A 2H14A 4R7AB 4E54B 3UVLA 3JRPA 5IJ7E 5KDOB 3V5WB 4A08B 4JXMA 3I7KA 5EAMA 3CIKB 2TRCB 5FXYA 1TYQC 4L9OA 4H5IA 4KFMB 3FGBA 3VA6A 2OVPB 4PSWB 2HJ4A 2XYIA 4ZOVA 4ERYA 3NVNA 3SBPA 4K3ID 4FA5D 3JZGA 4O1QD 4JT6C 4OZUA 5GMKn 4ZN4A 1XIPA 5I5JA 4X61B 2IUQA 2P9KC 3I7NA 4J82A 2H9NA 2PM9B 3I7LA 3F3FA 5FKRA 3UKRC 3V7DB 3IJCA 3SJLD 3RN1D 4FB1D 3AH8B 4QL1A 2W18A 2QXVA 2H3XA 1YFQA 1JMXB 5EMLB 4ZOYA 5AJAA 3KRXB 5IGQA 3NVXA 4JSNC 1A0RB 4A0AB 2I3SA 5HE3B 4JSXC 1PGUA 3PSLA 4PC0A 4JSPC 4J77A 4JD2C 5FA5B 2G99A 1N6DA 1JMZB 5FKTA 2P9IC 2CO0C 3U4YA 4A09A 3P4FA 1Q47A 1B9YA 2HKRA 3IIYA 3EI4A 2H6NA 3F3PA 4JT5C 4XYHA 5CXBB 4A7JA 2IURA 2H6KA 4J8GA 4A0BA 1GOTB 2BBKH 2HKMA 2I0SA 2QC5A 2PM6B 1MDAH 4ES0A 2AH0A 1NR0A 5EMKB 3SVWD 2B5NA 4GM3A 1R5MA 2IUVA 4GQBB 2G9AA 4FWWA 4FAND 1SQ9A 2J57G 2I0RA 4A11B 3W15A 2CO0A 3ULEC 2AGLA 3SLED 3EI1B 5CXCB 1XHMA 1K8KC 4FA9D 3C99A 1GG2B 4CY2A 1SQJA 3C9CA 5I5MA 2P9PC 5IC7A 2Z2NA 3SFZA 4EWRA 4Y5RD 2P9NC 5B4WA 1B9XA 4QQEA 3RFGA 2CNXA 5EM2B 1GXRA 5FLXg 4GZ8A 3C5MA 5TEFA 3RN0D 5EMMB 2IWFA 3RSEC 3PVUB 2AGXA 3BG0A 4QT8A 5A2Qg 5AMSA 3K27A 4A0BB 4CZYA 4U7AA 4J0WA 3DSMA 2BCJB 3OKYA 1SHYB 3N0DA 3RLMD 2H6QA 1ERJA 4A2MA 2XL2A 3RRMC 3EI2B 3OTTA 3SMRA 3PXTD 3BG1A 3RMZD 3AL8B 4J73A 2EBSA 3ZWLB 3EI3A 3HFQA 3JPXA 2GC7A 5THAA 2HYEA 2AGZA 4CC9A 5GXIA 4J87A 5C9ZB 4ZOZA 4E5ZB 1PI6A 4BL0A 3SBQA 5CYKB 4ZOXA 1VYHC 3PSCB 4CY3A 4TZ4A 4G56B 5TF2A 3PXSD 4CZXA 3OKWA 5FKQA 3NVQA 2P9SC 3OL2A 4GGCA 4U1EI 4UI9R 3I7PA 3OW8A 3I7OA 3SXTD 2P9LC 3DM0A 3MZLA 3DXMC 2I0TA 3J81g 1RI6A 2AQ5A 4CI3A 1P22A 5EARA 5FKSA 3J80g 2OIZA 3I7HA 2H9MA 4GQ2P 3N0EA 1XKSA 4GGAA 4GM8A 5K1CC 4FA4D 4X3EA 4FAVD 3FRXA 4PBYA 4L3GD 2XL3A 5IGOA 4E54A 3I8EA 3MXXA 3I2NA 4A08A 2AH1A 2J55H 4CI2A 5FQDA 2OVQB 2XU7A 2B5LA 3L4MD 5SXMA 1JOFA 3PE7A 2CE9A 4LG8A 2OJYA 2I3TA 4CZVA 2Z2PA 5AFU3 3IKOA 4J81A 2CN3A 2PM9A 1N6EA 3EWEA 4CY1A 4D0KA 4ESGA 4HDJA 4AOWA 4J84A 1S4UX 3MZKA 4CI1A 2OK6A 2IWKA 4A0AA 4O9DA 3UKUC 5K19A 1QNIA 4X60B 2B5MA 4K3JB 3UVKA 4Y7RA 4A09B 2P9UC 3IIWA 3L4OD 3SCYA 5TEEA 3SN6B 1JJUB 3EI4B 3K26A 2H68A 4L3HD 1PEVA 3IJ0A 3IJ1A 4LGNA 4FA1D 3PVWB 4NSXA 3JB9L 2IAAA 2CN2A 2H47A 4N14A 3MMYA 5CXBA 4IMMA 4PXWA 5JWZA 1U2VC 4O3UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I89 A;  3V9F A;  2HXC A;  2HES X;  3I8C A;  2YNN A;  3EG6 A;  3OKT A;  3UVN A;  4BH6 A;  2YB8 B;  2IUP A;  3UVO A;  5HE1 B;  4X63 B;  4I79 A;  2O9K A;  2H9L A;  2YMU A;  2GC4 A;  4AEZ A;  5EMJ B;  1OLZ A;  3FM0 A;  3CFV A;  4A11 A;  5GSA A;  4LG9 A;  4O45 A;  3CFS B;  2YNO A;  3EI1 A;  3KRW B;  1N6F A;  3DXK C;  3A0F A;  3ODT A;  5CXC A;  5HE2 B;  4J78 A;  3DWL C;  1K32 A;  4GM9 A;  5C2V B;  4A2L A;  2UZY B;  5HYN B;  4XYI A;  2CE8 A;  4L1Q D;  3C75 H;  4XEI C;  4GQ1 A;  4JSV C;  2YBA A;  5EM2 A;  3AFC A;  5H14 A;  2H13 A;  3PXW D;  4O3T B;  3ORV D;  2AGY A;  5EAL A;  1TBG A;  2MTA H;  4D6V A;  4H5J A;  1GP2 B;  3AL9 A;  4CY5 A;  5HE0 B;  3F3G A;  3JRO A;  3OKY B;  5IT9 g;  5GXH A;  2Q7Q A;  2PM7 B;  2GNQ A;  1U4C A;  5H1M A;  3UVM A;  5H17 A;  3BWS A;  3SBR A;  3EI3 B;  2OK4 A;  2YNP A;  3EI2 A;  3EMH A;  5IJ8 E;  3AL8 A;  3SHF A;  3VGZ A;  4PSX B;  3SWS D;  2B4E A;  2Z2O A;  4J8B A;  3JAM g;  3GFC A;  4IA9 A;  1OMW B;  4BUJ C;  4J0X A;  4ERQ A;  1MG2 A;  4FHL A;  3GRE A;  5EAP A;  2J56 H;  4ERZ A;  3JZH A;  4PNK B;  2HJB A;  3MKS B;  4E5Z A;  1L0Q A;  4GMB A;  3VH0 A;  4GGD A;  5I5I A;  4Z8L A;  4QRJ A;  2UZX B;  5CYK A;  5C2W B;  3JZN A;  3OL2 B;  4OWR A;  3EU7 A;  4YVD A;  2PBI B;  4MK0 B;  3MKQ A;  2H9P A;  4J86 A;  3UR4 A;  2OVR B;  3B7F A;  4PBZ A;  3RFH A;  1FWX A;  1PBY B;  4J79 A;  5HQG A;  3E0C A;  2AGW A;  1MG3 A;  5TDH B;  1NEX B;  4CI8 A;  2H14 A;  4R7A B;  4E54 B;  3UVL A;  3JRP A;  5IJ7 E;  5KDO B;  3V5W B;  4A08 B;  4JXM A;  3I7K A;  5EAM A;  3CIK B;  2TRC B;  5FXY A;  1TYQ C;  4L9O A;  4H5I A;  4KFM B;  3FGB A;  3VA6 A;  2OVP B;  4PSW B;  2HJ4 A;  2XYI A;  4ZOV A;  4ERY A;  3NVN A;  3SBP A;  4K3I D;  4FA5 D;  3JZG A;  4O1Q D;  4JT6 C;  4OZU A;  5GMK n;  4ZN4 A;  1XIP A;  5I5J A;  4X61 B;  2IUQ A;  2P9K C;  3I7N A;  4J82 A;  2H9N A;  2PM9 B;  3I7L A;  3F3F A;  5FKR A;  3UKR C;  3V7D B;  3IJC A;  3SJL D;  3RN1 D;  4FB1 D;  3AH8 B;  4QL1 A;  2W18 A;  2QXV A;  2H3X A;  1YFQ A;  1JMX B;  5EML B;  4ZOY A;  5AJA A;  3KRX B;  5IGQ A;  3NVX A;  4JSN C;  1A0R B;  4A0A B;  2I3S A;  5HE3 B;  4JSX C;  1PGU A;  3PSL A;  4PC0 A;  4JSP C;  4J77 A;  4JD2 C;  5FA5 B;  2G99 A;  1N6D A;  1JMZ B;  5FKT A;  2P9I C;  2CO0 C;  3U4Y A;  4A09 A;  3P4F A;  1Q47 A;  1B9Y A;  2HKR A;  3IIY A;  3EI4 A;  2H6N A;  3F3P A;  4JT5 C;  4XYH A;  5CXB B;  4A7J A;  2IUR A;  2H6K A;  4J8G A;  4A0B A;  1GOT B;  2BBK H;  2HKM A;  2I0S A;  2QC5 A;  2PM6 B;  1MDA H;  4ES0 A;  2AH0 A;  1NR0 A;  5EMK B;  3SVW D;  2B5N A;  4GM3 A;  1R5M A;  2IUV A;  4GQB B;  2G9A A;  4FWW A;  4FAN D;  1SQ9 A;  2J57 G;  2I0R A;  4A11 B;  3W15 A;  2CO0 A;  3ULE C;  2AGL A;  3SLE D;  3EI1 B;  5CXC B;  1XHM A;  1K8K C;  4FA9 D;  3C99 A;  1GG2 B;  4CY2 A;  1SQJ A;  3C9C A;  5I5M A;  2P9P C;  5IC7 A;  2Z2N A;  3SFZ A;  4EWR A;  4Y5R D;  2P9N C;  5B4W A;  1B9X A;  4QQE A;  3RFG A;  2CNX A;  5EM2 B;  1GXR A;  5FLX g;  4GZ8 A;  3C5M A;  5TEF A;  3RN0 D;  5EMM B;  2IWF A;  3RSE C;  3PVU B;  2AGX A;  3BG0 A;  4QT8 A;  5A2Q g;  5AMS A;  3K27 A;  4A0B B;  4CZY A;  4U7A A;  4J0W A;  3DSM A;  2BCJ B;  3OKY A;  1SHY B;  3N0D A;  3RLM D;  2H6Q A;  1ERJ A;  4A2M A;  2XL2 A;  3RRM C;  3EI2 B;  3OTT A;  3SMR A;  3PXT D;  3BG1 A;  3RMZ D;  3AL8 B;  4J73 A;  2EBS A;  3ZWL B;  3EI3 A;  3HFQ A;  3JPX A;  2GC7 A;  5THA A;  2HYE A;  2AGZ A;  4CC9 A;  5GXI A;  4J87 A;  5C9Z B;  4ZOZ A;  4E5Z B;  1PI6 A;  4BL0 A;  3SBQ A;  5CYK B;  4ZOX A;  1VYH C;  3PSC B;  4CY3 A;  4TZ4 A;  4G56 B;  5TF2 A;  3PXS D;  4CZX A;  3OKW A;  5FKQ A;  3NVQ A;  2P9S C;  3OL2 A;  4GGC A;  4U1E I;  4UI9 R;  3I7P A;  3OW8 A;  3I7O A;  3SXT D;  2P9L C;  3DM0 A;  3MZL A;  3DXM C;  2I0T A;  3J81 g;  1RI6 A;  2AQ5 A;  4CI3 A;  1P22 A;  5EAR A;  5FKS A;  3J80 g;  2OIZ A;  3I7H A;  2H9M A;  4GQ2 P;  3N0E A;  1XKS A;  4GGA A;  4GM8 A;  5K1C C;  4FA4 D;  4X3E A;  4FAV D;  3FRX A;  4PBY A;  4L3G D;  2XL3 A;  5IGO A;  4E54 A;  3I8E A;  3MXX A;  3I2N A;  4A08 A;  2AH1 A;  2J55 H;  4CI2 A;  5FQD A;  2OVQ B;  2XU7 A;  2B5L A;  3L4M D;  5SXM A;  1JOF A;  3PE7 A;  2CE9 A;  4LG8 A;  2OJY A;  2I3T A;  4CZV A;  2Z2P A;  5AFU 3;  3IKO A;  4J81 A;  2CN3 A;  2PM9 A;  1N6E A;  3EWE A;  4CY1 A;  4D0K A;  4ESG A;  4HDJ A;  4AOW A;  4J84 A;  1S4U X;  3MZK A;  4CI1 A;  2OK6 A;  2IWK A;  4A0A A;  4O9D A;  3UKU C;  5K19 A;  1QNI A;  4X60 B;  2B5M A;  4K3J B;  3UVK A;  4Y7R A;  4A09 B;  2P9U C;  3IIW A;  3L4O D;  3SCY A;  5TEE A;  3SN6 B;  1JJU B;  3EI4 B;  3K26 A;  2H68 A;  4L3H D;  1PEV A;  3IJ0 A;  3IJ1 A;  4LGN A;  4FA1 D;  3PVW B;  4NSX A;  3JB9 L;  2IAA A;  2CN2 A;  2H47 A;  4N14 A;  3MMY A;  5CXB A;  4IMM A;  4PXW A;  5JWZ A;  1U2V C;  4O3U B; 
#chains in the Genus database with same CATH topology
 3I89 A;  5E6R A;  3V9F A;  1JTD B;  2HXC A;  2HES X;  4G1M A;  3I8C A;  2YNN A;  3EG6 A;  3OKT A;  3UVN A;  4BH6 A;  2YB8 B;  5E6S A;  4Z7O A;  2IUP A;  3UVO A;  5HE1 B;  4X63 B;  4I79 A;  2O9K A;  2H9L A;  2VC2 A;  2YMU A;  2GC4 A;  4AEZ A;  5EMJ B;  1OLZ A;  3FM0 A;  3CFV A;  2VZ3 A;  4A11 A;  5GSA A;  4LG9 A;  4O45 A;  3CFS B;  2YNO A;  3EI1 A;  3KRW B;  1UTC A;  1N6F A;  3DXK C;  3A0F A;  3ODT A;  5CXC A;  5HE2 B;  4J78 A;  3DWL C;  4JHN A;  1K32 A;  4AN0 A;  3MUN A;  3O4J A;  4GM9 A;  5C2V B;  4A2L A;  2UZY B;  5HYN B;  1H2X A;  4XYI A;  2CE8 A;  4L1Q D;  3C75 H;  4XEI C;  2QZP A;  4GQ1 A;  4JSV C;  2YBA A;  3MVD K;  5EM2 A;  3AFC A;  5H14 A;  3ZDX A;  2H13 A;  3PXW D;  4O3T B;  3DDU A;  2AGY A;  3ORV D;  5EAL A;  1I2M B;  4AMZ A;  1TBG A;  2MTA H;  4D6V A;  4H5J A;  1GP2 B;  3AL9 A;  2EIC A;  4CY5 A;  5HE0 B;  2HU8 A;  4WK4 A;  3F3G A;  3JRO A;  3OKY B;  5M61 A;  5IT9 g;  4RE5 A;  4G55 A;  5GXH A;  2Q7Q A;  2PM7 B;  2GNQ A;  4UM8 A;  3VI4 A;  1U4C A;  5H1M A;  3UVM A;  5H17 A;  3BWS A;  3SBR A;  3EI3 B;  2OK4 A;  2YNP A;  3EI2 A;  3EMH A;  5IJ8 E;  1TYE A;  3AL8 A;  3SHF A;  3VGZ A;  4PSX B;  3SWS D;  2B4E A;  2Z2O A;  4J8B A;  3JAM g;  3GFC A;  3NID A;  1M1X A;  4IA9 A;  1OMW B;  4BUJ C;  4J0X A;  4ERQ A;  1MG2 A;  4MMZ A;  3O4I A;  4FHL A;  3GRE A;  5EAP A;  2J56 H;  4ERZ A;  3JZH A;  3O4G A;  4PNK B;  2HJB A;  3ZE1 A;  3MKS B;  4E5Z A;  1L0Q A;  4GMB A;  3VH0 A;  4GGD A;  1UOO A;  5I5I A;  4NEN A;  3EQ8 A;  4Z8L A;  4QRJ A;  1UOQ A;  2UZX B;  5CYK A;  5C2W B;  3JZN A;  3OL2 B;  4OWR A;  3EU7 A;  4YVD A;  3QHY B;  2PBI B;  4MK0 B;  3MKQ A;  4AX4 A;  2H9P A;  4J86 A;  3UR4 A;  2OVR B;  3B7F A;  3V4V A;  4PBZ A;  3RFH A;  4WJK A;  3K6S A;  3GC3 B;  1FWX A;  1PBY B;  3IJE A;  4BCB A;  4J79 A;  5HQG A;  3E0C A;  2AGW A;  4NC4 A;  1MG3 A;  2XE4 A;  5TDH B;  1NEX B;  4CI8 A;  2H14 A;  4R7A B;  4E54 B;  3UVL A;  5M5S A;  3JRP A;  5IJ7 E;  5KDO B;  3V5W B;  4A08 B;  4JXM A;  3I7K A;  5EAM A;  3CIK B;  1T2X A;  2TRC B;  5FXY A;  1BPO A;  1TYQ C;  4L9O A;  4H5I A;  4KFM B;  5M5U A;  3FGB A;  3VA6 A;  5E6U A;  2OVP B;  4PSW B;  2BKL A;  2HJ4 A;  2XYI A;  4ZOV A;  4ERY A;  3NVN A;  3SBP A;  4K3I D;  4FA5 D;  3JZG A;  4O1Q D;  4JT6 C;  4OZU A;  5GMK n;  4ZN4 A;  1XIP A;  5I5J A;  4X61 B;  1QFM A;  2XDW A;  2IUQ A;  2P9K C;  3I7N A;  4J82 A;  3K72 A;  2H9N A;  2PM9 B;  3I7L A;  3F3F A;  1O6G A;  3NIF A;  2VDO A;  5FKR A;  3UKR C;  3V7D B;  2QR5 A;  3IJC A;  3SJL D;  3RN1 D;  4FB1 D;  3AH8 B;  4QL1 A;  2W18 A;  3FCS A;  1GOG A;  2QXV A;  2H3X A;  1YFQ A;  1JMX B;  5EML B;  5HDB A;  4ZOY A;  3T3P A;  5AJA A;  3KRX B;  3IUR A;  5IGQ A;  3NVX A;  2EIB A;  1A0R B;  4JSN C;  4A0A B;  2I3S A;  5HE3 B;  1H2Z A;  4G1E A;  4JSX C;  3K71 A;  1PGU A;  3PSL A;  4PC0 A;  4JSP C;  2EIE A;  4J77 A;  1E8N A;  4JD2 C;  5FA5 B;  2G99 A;  4O2W A;  1N6D A;  1JMZ B;  5FKT A;  2P9I C;  2CO0 C;  1UOP A;  3U4Y A;  5M5T A;  4A09 A;  3P4F A;  4DNW A;  1Q47 A;  1C9I A;  1B9Y A;  2HKR A;  3NIG A;  3IIY A;  1GOH A;  2H6N A;  3F3P A;  3EI4 A;  4JT5 C;  3IUJ A;  4XYH A;  5CXB B;  4A7J A;  2IUR A;  2H6K A;  4J8G A;  4A0B A;  4UM9 A;  1GOT B;  2BBK H;  3IUN A;  4BP8 A;  2HKM A;  2I0S A;  2QC5 A;  2PM6 B;  1QFS A;  2HU5 A;  1MDA H;  3O4H A;  2HU7 A;  4DNV A;  2AH0 A;  1NR0 A;  5EMK B;  3FCU A;  4ES0 A;  3SVW D;  2B5N A;  1A12 A;  4GM3 A;  1R5M A;  2IUV A;  4GQB B;  2G9A A;  4FWW A;  1VE7 A;  4FAN D;  1SQ9 A;  2J57 G;  2VDR A;  2I0R A;  4A11 B;  4MMX A;  3W15 A;  1VE6 A;  3GD1 I;  2CO0 A;  2JKX A;  3ULE C;  2AGL A;  3SLE D;  3EI1 B;  1YR2 A;  5CXC B;  1XHM A;  1K8K C;  4FA9 D;  3C99 A;  1GG2 B;  4CY2 A;  1SQJ A;  3C9C A;  5I5M A;  2P9P C;  5IC7 A;  2Z2N A;  3SFZ A;  4NAA A;  3KCI A;  4Y5R D;  2P9N C;  4EWR A;  5B4W A;  1B9X A;  4QQE A;  5FFO A;  3RFG A;  2CNX A;  5EM2 B;  1GXR A;  5FLX g;  4GZ8 A;  4BCC A;  3C5M A;  5TEF A;  3RN0 D;  5EMM B;  2IWF A;  3RSE C;  3PVU B;  3ZDZ A;  2AGX A;  2VDK A;  3BG0 A;  4QT8 A;  3V4P A;  1VZ2 A;  4AN1 A;  5A2Q g;  5AMS A;  3K27 A;  4A0B B;  4CZY A;  4U7A A;  4J0W A;  4D9S A;  3MUO A;  3DSM A;  2BCJ B;  3IUL A;  3OKY A;  1SHY B;  3N0D A;  3RLM D;  3EQ9 A;  2H6Q A;  1ERJ A;  4A2M A;  2XL2 A;  3RRM C;  3QI0 A;  3EI2 B;  3OTT A;  3SMR A;  3PXT D;  3BG1 A;  3RMZ D;  3AL8 B;  4J73 A;  2EBS A;  3ZWL B;  3ZE0 A;  3EI3 A;  3HFQ A;  4DNU A;  3JPX A;  2GC7 A;  4Z7N A;  5THA A;  2HYE A;  2AGZ A;  4CC9 A;  5GXI A;  4J87 A;  3OF7 A;  3T3M A;  5C9Z B;  4ZOZ A;  4E5Z B;  1PI6 A;  1L5G A;  3IUM A;  4BL0 A;  4QAM A;  3SBQ A;  5CYK B;  4WK0 A;  4ZOX A;  1VYH C;  3PSC B;  4CY3 A;  4TZ4 A;  4Z7Q A;  4G56 B;  5TF2 A;  3PXS D;  4CZX A;  3OKW A;  5FKQ A;  3NVQ A;  5C92 A;  2P9S C;  3OL2 A;  4GGC A;  4NBM A;  4U1E I;  4UI9 R;  3I7P A;  3OW8 A;  3I7O A;  3SXT D;  2P9L C;  3DM0 A;  3MZL A;  3DXM C;  2I0T A;  3J81 g;  4L1M A;  2VZ1 A;  1RI6 A;  2AQ5 A;  2XZG A;  4CI3 A;  4BCD A;  3IVM A;  1P22 A;  5EAR A;  1O6F A;  5FKS A;  3J80 g;  4WK2 A;  2OIZ A;  3I7H A;  5C86 A;  2H9M A;  4GQ2 P;  3N0E A;  4MMY A;  1XKS A;  4GGA A;  2WQ8 A;  4GM8 A;  5K1C C;  4FA4 D;  4X3E A;  4FAV D;  3FRX A;  4PBY A;  4L3G D;  2XL3 A;  5IGO A;  4E54 A;  2VDL A;  3I8E A;  1E5T A;  3MXX A;  3I2N A;  4A08 A;  2AH1 A;  2J55 H;  4CI2 A;  5FQD A;  1VZ3 A;  2OVQ B;  2XU7 A;  2B5L A;  3L4M D;  5SXM A;  1JOF A;  3PE7 A;  2CE9 A;  2VDM A;  4IRZ A;  4LG8 A;  3ZE2 A;  3ZDY A;  2OJY A;  2I3T A;  4JHP C;  4CZV A;  2Z2P A;  5AFU 3;  4RE6 A;  4AMY A;  4O02 A;  3IKO A;  4J81 A;  2CN3 A;  2VDQ A;  2PM9 A;  1N6E A;  3EWE A;  2EID A;  5M5R A;  4CY1 A;  4D0K A;  4ESG A;  4HDJ A;  4AOW A;  4J84 A;  1S4U X;  3MZK A;  4CI1 A;  2OK6 A;  2IWK A;  1H2Y A;  3VI3 A;  4BP9 A;  4A0A A;  4O9D A;  5M5V A;  3UKU C;  5K19 A;  1QNI A;  1H2W A;  4X60 B;  2B5M A;  4K3J B;  3UVK A;  1GOF A;  3EQ7 A;  4Y7R A;  4A09 B;  2P9U C;  1U8C A;  2VDN A;  3IIW A;  3L4O D;  3SCY A;  5TEE A;  1JV2 A;  3IUQ A;  1JJU B;  3EI4 B;  3SN6 B;  3K26 A;  2H68 A;  1K3I A;  4L3H D;  1PEV A;  3IJ0 A;  3IJ1 A;  4LGN A;  4FA1 D;  2VDP A;  3PVW B;  4NSX A;  3JB9 L;  2IAA A;  2CN2 A;  2H47 A;  4N14 A;  1C9L A;  1E8M A;  3MMY A;  5CXB A;  5FFG A;  4IMM A;  4PXW A;  5JWZ A;  1U2V C;  4O3U B; 
#chains in the Genus database with same CATH homology
 3I89 A;  3V9F A;  2HXC A;  2HES X;  3I8C A;  2YNN A;  3EG6 A;  3OKT A;  3UVN A;  4BH6 A;  2YB8 B;  2IUP A;  3UVO A;  5HE1 B;  4X63 B;  4I79 A;  2O9K A;  2H9L A;  2YMU A;  2GC4 A;  4AEZ A;  5EMJ B;  1OLZ A;  3FM0 A;  3CFV A;  4A11 A;  5GSA A;  4LG9 A;  4O45 A;  3CFS B;  2YNO A;  3EI1 A;  3KRW B;  1N6F A;  3DXK C;  3A0F A;  3ODT A;  5CXC A;  5HE2 B;  4J78 A;  3DWL C;  1K32 A;  4GM9 A;  5C2V B;  4A2L A;  2UZY B;  5HYN B;  4XYI A;  2CE8 A;  4L1Q D;  3C75 H;  4XEI C;  4GQ1 A;  4JSV C;  2YBA A;  5EM2 A;  3AFC A;  5H14 A;  2H13 A;  3PXW D;  4O3T B;  3ORV D;  2AGY A;  5EAL A;  1TBG A;  2MTA H;  4D6V A;  4H5J A;  1GP2 B;  3AL9 A;  4CY5 A;  5HE0 B;  3F3G A;  3JRO A;  3OKY B;  5IT9 g;  5GXH A;  2Q7Q A;  2PM7 B;  2GNQ A;  1U4C A;  5H1M A;  3UVM A;  5H17 A;  3BWS A;  3SBR A;  3EI3 B;  2OK4 A;  2YNP A;  3EI2 A;  3EMH A;  5IJ8 E;  3AL8 A;  3SHF A;  3VGZ A;  4PSX B;  3SWS D;  2B4E A;  2Z2O A;  4J8B A;  3JAM g;  3GFC A;  4IA9 A;  1OMW B;  4BUJ C;  4J0X A;  4ERQ A;  1MG2 A;  4FHL A;  3GRE A;  5EAP A;  2J56 H;  4ERZ A;  3JZH A;  4PNK B;  2HJB A;  3MKS B;  4E5Z A;  1L0Q A;  4GMB A;  3VH0 A;  4GGD A;  5I5I A;  4Z8L A;  4QRJ A;  2UZX B;  5CYK A;  5C2W B;  3JZN A;  3OL2 B;  4OWR A;  3EU7 A;  4YVD A;  2PBI B;  4MK0 B;  3MKQ A;  2H9P A;  4J86 A;  3UR4 A;  2OVR B;  3B7F A;  4PBZ A;  3RFH A;  1FWX A;  1PBY B;  4J79 A;  5HQG A;  3E0C A;  2AGW A;  1MG3 A;  5TDH B;  1NEX B;  4CI8 A;  2H14 A;  4R7A B;  4E54 B;  3UVL A;  3JRP A;  5IJ7 E;  5KDO B;  3V5W B;  4A08 B;  4JXM A;  3I7K A;  5EAM A;  3CIK B;  2TRC B;  5FXY A;  1TYQ C;  4L9O A;  4H5I A;  4KFM B;  3FGB A;  3VA6 A;  2OVP B;  4PSW B;  2HJ4 A;  2XYI A;  4ZOV A;  4ERY A;  3NVN A;  3SBP A;  4K3I D;  4FA5 D;  3JZG A;  4O1Q D;  4JT6 C;  4OZU A;  5GMK n;  4ZN4 A;  1XIP A;  5I5J A;  4X61 B;  2IUQ A;  2P9K C;  3I7N A;  4J82 A;  2H9N A;  2PM9 B;  3I7L A;  3F3F A;  5FKR A;  3UKR C;  3V7D B;  3IJC A;  3SJL D;  3RN1 D;  4FB1 D;  3AH8 B;  4QL1 A;  2W18 A;  2QXV A;  2H3X A;  1YFQ A;  1JMX B;  5EML B;  4ZOY A;  5AJA A;  3KRX B;  5IGQ A;  3NVX A;  4JSN C;  1A0R B;  4A0A B;  2I3S A;  5HE3 B;  4JSX C;  1PGU A;  3PSL A;  4PC0 A;  4JSP C;  4J77 A;  4JD2 C;  5FA5 B;  2G99 A;  1N6D A;  1JMZ B;  5FKT A;  2P9I C;  2CO0 C;  3U4Y A;  4A09 A;  3P4F A;  1Q47 A;  1B9Y A;  2HKR A;  3IIY A;  3EI4 A;  2H6N A;  3F3P A;  4JT5 C;  4XYH A;  5CXB B;  4A7J A;  2IUR A;  2H6K A;  4J8G A;  4A0B A;  1GOT B;  2BBK H;  2HKM A;  2I0S A;  2QC5 A;  2PM6 B;  1MDA H;  4ES0 A;  2AH0 A;  1NR0 A;  5EMK B;  3SVW D;  2B5N A;  4GM3 A;  1R5M A;  2IUV A;  4GQB B;  2G9A A;  4FWW A;  4FAN D;  1SQ9 A;  2J57 G;  2I0R A;  4A11 B;  3W15 A;  2CO0 A;  3ULE C;  2AGL A;  3SLE D;  3EI1 B;  5CXC B;  1XHM A;  1K8K C;  4FA9 D;  3C99 A;  1GG2 B;  4CY2 A;  1SQJ A;  3C9C A;  5I5M A;  2P9P C;  5IC7 A;  2Z2N A;  3SFZ A;  4EWR A;  4Y5R D;  2P9N C;  5B4W A;  1B9X A;  4QQE A;  3RFG A;  2CNX A;  5EM2 B;  1GXR A;  5FLX g;  4GZ8 A;  3C5M A;  5TEF A;  3RN0 D;  5EMM B;  2IWF A;  3RSE C;  3PVU B;  2AGX A;  3BG0 A;  4QT8 A;  5A2Q g;  5AMS A;  3K27 A;  4A0B B;  4CZY A;  4U7A A;  4J0W A;  3DSM A;  2BCJ B;  3OKY A;  1SHY B;  3N0D A;  3RLM D;  2H6Q A;  1ERJ A;  4A2M A;  2XL2 A;  3RRM C;  3EI2 B;  3OTT A;  3SMR A;  3PXT D;  3BG1 A;  3RMZ D;  3AL8 B;  4J73 A;  2EBS A;  3ZWL B;  3EI3 A;  3HFQ A;  3JPX A;  2GC7 A;  5THA A;  2HYE A;  2AGZ A;  4CC9 A;  5GXI A;  4J87 A;  5C9Z B;  4ZOZ A;  4E5Z B;  1PI6 A;  4BL0 A;  3SBQ A;  5CYK B;  4ZOX A;  1VYH C;  3PSC B;  4CY3 A;  4TZ4 A;  4G56 B;  5TF2 A;  3PXS D;  4CZX A;  3OKW A;  5FKQ A;  3NVQ A;  2P9S C;  3OL2 A;  4GGC A;  4U1E I;  4UI9 R;  3I7P A;  3OW8 A;  3I7O A;  3SXT D;  2P9L C;  3DM0 A;  3MZL A;  3DXM C;  2I0T A;  3J81 g;  1RI6 A;  2AQ5 A;  4CI3 A;  1P22 A;  5EAR A;  5FKS A;  3J80 g;  2OIZ A;  3I7H A;  2H9M A;  4GQ2 P;  3N0E A;  1XKS A;  4GGA A;  4GM8 A;  5K1C C;  4FA4 D;  4X3E A;  4FAV D;  3FRX A;  4PBY A;  4L3G D;  2XL3 A;  5IGO A;  4E54 A;  3I8E A;  3MXX A;  3I2N A;  4A08 A;  2AH1 A;  2J55 H;  4CI2 A;  5FQD A;  2OVQ B;  2XU7 A;  2B5L A;  3L4M D;  5SXM A;  1JOF A;  3PE7 A;  2CE9 A;  4LG8 A;  2OJY A;  2I3T A;  4CZV A;  2Z2P A;  5AFU 3;  3IKO A;  4J81 A;  2CN3 A;  2PM9 A;  1N6E A;  3EWE A;  4CY1 A;  4D0K A;  4ESG A;  4HDJ A;  4AOW A;  4J84 A;  1S4U X;  3MZK A;  4CI1 A;  2OK6 A;  2IWK A;  4A0A A;  4O9D A;  3UKU C;  5K19 A;  1QNI A;  4X60 B;  2B5M A;  4K3J B;  3UVK A;  4Y7R A;  4A09 B;  2P9U C;  3IIW A;  3L4O D;  3SCY A;  5TEE A;  3SN6 B;  1JJU B;  3EI4 B;  3K26 A;  2H68 A;  4L3H D;  1PEV A;  3IJ0 A;  3IJ1 A;  4LGN A;  4FA1 D;  3PVW B;  4NSX A;  3JB9 L;  2IAA A;  2CN2 A;  2H47 A;  4N14 A;  3MMY A;  5CXB A;  4IMM A;  4PXW A;  5JWZ A;  1U2V C;  4O3U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...