3BG0A

Architecture of a coat for the nuclear pore membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
291
structure length
283
Chain Sequence
DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, hydrolase
molecule keywords Protein SEC13 homolog
total genus 52
structure length 283
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg0A00
4CI1A 3NVQA 5EMMB 4J79A 4GQ2P 1JOFA 3RLMD 4A0AB 2IURA 2BCJB 3CFSB 1GP2B 2XL2A 1B9YA 3OW8A 3ULEC 5EALA 2CE9A 3FM0A 4ZOYA 2AGYA 4FB1D 3GFCA 3I7LA 3P4FA 4ERQA 4FA4D 4JSNC 1GG2B 2AGXA 3N0DA 2CE8A 3BG1A 2Q7QA 3JZHA 3AL8B 4JSPC 4A11B 3I7NA 4ERYA 4ZN4A 2GC7A 2Z2OA 4L3HD 5K19A 1SQ9A 1NR0A 2HKMA 4LG9A 1L0QA 3VA6A 2W18A 2J55H 3SBRA 5HE0B 5AMSA 3OKYA 2AH0A 4ZOVA 4TZ4A 5IJ7E 3F3PA 2H13A 5FXYA 3L4OD 4E54A 1PGUA 4J73A 5IC7A 4A2LA 3PXWD 5THAA 4OZUA 4R7AB 4O9DA 3MKQA 4X63B 3JZGA 3AL9A 4CY5A 4K3JB 3VGZA 3AL8A 2H6QA 3I8CA 3SWSD 5I5MA 5CXCA 4JXMA 4CY1A 4A0BB 3C5MA 3RRMC 3MZLA 2TRCB 4GM3A 2J56H 3OKYB 1GXRA 3EI2A 5GXIA 4J81A 5EARA 4CZXA 2YNOA 3K27A 4EWRA 3NVXA 4MK0B 4X60B 4ESGA 5HYNB 4PNKB 3V7DB 4XYIA 4O1QD 1B9XA 4Z8LA 2Z2PA 3UVOA 3EMHA 5IT9g 5FLXg 2BBKH 5C2WB 2G9AA 4GQBB 4J0WA 4FWWA 5HE3B 4JT6C 4ERZA 4A08B 3AH8B 3OTTA 4LG8A 4J78A 4J8GA 4ZOZA 1ERJA 2IUVA 4FA9D 3SVWD 1P22A 3RSEC 5GSAA 4ZOXA 3C9CA 2P9LC 2I0SA 2XU7A 3C75H 1Q47A 3PVWB 4IA9A 3UKRC 4PBYA 2GC4A 4QT8A 3W15A 1PEVA 3I8EA 4FA1D 2HESX 5EAMA 1N6FA 3SFZA 4GZ8A 4GQ1A 3U4YA 4XYHA 3KRWB 5C2VB 1FWXA 5IGQA 2AH1A 3JZNA 1JJUB 4G56B 2OVRB 3RMZD 4D0KA 4H5IA 1JMXB 4KFMB 2B5NA 4PBZA 1NEXB 2O9KA 2P9SC 5TEEA 1S4UX 2UZXB 5IJ8E 3JB9L 4JT5C 4FHLA 4J82A 2B5LA 4BL0A 4QRJA 4CI3A 3EI1A 1MG3A 3E0CA 4OWRA 4J0XA 4IMMA 3JAMg 5EM2A 2CO0A 4FAVD 2AGZA 2B5MA 4U1EI 4X3EA 2XYIA 2G99A 4JSVC 2PM9B 4O3TB 3SN6B 4BUJC 2I3SA 2OVPB 2CN2A 4FAND 2PBIB 2MTAH 1JMZB 1OMWB 3EI2B 4NSXA 5EMKB 2AGWA 3MKSB 1SHYB 5JWZA 2CO0C 3UKUC 3CFVA 3UVMA 2H47A 3I7OA 2PM6B 3IIWA 2H6NA 3SJLD 2J57G 4K3ID 5TDHB 3RN1D 1N6DA 3OKTA 5FKRA 5H17A 4D6VA 3OKWA 3DXMC 3I7PA 3K26A 3UVNA 4I79A 4LGNA 3N0EA 5CYKB 3UVLA 4GMBA 4A7JA 4CY2A 2H6KA 3PXSD 3SMRA 3BG0A 4CZVA 3JRPA 3A0FA 3RFHA 3SCYA 4YVDA 4A09B 2IWFA 3EU7A 2UZYB 2CNXA 4CC9A 4GM9A 2AQ5A 4J84A 4O45A 3MXXA 5I5IA 2H9MA 1SQJA 3EI4A 3DWLC 2YNPA 4L1QD 1A0RB 3FGBA 4E54B 3F3FA 2YBAA 2B4EA 4PC0A 2OVQB 3DSMA 1TYQC 4GM8A 4PSXB 3C99A 3I7HA 3PSCB 2YMUA 4UI9R 3IIYA 2HXCA 3DM0A 3PVUB 5AJAA 3EI3A 3EG6A 5FKQA 5I5JA 4QQEA 2IUQA 2H14A 2P9KC 5B4WA 2PM7B 4A09A 5FQDA 4CY3A 4AEZA 3ORVD 4GGCA 3JROA 3PXTD 1QNIA 3SLED 4J87A 2XL3A 2IAAA 3EI4B 1OLZA 4L3GD 3L4MD 2HKRA 3MZKA 3RN0D 4A0BA 3EI1B 3J80g 2Z2NA 4CI8A 1RI6A 4A08A 3GREA 4N14A 2P9IC 3KRXB 3RFGA 3EI3B 4FA5D 3HFQA 4E5ZA 2OK4A 2YNNA 2OIZA 3BWSA 5HE2B 3ODTA 2YB8B 2CN3A 5EMJB 2I0RA 1TBGA 4ES0A 4J8BA 3DXKC 2HJBA 4O3UB 5HQGA 4BH6A 2QXVA 5KDOB 2H9NA 3ZWLB 1XKSA 4CZYA 5TF2A 5TEFA 4A11A 4J77A 1R5MA 2IUPA 3VH0A 3OL2B 2OK6A 4JD2C 4J86A 1YFQA 5AFU3 5HE1B 4GGAA 5H14A 2H3XA 3IJCA 4QL1A 2H9PA 1VYHC 2OJYA 3UR4A 4AOWA 3J81g 2I3TA 4CI2A 3SXTD 3SHFA 2H9LA 3JPXA 2EBSA 4E5ZB 3I2NA 3FRXA 5H1MA 5CYKA 2H68A 2HYEA 4HDJA 1K32A 2AGLA 2QC5A 5GMKn 5A2Qg 3V5WB 3CIKB 3F3GA 4PSWB 5CXBB 4A2MA 2P9UC 1XIPA 4JSXC 3SBQA 1MG2A 2I0TA 3OL2A 3I7KA 4Y7RA 5CXCB 1U2VC 5K1CC 1PBYB 3PE7A 1PI6A 4X61B 5GXHA 1MDAH 3SBPA 5C9ZB 3B7FA 2GNQA 5EM2B 4XEIC 4A0AA 3UVKA 5IGOA 3PSLA 5FKSA 3IKOA 1GOTB 1K8KC 3EWEA 4PXWA 4Y5RD 3NVNA 2IWKA 1N6EA 2HJ4A 3V9FA 5FA5B 2P9PC 2P9NC 1U4CA 3AFCA 4U7AA 5SXMA 3IJ0A 3MMYA 5CXBA 3I89A 4GGDA 5EAPA 5EMLB 4H5JA 2PM9A 4L9OA 5FKTA 3IJ1A 1XHMA
chains in the Genus database with same CATH superfamily
4CI1A 3NVQA 5EMMB 4J79A 4QAMA 4GQ2P 1JOFA 2EIDA 3NIGA 3RLMD 4A0AB 2IURA 1UTCA 2BCJB 3CFSB 1GP2B 2XL2A 1B9YA 3OW8A 3ULEC 5EALA 2CE9A 3FM0A 4ZOYA 2VZ1A 2WQ8A 2AGYA 1QFMA 4FB1D 3GFCA 4WJKA 3I7LA 1XHMA 3ZDXA 3P4FA 3IURA 4ERQA 4FA4D 4JSNC 1GG2B 2AGXA 3GD1I 3N0DA 2CE8A 3BG1A 2Q7QA 3JZHA 3AL8B 4JSPC 4A11B 2VDMA 1VE7A 3I7NA 4WK4A 4ERYA 2GC7A 4ZN4A 2Z2OA 4BCBA 3ZDZA 4L3HD 5K19A 1SQ9A 1NR0A 2HKMA 4LG9A 1L0QA 3VA6A 2W18A 4Z7OA 2J55H 3SBRA 5HE0B 2JKXA 5AMSA 3OKYA 5E6UA 2AH0A 4ZOVA 2QR5A 1I2MB 4TZ4A 5IJ7E 3F3PA 2H13A 5FXYA 3L4OD 4E54A 1PGUA 4J73A 5IC7A 2EICA 4A2LA 1M1XA 1TYEA 4NENA 4D9SA 3PXWD 5THAA 4OZUA 4R7AB 4O9DA 5FFOA 3MKQA 4X63B 2VDLA 3JZGA 3AL9A 4CY5A 4K3JB 3VGZA 3AL8A 2H6QA 3I8CA 3SWSD 5I5MA 5CXCA 5M5SA 3IVMA 4JXMA 4CY1A 4A0BB 3C5MA 3RRMC 3MZLA 2TRCB 4GM3A 2J56H 3OKYB 1GXRA 3EI2A 3ZE1A 5GXIA 4J81A 5EARA 4CZXA 2YNOA 3K27A 4NC4A 4EWRA 3MUNA 3NVXA 4MK0B 1YR2A 4X60B 4ESGA 5HYNB 4PNKB 4DNWA 3K72A 3V7DB 4XYIA 4O1QD 3QHYB 4MMYA 1H2ZA 1B9XA 4Z8LA 2Z2PA 3UVOA 3EMHA 5IT9g 5FLXg 2BBKH 5C2WB 2G9AA 4GQBB 4J0WA 4FWWA 5HE3B 4JT6C 4ERZA 2VDPA 4A08B 3FCSA 3AH8B 3OTTA 4LG8A 4IRZA 4J78A 4J8GA 1UOOA 4BP8A 4ZOZA 3FCUA 1ERJA 4G55A 2IUVA 1E8MA 4FA9D 3SVWD 5M5UA 1P22A 3RSEC 4AN1A 5GSAA 5C92A 4ZOXA 3C9CA 2P9LC 2I0SA 2XU7A 3C75H 1Q47A 3PVWB 4IA9A 3UKRC 1E5TA 4PBYA 2GC4A 4QT8A 3W15A 1PEVA 3I8EA 4FA1D 2HESX 5EAMA 1N6FA 1JV2A 4G1EA 3MUOA 3SFZA 4GZ8A 4GQ1A 1H2YA 3U4YA 3V4VA 4XYHA 4BP9A 3KRWB 5C2VB 5HDBA 3VI3A 1FWXA 5IGQA 1VZ3A 2HU7A 2AH1A 3JZNA 4BCDA 3IUNA 1JJUB 4G56B 2OVRB 3RMZD 4D0KA 4H5IA 1JMXB 4KFMB 3NIDA 2B5NA 4PBZA 1NEXB 2O9KA 2P9SC 5TEEA 1S4UX 2UZXB 1VZ2A 2VDQA 5IJ8E 3JB9L 4JT5C 4FHLA 4O02A 4J82A 2B5LA 4BL0A 4QRJA 4CI3A 3EI1A 1MG3A 3E0CA 4OWRA 4J0XA 3T3MA 4IMMA 3JAMg 2VZ3A 5EM2A 1K3IA 2CO0A 4FAVD 2AGZA 2B5MA 4G1MA 4U1EI 4X3EA 2XYIA 2G99A 4JSVC 4MMZA 2PM9B 4O3TB 1O6GA 3O4GA 3VI4A 3ZE0A 3SN6B 4BUJC 1T2XA 2I3SA 2OVPB 2CN2A 3IUMA 4FAND 2PBIB 2MTAH 4UM9A 1JMZB 1BPOA 4O2WA 1OMWB 3QI0A 3EI2B 1H2WA 4NSXA 2HU8A 5EMKB 2AGWA 2EIEA 3MKSB 1SHYB 5JWZA 2CO0C 3UKUC 3CFVA 3UVMA 2H47A 1GOGA 3I7OA 2PM6B 3IIWA 2H6NA 3SJLD 2J57G 4K3ID 3IUQA 5TDHB 2XDWA 3RN1D 1N6DA 3OKTA 5FKRA 5H17A 4D6VA 4NBMA 3OKWA 3DXMC 3I7PA 3IUJA 3K26A 3UVNA 4I79A 4LGNA 3N0EA 2VDOA 5CYKB 4GMBA 3UVLA 3V4PA 4A7JA 4CY2A 2H6KA 3PXSD 3SMRA 3BG0A 4CZVA 3JRPA 4DNVA 3A0FA 3RFHA 3MVDK 3SCYA 4YVDA 4A09B 5FFGA 2IWFA 3EU7A 2UZYB 3GC3B 2CNXA 4CC9A 4GM9A 2VDNA 2AQ5A 4J84A 4O45A 3MXXA 5I5IA 2XE4A 2H9MA 1SQJA 3EI4A 3DWLC 2YNPA 4L1QD 1A0RB 3FGBA 4E54B 2HU5A 2YBAA 2B4EA 3F3FA 1A12A 4PC0A 4AX4A 4WK0A 2OVQB 3DSMA 1TYQC 4GM8A 4PSXB 3C99A 3I7HA 3PSCB 2YMUA 4UI9R 3IIYA 1C9IA 2HXCA 3DM0A 2BKLA 3PVUB 4AMZA 4NAAA 5AJAA 4AN0A 3EI3A 3EG6A 5FKQA 5I5JA 4QQEA 2IUQA 2H14A 2P9KC 5B4WA 2PM7B 4A09A 3OF7A 5FQDA 4CY3A 4AEZA 3ORVD 4WK2A 4GGCA 4RE6A 3JROA 1VE6A 3O4IA 1H2XA 3PXTD 1QNIA 3SLED 2QZPA 4J87A 2XL3A 5M61A 2IAAA 3EI4B 1OLZA 4L3GD 3L4MD 4DNUA 3K71A 2HKRA 3MZKA 3RN0D 4A0BA 3ZE2A 2EIBA 3EI1B 3T3PA 3J80g 2VDRA 2Z2NA 4CI8A 1RI6A 2VDKA 4A08A 3GREA 3KCIA 4N14A 4JHPC 2P9IC 3KRXB 3RFGA 3EI3B 4FA5D 4BCCA 3HFQA 4E5ZA 2OK4A 2YNNA 2OIZA 3BWSA 4RE5A 1C9LA 5HE2B 2XZGA 2YB8B 2CN3A 3ODTA 5EMJB 2I0RA 4UM8A 5M5RA 5M5TA 1TBGA 4ES0A 2VC2A 5E6SA 4J8BA 3DXKC 2HJBA 4L1MA 4O3UB 5HQGA 4BH6A 1UOPA 2QXVA 5KDOB 2H9NA 3ZWLB 1XKSA 4CZYA 5TF2A 5TEFA 4A11A 4J77A 1R5MA 2IUPA 3VH0A 3OL2B 3IULA 3DDUA 2OK6A 4JD2C 5M5VA 4J86A 4JHNA 1YFQA 5AFU3 5C86A 5HE1B 4GGAA 5H14A 2H3XA 3IJCA 2H9PA 4QL1A 1VYHC 2OJYA 3UR4A 4AOWA 3J81g 1UOQA 2I3TA 4CI2A 1QFSA 3SXTD 1O6FA 5E6RA 3SHFA 2H9LA 3JPXA 2EBSA 4E5ZB 3I2NA 3FRXA 5H1MA 5CYKA 2H68A 2HYEA 3EQ8A 1L5GA 4HDJA 3IJEA 1K32A 2AGLA 2QC5A 5GMKn 5A2Qg 3V5WB 3CIKB 3O4HA 3F3GA 4PSWB 5CXBB 3EQ9A 4A2MA 2P9UC 1XIPA 4JSXC 3SBQA 1MG2A 2I0TA 3OL2A 4MMXA 3I7KA 4Y7RA 5CXCB 1U2VC 5K1CC 1PBYB 3PE7A 1PI6A 4X61B 5GXHA 1MDAH 3EQ7A 3SBPA 5C9ZB 3B7FA 2GNQA 5EM2B 4XEIC 4A0AA 3UVKA 5IGOA 3PSLA 5FKSA 3IKOA 4Z7QA 1GOTB 1K8KC 3EWEA 1E8NA 3O4JA 4PXWA 4Y5RD 1JTDB 3NVNA 2IWKA 1N6EA 2HJ4A 3V9FA 4AMYA 4Z7NA 5FA5B 2P9PC 2P9NC 1GOHA 1U4CA 3AFCA 4U7AA 5SXMA 3K6SA 3IJ0A 1U8CA 1GOFA 3MMYA 5CXBA 3I89A 4GGDA 5EAPA 5EMLB 4H5JA 2PM9A 4L9OA 3ZDYA 5FKTA 3IJ1A 3NIFA
chains in the Genus database with same CATH topology
4CI1A 3NVQA 5EMMB 4J79A 4GQ2P 1JOFA 3RLMD 4A0AB 2IURA 2BCJB 3CFSB 1GP2B 2XL2A 1B9YA 3OW8A 3ULEC 5EALA 2CE9A 3FM0A 4ZOYA 2AGYA 4FB1D 3GFCA 3I7LA 3P4FA 4ERQA 4FA4D 4JSNC 1GG2B 2AGXA 3N0DA 2CE8A 3BG1A 2Q7QA 3JZHA 3AL8B 4JSPC 4A11B 3I7NA 4ERYA 4ZN4A 2GC7A 2Z2OA 4L3HD 5K19A 1SQ9A 1NR0A 2HKMA 4LG9A 1L0QA 3VA6A 2W18A 2J55H 3SBRA 5HE0B 5AMSA 3OKYA 2AH0A 4ZOVA 4TZ4A 5IJ7E 3F3PA 2H13A 5FXYA 3L4OD 4E54A 1PGUA 4J73A 5IC7A 4A2LA 3PXWD 5THAA 4OZUA 4R7AB 4O9DA 3MKQA 4X63B 3JZGA 3AL9A 4CY5A 4K3JB 3VGZA 3AL8A 2H6QA 3I8CA 3SWSD 5I5MA 5CXCA 4JXMA 4CY1A 4A0BB 3C5MA 3RRMC 3MZLA 2TRCB 4GM3A 2J56H 3OKYB 1GXRA 3EI2A 5GXIA 4J81A 5EARA 4CZXA 2YNOA 3K27A 4EWRA 3NVXA 4MK0B 4X60B 4ESGA 5HYNB 4PNKB 3V7DB 4XYIA 4O1QD 1B9XA 4Z8LA 2Z2PA 3UVOA 3EMHA 5IT9g 5FLXg 2BBKH 5C2WB 2G9AA 4GQBB 4J0WA 4FWWA 5HE3B 4JT6C 4ERZA 4A08B 3AH8B 3OTTA 4LG8A 4J78A 4J8GA 4ZOZA 1ERJA 2IUVA 4FA9D 3SVWD 1P22A 3RSEC 5GSAA 4ZOXA 3C9CA 2P9LC 2I0SA 2XU7A 3C75H 1Q47A 3PVWB 4IA9A 3UKRC 4PBYA 2GC4A 4QT8A 3W15A 1PEVA 3I8EA 4FA1D 2HESX 5EAMA 1N6FA 3SFZA 4GZ8A 4GQ1A 3U4YA 4XYHA 3KRWB 5C2VB 1FWXA 5IGQA 2AH1A 3JZNA 1JJUB 4G56B 2OVRB 3RMZD 4D0KA 4H5IA 1JMXB 4KFMB 2B5NA 4PBZA 1NEXB 2O9KA 2P9SC 5TEEA 1S4UX 2UZXB 5IJ8E 3JB9L 4JT5C 4FHLA 4J82A 2B5LA 4BL0A 4QRJA 4CI3A 3EI1A 1MG3A 3E0CA 4OWRA 4J0XA 4IMMA 3JAMg 5EM2A 2CO0A 4FAVD 2AGZA 2B5MA 4U1EI 4X3EA 2XYIA 2G99A 4JSVC 2PM9B 4O3TB 3SN6B 4BUJC 2I3SA 2OVPB 2CN2A 4FAND 2PBIB 2MTAH 1JMZB 1OMWB 3EI2B 4NSXA 5EMKB 2AGWA 3MKSB 1SHYB 5JWZA 2CO0C 3UKUC 3CFVA 3UVMA 2H47A 3I7OA 2PM6B 3IIWA 2H6NA 3SJLD 2J57G 4K3ID 5TDHB 3RN1D 1N6DA 3OKTA 5FKRA 5H17A 4D6VA 3OKWA 3DXMC 3I7PA 3K26A 3UVNA 4I79A 4LGNA 3N0EA 5CYKB 3UVLA 4GMBA 4A7JA 4CY2A 2H6KA 3PXSD 3SMRA 3BG0A 4CZVA 3JRPA 3A0FA 3RFHA 3SCYA 4YVDA 4A09B 2IWFA 3EU7A 2UZYB 2CNXA 4CC9A 4GM9A 2AQ5A 4J84A 4O45A 3MXXA 5I5IA 2H9MA 1SQJA 3EI4A 3DWLC 2YNPA 4L1QD 1A0RB 3FGBA 4E54B 3F3FA 2YBAA 2B4EA 4PC0A 2OVQB 3DSMA 1TYQC 4GM8A 4PSXB 3C99A 3I7HA 3PSCB 2YMUA 4UI9R 3IIYA 2HXCA 3DM0A 3PVUB 5AJAA 3EI3A 3EG6A 5FKQA 5I5JA 4QQEA 2IUQA 2H14A 2P9KC 5B4WA 2PM7B 4A09A 5FQDA 4CY3A 4AEZA 3ORVD 4GGCA 3JROA 3PXTD 1QNIA 3SLED 4J87A 2XL3A 2IAAA 3EI4B 1OLZA 4L3GD 3L4MD 2HKRA 3MZKA 3RN0D 4A0BA 3EI1B 3J80g 2Z2NA 4CI8A 1RI6A 4A08A 3GREA 4N14A 2P9IC 3KRXB 3RFGA 3EI3B 4FA5D 3HFQA 4E5ZA 2OK4A 2YNNA 2OIZA 3BWSA 5HE2B 3ODTA 2YB8B 2CN3A 5EMJB 2I0RA 1TBGA 4ES0A 4J8BA 3DXKC 2HJBA 4O3UB 5HQGA 4BH6A 2QXVA 5KDOB 2H9NA 3ZWLB 1XKSA 4CZYA 5TF2A 5TEFA 4A11A 4J77A 1R5MA 2IUPA 3VH0A 3OL2B 2OK6A 4JD2C 4J86A 1YFQA 5AFU3 5HE1B 4GGAA 5H14A 2H3XA 3IJCA 4QL1A 2H9PA 1VYHC 2OJYA 3UR4A 4AOWA 3J81g 2I3TA 4CI2A 3SXTD 3SHFA 2H9LA 3JPXA 2EBSA 4E5ZB 3I2NA 3FRXA 5H1MA 5CYKA 2H68A 2HYEA 4HDJA 1K32A 2AGLA 2QC5A 5GMKn 5A2Qg 3V5WB 3CIKB 3F3GA 4PSWB 5CXBB 4A2MA 2P9UC 1XIPA 4JSXC 3SBQA 1MG2A 2I0TA 3OL2A 3I7KA 4Y7RA 5CXCB 1U2VC 5K1CC 1PBYB 3PE7A 1PI6A 4X61B 5GXHA 1MDAH 3SBPA 5C9ZB 3B7FA 2GNQA 5EM2B 4XEIC 4A0AA 3UVKA 5IGOA 3PSLA 5FKSA 3IKOA 1GOTB 1K8KC 3EWEA 4PXWA 4Y5RD 3NVNA 2IWKA 1N6EA 2HJ4A 3V9FA 5FA5B 2P9PC 2P9NC 1U4CA 3AFCA 4U7AA 5SXMA 3IJ0A 3MMYA 5CXBA 3I89A 4GGDA 5EAPA 5EMLB 4H5JA 2PM9A 4L9OA 5FKTA 3IJ1A 1XHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI1 A;  3NVQ A;  5EMM B;  4J79 A;  4GQ2 P;  1JOF A;  3RLM D;  4A0A B;  2IUR A;  2BCJ B;  3CFS B;  1GP2 B;  2XL2 A;  1B9Y A;  3OW8 A;  3ULE C;  5EAL A;  2CE9 A;  3FM0 A;  4ZOY A;  2AGY A;  4FB1 D;  3GFC A;  3I7L A;  3P4F A;  4ERQ A;  4FA4 D;  4JSN C;  1GG2 B;  2AGX A;  3N0D A;  2CE8 A;  3BG1 A;  2Q7Q A;  3JZH A;  3AL8 B;  4JSP C;  4A11 B;  3I7N A;  4ERY A;  4ZN4 A;  2GC7 A;  2Z2O A;  4L3H D;  5K19 A;  1SQ9 A;  1NR0 A;  2HKM A;  4LG9 A;  1L0Q A;  3VA6 A;  2W18 A;  2J55 H;  3SBR A;  5HE0 B;  5AMS A;  3OKY A;  2AH0 A;  4ZOV A;  4TZ4 A;  5IJ7 E;  3F3P A;  2H13 A;  5FXY A;  3L4O D;  4E54 A;  1PGU A;  4J73 A;  5IC7 A;  4A2L A;  3PXW D;  5THA A;  4OZU A;  4R7A B;  4O9D A;  3MKQ A;  4X63 B;  3JZG A;  3AL9 A;  4CY5 A;  4K3J B;  3VGZ A;  3AL8 A;  2H6Q A;  3I8C A;  3SWS D;  5I5M A;  5CXC A;  4JXM A;  4CY1 A;  4A0B B;  3C5M A;  3RRM C;  3MZL A;  2TRC B;  4GM3 A;  2J56 H;  3OKY B;  1GXR A;  3EI2 A;  5GXI A;  4J81 A;  5EAR A;  4CZX A;  2YNO A;  3K27 A;  4EWR A;  3NVX A;  4MK0 B;  4X60 B;  4ESG A;  5HYN B;  4PNK B;  3V7D B;  4XYI A;  4O1Q D;  1B9X A;  4Z8L A;  2Z2P A;  3UVO A;  3EMH A;  5IT9 g;  5FLX g;  2BBK H;  5C2W B;  2G9A A;  4GQB B;  4J0W A;  4FWW A;  5HE3 B;  4JT6 C;  4ERZ A;  4A08 B;  3AH8 B;  3OTT A;  4LG8 A;  4J78 A;  4J8G A;  4ZOZ A;  1ERJ A;  2IUV A;  4FA9 D;  3SVW D;  1P22 A;  3RSE C;  5GSA A;  4ZOX A;  3C9C A;  2P9L C;  2I0S A;  2XU7 A;  3C75 H;  1Q47 A;  3PVW B;  4IA9 A;  3UKR C;  4PBY A;  2GC4 A;  4QT8 A;  3W15 A;  1PEV A;  3I8E A;  4FA1 D;  2HES X;  5EAM A;  1N6F A;  3SFZ A;  4GZ8 A;  4GQ1 A;  3U4Y A;  4XYH A;  3KRW B;  5C2V B;  1FWX A;  5IGQ A;  2AH1 A;  3JZN A;  1JJU B;  4G56 B;  2OVR B;  3RMZ D;  4D0K A;  4H5I A;  1JMX B;  4KFM B;  2B5N A;  4PBZ A;  1NEX B;  2O9K A;  2P9S C;  5TEE A;  1S4U X;  2UZX B;  5IJ8 E;  3JB9 L;  4JT5 C;  4FHL A;  4J82 A;  2B5L A;  4BL0 A;  4QRJ A;  4CI3 A;  3EI1 A;  1MG3 A;  3E0C A;  4OWR A;  4J0X A;  4IMM A;  3JAM g;  5EM2 A;  2CO0 A;  4FAV D;  2AGZ A;  2B5M A;  4U1E I;  4X3E A;  2XYI A;  2G99 A;  4JSV C;  2PM9 B;  4O3T B;  3SN6 B;  4BUJ C;  2I3S A;  2OVP B;  2CN2 A;  4FAN D;  2PBI B;  2MTA H;  1JMZ B;  1OMW B;  3EI2 B;  4NSX A;  5EMK B;  2AGW A;  3MKS B;  1SHY B;  5JWZ A;  2CO0 C;  3UKU C;  3CFV A;  3UVM A;  2H47 A;  3I7O A;  2PM6 B;  3IIW A;  2H6N A;  3SJL D;  2J57 G;  4K3I D;  5TDH B;  3RN1 D;  1N6D A;  3OKT A;  5FKR A;  5H17 A;  4D6V A;  3OKW A;  3DXM C;  3I7P A;  3K26 A;  3UVN A;  4I79 A;  4LGN A;  3N0E A;  5CYK B;  3UVL A;  4GMB A;  4A7J A;  4CY2 A;  2H6K A;  3PXS D;  3SMR A;  3BG0 A;  4CZV A;  3JRP A;  3A0F A;  3RFH A;  3SCY A;  4YVD A;  4A09 B;  2IWF A;  3EU7 A;  2UZY B;  2CNX A;  4CC9 A;  4GM9 A;  2AQ5 A;  4J84 A;  4O45 A;  3MXX A;  5I5I A;  2H9M A;  1SQJ A;  3EI4 A;  3DWL C;  2YNP A;  4L1Q D;  1A0R B;  3FGB A;  4E54 B;  3F3F A;  2YBA A;  2B4E A;  4PC0 A;  2OVQ B;  3DSM A;  1TYQ C;  4GM8 A;  4PSX B;  3C99 A;  3I7H A;  3PSC B;  2YMU A;  4UI9 R;  3IIY A;  2HXC A;  3DM0 A;  3PVU B;  5AJA A;  3EI3 A;  3EG6 A;  5FKQ A;  5I5J A;  4QQE A;  2IUQ A;  2H14 A;  2P9K C;  5B4W A;  2PM7 B;  4A09 A;  5FQD A;  4CY3 A;  4AEZ A;  3ORV D;  4GGC A;  3JRO A;  3PXT D;  1QNI A;  3SLE D;  4J87 A;  2XL3 A;  2IAA A;  3EI4 B;  1OLZ A;  4L3G D;  3L4M D;  2HKR A;  3MZK A;  3RN0 D;  4A0B A;  3EI1 B;  3J80 g;  2Z2N A;  4CI8 A;  1RI6 A;  4A08 A;  3GRE A;  4N14 A;  2P9I C;  3KRX B;  3RFG A;  3EI3 B;  4FA5 D;  3HFQ A;  4E5Z A;  2OK4 A;  2YNN A;  2OIZ A;  3BWS A;  5HE2 B;  3ODT A;  2YB8 B;  2CN3 A;  5EMJ B;  2I0R A;  1TBG A;  4ES0 A;  4J8B A;  3DXK C;  2HJB A;  4O3U B;  5HQG A;  4BH6 A;  2QXV A;  5KDO B;  2H9N A;  3ZWL B;  1XKS A;  4CZY A;  5TF2 A;  5TEF A;  4A11 A;  4J77 A;  1R5M A;  2IUP A;  3VH0 A;  3OL2 B;  2OK6 A;  4JD2 C;  4J86 A;  1YFQ A;  5AFU 3;  5HE1 B;  4GGA A;  5H14 A;  2H3X A;  3IJC A;  4QL1 A;  2H9P A;  1VYH C;  2OJY A;  3UR4 A;  4AOW A;  3J81 g;  2I3T A;  4CI2 A;  3SXT D;  3SHF A;  2H9L A;  3JPX A;  2EBS A;  4E5Z B;  3I2N A;  3FRX A;  5H1M A;  5CYK A;  2H68 A;  2HYE A;  4HDJ A;  1K32 A;  2AGL A;  2QC5 A;  5GMK n;  5A2Q g;  3V5W B;  3CIK B;  3F3G A;  4PSW B;  5CXB B;  4A2M A;  2P9U C;  1XIP A;  4JSX C;  3SBQ A;  1MG2 A;  2I0T A;  3OL2 A;  3I7K A;  4Y7R A;  5CXC B;  1U2V C;  5K1C C;  1PBY B;  3PE7 A;  1PI6 A;  4X61 B;  5GXH A;  1MDA H;  3SBP A;  5C9Z B;  3B7F A;  2GNQ A;  5EM2 B;  4XEI C;  4A0A A;  3UVK A;  5IGO A;  3PSL A;  5FKS A;  3IKO A;  1GOT B;  1K8K C;  3EWE A;  4PXW A;  4Y5R D;  3NVN A;  2IWK A;  1N6E A;  2HJ4 A;  3V9F A;  5FA5 B;  2P9P C;  2P9N C;  1U4C A;  3AFC A;  4U7A A;  5SXM A;  3IJ0 A;  3MMY A;  5CXB A;  3I89 A;  4GGD A;  5EAP A;  5EML B;  4H5J A;  2PM9 A;  4L9O A;  5FKT A;  3IJ1 A;  1XHM A; 
#chains in the Genus database with same CATH topology
 4CI1 A;  3NVQ A;  5EMM B;  4J79 A;  4QAM A;  4GQ2 P;  1JOF A;  2EID A;  3NIG A;  3RLM D;  4A0A B;  2IUR A;  1UTC A;  2BCJ B;  3CFS B;  1GP2 B;  2XL2 A;  1B9Y A;  3OW8 A;  3ULE C;  5EAL A;  2CE9 A;  3FM0 A;  4ZOY A;  2VZ1 A;  2WQ8 A;  2AGY A;  1QFM A;  4FB1 D;  3GFC A;  4WJK A;  3I7L A;  1XHM A;  3ZDX A;  3P4F A;  3IUR A;  4ERQ A;  4FA4 D;  4JSN C;  1GG2 B;  2AGX A;  3GD1 I;  3N0D A;  2CE8 A;  3BG1 A;  2Q7Q A;  3JZH A;  3AL8 B;  4JSP C;  4A11 B;  2VDM A;  1VE7 A;  3I7N A;  4WK4 A;  4ERY A;  2GC7 A;  4ZN4 A;  2Z2O A;  4BCB A;  3ZDZ A;  4L3H D;  5K19 A;  1SQ9 A;  1NR0 A;  2HKM A;  4LG9 A;  1L0Q A;  3VA6 A;  2W18 A;  4Z7O A;  2J55 H;  3SBR A;  5HE0 B;  2JKX A;  5AMS A;  3OKY A;  5E6U A;  2AH0 A;  4ZOV A;  2QR5 A;  1I2M B;  4TZ4 A;  5IJ7 E;  3F3P A;  2H13 A;  5FXY A;  3L4O D;  4E54 A;  1PGU A;  4J73 A;  5IC7 A;  2EIC A;  4A2L A;  1M1X A;  1TYE A;  4NEN A;  4D9S A;  3PXW D;  5THA A;  4OZU A;  4R7A B;  4O9D A;  5FFO A;  3MKQ A;  4X63 B;  2VDL A;  3JZG A;  3AL9 A;  4CY5 A;  4K3J B;  3VGZ A;  3AL8 A;  2H6Q A;  3I8C A;  3SWS D;  5I5M A;  5CXC A;  5M5S A;  3IVM A;  4JXM A;  4CY1 A;  4A0B B;  3C5M A;  3RRM C;  3MZL A;  2TRC B;  4GM3 A;  2J56 H;  3OKY B;  1GXR A;  3EI2 A;  3ZE1 A;  5GXI A;  4J81 A;  5EAR A;  4CZX A;  2YNO A;  3K27 A;  4NC4 A;  4EWR A;  3MUN A;  3NVX A;  4MK0 B;  1YR2 A;  4X60 B;  4ESG A;  5HYN B;  4PNK B;  4DNW A;  3K72 A;  3V7D B;  4XYI A;  4O1Q D;  3QHY B;  4MMY A;  1H2Z A;  1B9X A;  4Z8L A;  2Z2P A;  3UVO A;  3EMH A;  5IT9 g;  5FLX g;  2BBK H;  5C2W B;  2G9A A;  4GQB B;  4J0W A;  4FWW A;  5HE3 B;  4JT6 C;  4ERZ A;  2VDP A;  4A08 B;  3FCS A;  3AH8 B;  3OTT A;  4LG8 A;  4IRZ A;  4J78 A;  4J8G A;  1UOO A;  4BP8 A;  4ZOZ A;  3FCU A;  1ERJ A;  4G55 A;  2IUV A;  1E8M A;  4FA9 D;  3SVW D;  5M5U A;  1P22 A;  3RSE C;  4AN1 A;  5GSA A;  5C92 A;  4ZOX A;  3C9C A;  2P9L C;  2I0S A;  2XU7 A;  3C75 H;  1Q47 A;  3PVW B;  4IA9 A;  3UKR C;  1E5T A;  4PBY A;  2GC4 A;  4QT8 A;  3W15 A;  1PEV A;  3I8E A;  4FA1 D;  2HES X;  5EAM A;  1N6F A;  1JV2 A;  4G1E A;  3MUO A;  3SFZ A;  4GZ8 A;  4GQ1 A;  1H2Y A;  3U4Y A;  3V4V A;  4XYH A;  4BP9 A;  3KRW B;  5C2V B;  5HDB A;  3VI3 A;  1FWX A;  5IGQ A;  1VZ3 A;  2HU7 A;  2AH1 A;  3JZN A;  4BCD A;  3IUN A;  1JJU B;  4G56 B;  2OVR B;  3RMZ D;  4D0K A;  4H5I A;  1JMX B;  4KFM B;  3NID A;  2B5N A;  4PBZ A;  1NEX B;  2O9K A;  2P9S C;  5TEE A;  1S4U X;  2UZX B;  1VZ2 A;  2VDQ A;  5IJ8 E;  3JB9 L;  4JT5 C;  4FHL A;  4O02 A;  4J82 A;  2B5L A;  4BL0 A;  4QRJ A;  4CI3 A;  3EI1 A;  1MG3 A;  3E0C A;  4OWR A;  4J0X A;  3T3M A;  4IMM A;  3JAM g;  2VZ3 A;  5EM2 A;  1K3I A;  2CO0 A;  4FAV D;  2AGZ A;  2B5M A;  4G1M A;  4U1E I;  4X3E A;  2XYI A;  2G99 A;  4JSV C;  4MMZ A;  2PM9 B;  4O3T B;  1O6G A;  3O4G A;  3VI4 A;  3ZE0 A;  3SN6 B;  4BUJ C;  1T2X A;  2I3S A;  2OVP B;  2CN2 A;  3IUM A;  4FAN D;  2PBI B;  2MTA H;  4UM9 A;  1JMZ B;  1BPO A;  4O2W A;  1OMW B;  3QI0 A;  3EI2 B;  1H2W A;  4NSX A;  2HU8 A;  5EMK B;  2AGW A;  2EIE A;  3MKS B;  1SHY B;  5JWZ A;  2CO0 C;  3UKU C;  3CFV A;  3UVM A;  2H47 A;  1GOG A;  3I7O A;  2PM6 B;  3IIW A;  2H6N A;  3SJL D;  2J57 G;  4K3I D;  3IUQ A;  5TDH B;  2XDW A;  3RN1 D;  1N6D A;  3OKT A;  5FKR A;  5H17 A;  4D6V A;  4NBM A;  3OKW A;  3DXM C;  3I7P A;  3IUJ A;  3K26 A;  3UVN A;  4I79 A;  4LGN A;  3N0E A;  2VDO A;  5CYK B;  4GMB A;  3UVL A;  3V4P A;  4A7J A;  4CY2 A;  2H6K A;  3PXS D;  3SMR A;  3BG0 A;  4CZV A;  3JRP A;  4DNV A;  3A0F A;  3RFH A;  3MVD K;  3SCY A;  4YVD A;  4A09 B;  5FFG A;  2IWF A;  3EU7 A;  2UZY B;  3GC3 B;  2CNX A;  4CC9 A;  4GM9 A;  2VDN A;  2AQ5 A;  4J84 A;  4O45 A;  3MXX A;  5I5I A;  2XE4 A;  2H9M A;  1SQJ A;  3EI4 A;  3DWL C;  2YNP A;  4L1Q D;  1A0R B;  3FGB A;  4E54 B;  2HU5 A;  2YBA A;  2B4E A;  3F3F A;  1A12 A;  4PC0 A;  4AX4 A;  4WK0 A;  2OVQ B;  3DSM A;  1TYQ C;  4GM8 A;  4PSX B;  3C99 A;  3I7H A;  3PSC B;  2YMU A;  4UI9 R;  3IIY A;  1C9I A;  2HXC A;  3DM0 A;  2BKL A;  3PVU B;  4AMZ A;  4NAA A;  5AJA A;  4AN0 A;  3EI3 A;  3EG6 A;  5FKQ A;  5I5J A;  4QQE A;  2IUQ A;  2H14 A;  2P9K C;  5B4W A;  2PM7 B;  4A09 A;  3OF7 A;  5FQD A;  4CY3 A;  4AEZ A;  3ORV D;  4WK2 A;  4GGC A;  4RE6 A;  3JRO A;  1VE6 A;  3O4I A;  1H2X A;  3PXT D;  1QNI A;  3SLE D;  2QZP A;  4J87 A;  2XL3 A;  5M61 A;  2IAA A;  3EI4 B;  1OLZ A;  4L3G D;  3L4M D;  4DNU A;  3K71 A;  2HKR A;  3MZK A;  3RN0 D;  4A0B A;  3ZE2 A;  2EIB A;  3EI1 B;  3T3P A;  3J80 g;  2VDR A;  2Z2N A;  4CI8 A;  1RI6 A;  2VDK A;  4A08 A;  3GRE A;  3KCI A;  4N14 A;  4JHP C;  2P9I C;  3KRX B;  3RFG A;  3EI3 B;  4FA5 D;  4BCC A;  3HFQ A;  4E5Z A;  2OK4 A;  2YNN A;  2OIZ A;  3BWS A;  4RE5 A;  1C9L A;  5HE2 B;  2XZG A;  2YB8 B;  2CN3 A;  3ODT A;  5EMJ B;  2I0R A;  4UM8 A;  5M5R A;  5M5T A;  1TBG A;  4ES0 A;  2VC2 A;  5E6S A;  4J8B A;  3DXK C;  2HJB A;  4L1M A;  4O3U B;  5HQG A;  4BH6 A;  1UOP A;  2QXV A;  5KDO B;  2H9N A;  3ZWL B;  1XKS A;  4CZY A;  5TF2 A;  5TEF A;  4A11 A;  4J77 A;  1R5M A;  2IUP A;  3VH0 A;  3OL2 B;  3IUL A;  3DDU A;  2OK6 A;  4JD2 C;  5M5V A;  4J86 A;  4JHN A;  1YFQ A;  5AFU 3;  5C86 A;  5HE1 B;  4GGA A;  5H14 A;  2H3X A;  3IJC A;  2H9P A;  4QL1 A;  1VYH C;  2OJY A;  3UR4 A;  4AOW A;  3J81 g;  1UOQ A;  2I3T A;  4CI2 A;  1QFS A;  3SXT D;  1O6F A;  5E6R A;  3SHF A;  2H9L A;  3JPX A;  2EBS A;  4E5Z B;  3I2N A;  3FRX A;  5H1M A;  5CYK A;  2H68 A;  2HYE A;  3EQ8 A;  1L5G A;  4HDJ A;  3IJE A;  1K32 A;  2AGL A;  2QC5 A;  5GMK n;  5A2Q g;  3V5W B;  3CIK B;  3O4H A;  3F3G A;  4PSW B;  5CXB B;  3EQ9 A;  4A2M A;  2P9U C;  1XIP A;  4JSX C;  3SBQ A;  1MG2 A;  2I0T A;  3OL2 A;  4MMX A;  3I7K A;  4Y7R A;  5CXC B;  1U2V C;  5K1C C;  1PBY B;  3PE7 A;  1PI6 A;  4X61 B;  5GXH A;  1MDA H;  3EQ7 A;  3SBP A;  5C9Z B;  3B7F A;  2GNQ A;  5EM2 B;  4XEI C;  4A0A A;  3UVK A;  5IGO A;  3PSL A;  5FKS A;  3IKO A;  4Z7Q A;  1GOT B;  1K8K C;  3EWE A;  1E8N A;  3O4J A;  4PXW A;  4Y5R D;  1JTD B;  3NVN A;  2IWK A;  1N6E A;  2HJ4 A;  3V9F A;  4AMY A;  4Z7N A;  5FA5 B;  2P9P C;  2P9N C;  1GOH A;  1U4C A;  3AFC A;  4U7A A;  5SXM A;  3K6S A;  3IJ0 A;  1U8C A;  1GOF A;  3MMY A;  5CXB A;  3I89 A;  4GGD A;  5EAP A;  5EML B;  4H5J A;  2PM9 A;  4L9O A;  3ZDY A;  5FKT A;  3IJ1 A;  3NIF A; 
#chains in the Genus database with same CATH homology
 4CI1 A;  3NVQ A;  5EMM B;  4J79 A;  4GQ2 P;  1JOF A;  3RLM D;  4A0A B;  2IUR A;  2BCJ B;  3CFS B;  1GP2 B;  2XL2 A;  1B9Y A;  3OW8 A;  3ULE C;  5EAL A;  2CE9 A;  3FM0 A;  4ZOY A;  2AGY A;  4FB1 D;  3GFC A;  3I7L A;  3P4F A;  4ERQ A;  4FA4 D;  4JSN C;  1GG2 B;  2AGX A;  3N0D A;  2CE8 A;  3BG1 A;  2Q7Q A;  3JZH A;  3AL8 B;  4JSP C;  4A11 B;  3I7N A;  4ERY A;  4ZN4 A;  2GC7 A;  2Z2O A;  4L3H D;  5K19 A;  1SQ9 A;  1NR0 A;  2HKM A;  4LG9 A;  1L0Q A;  3VA6 A;  2W18 A;  2J55 H;  3SBR A;  5HE0 B;  5AMS A;  3OKY A;  2AH0 A;  4ZOV A;  4TZ4 A;  5IJ7 E;  3F3P A;  2H13 A;  5FXY A;  3L4O D;  4E54 A;  1PGU A;  4J73 A;  5IC7 A;  4A2L A;  3PXW D;  5THA A;  4OZU A;  4R7A B;  4O9D A;  3MKQ A;  4X63 B;  3JZG A;  3AL9 A;  4CY5 A;  4K3J B;  3VGZ A;  3AL8 A;  2H6Q A;  3I8C A;  3SWS D;  5I5M A;  5CXC A;  4JXM A;  4CY1 A;  4A0B B;  3C5M A;  3RRM C;  3MZL A;  2TRC B;  4GM3 A;  2J56 H;  3OKY B;  1GXR A;  3EI2 A;  5GXI A;  4J81 A;  5EAR A;  4CZX A;  2YNO A;  3K27 A;  4EWR A;  3NVX A;  4MK0 B;  4X60 B;  4ESG A;  5HYN B;  4PNK B;  3V7D B;  4XYI A;  4O1Q D;  1B9X A;  4Z8L A;  2Z2P A;  3UVO A;  3EMH A;  5IT9 g;  5FLX g;  2BBK H;  5C2W B;  2G9A A;  4GQB B;  4J0W A;  4FWW A;  5HE3 B;  4JT6 C;  4ERZ A;  4A08 B;  3AH8 B;  3OTT A;  4LG8 A;  4J78 A;  4J8G A;  4ZOZ A;  1ERJ A;  2IUV A;  4FA9 D;  3SVW D;  1P22 A;  3RSE C;  5GSA A;  4ZOX A;  3C9C A;  2P9L C;  2I0S A;  2XU7 A;  3C75 H;  1Q47 A;  3PVW B;  4IA9 A;  3UKR C;  4PBY A;  2GC4 A;  4QT8 A;  3W15 A;  1PEV A;  3I8E A;  4FA1 D;  2HES X;  5EAM A;  1N6F A;  3SFZ A;  4GZ8 A;  4GQ1 A;  3U4Y A;  4XYH A;  3KRW B;  5C2V B;  1FWX A;  5IGQ A;  2AH1 A;  3JZN A;  1JJU B;  4G56 B;  2OVR B;  3RMZ D;  4D0K A;  4H5I A;  1JMX B;  4KFM B;  2B5N A;  4PBZ A;  1NEX B;  2O9K A;  2P9S C;  5TEE A;  1S4U X;  2UZX B;  5IJ8 E;  3JB9 L;  4JT5 C;  4FHL A;  4J82 A;  2B5L A;  4BL0 A;  4QRJ A;  4CI3 A;  3EI1 A;  1MG3 A;  3E0C A;  4OWR A;  4J0X A;  4IMM A;  3JAM g;  5EM2 A;  2CO0 A;  4FAV D;  2AGZ A;  2B5M A;  4U1E I;  4X3E A;  2XYI A;  2G99 A;  4JSV C;  2PM9 B;  4O3T B;  3SN6 B;  4BUJ C;  2I3S A;  2OVP B;  2CN2 A;  4FAN D;  2PBI B;  2MTA H;  1JMZ B;  1OMW B;  3EI2 B;  4NSX A;  5EMK B;  2AGW A;  3MKS B;  1SHY B;  5JWZ A;  2CO0 C;  3UKU C;  3CFV A;  3UVM A;  2H47 A;  3I7O A;  2PM6 B;  3IIW A;  2H6N A;  3SJL D;  2J57 G;  4K3I D;  5TDH B;  3RN1 D;  1N6D A;  3OKT A;  5FKR A;  5H17 A;  4D6V A;  3OKW A;  3DXM C;  3I7P A;  3K26 A;  3UVN A;  4I79 A;  4LGN A;  3N0E A;  5CYK B;  3UVL A;  4GMB A;  4A7J A;  4CY2 A;  2H6K A;  3PXS D;  3SMR A;  3BG0 A;  4CZV A;  3JRP A;  3A0F A;  3RFH A;  3SCY A;  4YVD A;  4A09 B;  2IWF A;  3EU7 A;  2UZY B;  2CNX A;  4CC9 A;  4GM9 A;  2AQ5 A;  4J84 A;  4O45 A;  3MXX A;  5I5I A;  2H9M A;  1SQJ A;  3EI4 A;  3DWL C;  2YNP A;  4L1Q D;  1A0R B;  3FGB A;  4E54 B;  3F3F A;  2YBA A;  2B4E A;  4PC0 A;  2OVQ B;  3DSM A;  1TYQ C;  4GM8 A;  4PSX B;  3C99 A;  3I7H A;  3PSC B;  2YMU A;  4UI9 R;  3IIY A;  2HXC A;  3DM0 A;  3PVU B;  5AJA A;  3EI3 A;  3EG6 A;  5FKQ A;  5I5J A;  4QQE A;  2IUQ A;  2H14 A;  2P9K C;  5B4W A;  2PM7 B;  4A09 A;  5FQD A;  4CY3 A;  4AEZ A;  3ORV D;  4GGC A;  3JRO A;  3PXT D;  1QNI A;  3SLE D;  4J87 A;  2XL3 A;  2IAA A;  3EI4 B;  1OLZ A;  4L3G D;  3L4M D;  2HKR A;  3MZK A;  3RN0 D;  4A0B A;  3EI1 B;  3J80 g;  2Z2N A;  4CI8 A;  1RI6 A;  4A08 A;  3GRE A;  4N14 A;  2P9I C;  3KRX B;  3RFG A;  3EI3 B;  4FA5 D;  3HFQ A;  4E5Z A;  2OK4 A;  2YNN A;  2OIZ A;  3BWS A;  5HE2 B;  3ODT A;  2YB8 B;  2CN3 A;  5EMJ B;  2I0R A;  1TBG A;  4ES0 A;  4J8B A;  3DXK C;  2HJB A;  4O3U B;  5HQG A;  4BH6 A;  2QXV A;  5KDO B;  2H9N A;  3ZWL B;  1XKS A;  4CZY A;  5TF2 A;  5TEF A;  4A11 A;  4J77 A;  1R5M A;  2IUP A;  3VH0 A;  3OL2 B;  2OK6 A;  4JD2 C;  4J86 A;  1YFQ A;  5AFU 3;  5HE1 B;  4GGA A;  5H14 A;  2H3X A;  3IJC A;  4QL1 A;  2H9P A;  1VYH C;  2OJY A;  3UR4 A;  4AOW A;  3J81 g;  2I3T A;  4CI2 A;  3SXT D;  3SHF A;  2H9L A;  3JPX A;  2EBS A;  4E5Z B;  3I2N A;  3FRX A;  5H1M A;  5CYK A;  2H68 A;  2HYE A;  4HDJ A;  1K32 A;  2AGL A;  2QC5 A;  5GMK n;  5A2Q g;  3V5W B;  3CIK B;  3F3G A;  4PSW B;  5CXB B;  4A2M A;  2P9U C;  1XIP A;  4JSX C;  3SBQ A;  1MG2 A;  2I0T A;  3OL2 A;  3I7K A;  4Y7R A;  5CXC B;  1U2V C;  5K1C C;  1PBY B;  3PE7 A;  1PI6 A;  4X61 B;  5GXH A;  1MDA H;  3SBP A;  5C9Z B;  3B7F A;  2GNQ A;  5EM2 B;  4XEI C;  4A0A A;  3UVK A;  5IGO A;  3PSL A;  5FKS A;  3IKO A;  1GOT B;  1K8K C;  3EWE A;  4PXW A;  4Y5R D;  3NVN A;  2IWK A;  1N6E A;  2HJ4 A;  3V9F A;  5FA5 B;  2P9P C;  2P9N C;  1U4C A;  3AFC A;  4U7A A;  5SXM A;  3IJ0 A;  3MMY A;  5CXB A;  3I89 A;  4GGD A;  5EAP A;  5EML B;  4H5J A;  2PM9 A;  4L9O A;  5FKT A;  3IJ1 A;  1XHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...