3BG0A

Architecture of a coat for the nuclear pore membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
291
structure length
283
Chain Sequence
DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SEC13 homolog
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, hydrolase
total genus 52
structure length 283
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg0A00
3SN6B 5TEEA 2QC5A 3CFSB 3OL2B 4CY5A 4GQ1A 4ZN4A 2IWFA 2OJYA 4PSXB 3F3FA 3EI1B 1U2VC 1PEVA 3RN0D 3PSLA 2H6QA 5TF2A 4JSVC 4ZOZA 1XKSA 5EALA 1JMXB 2TRCB 3JZGA 2CO0A 4K3ID 4A7JA 4CZYA 2H9MA 4ERQA 2QXVA 3ORVD 1OMWB 4E54B 1S4UX 3U4YA 3K27A 4XYHA 3RSEC 2PM6B 3J81g 3NVQA 3B7FA 4Y7RA 4BL0A 4EWRA 2B5NA 4JSNC 4FA5D 3AH8B 4J0WA 4D6VA 3UVOA 2IUQA 1MG3A 3ZWLB 5EM2B 1NEXB 4E5ZB 4R7AB 4JSXC 4CZVA 1OLZA 1N6FA 3CIKB 1TYQC 2I0SA 3OKYB 3MZKA 4A09A 3VA6A 2W18A 4GM8A 3C9CA 4GGDA 4LG8A 4X63B 5JWZA 4BH6A 4PC0A 4PNKB 3JRPA 1L0QA 3SWSD 4A0AA 2BCJB 4D0KA 4ES0A 5CYKB 5SXMA 2YNPA 3DWLC 4ERYA 4U1EI 3ULEC 4L9OA 4TZ4A 4O45A 3I7KA 3NVXA 4CI8A 3JB9L 2OK4A 1GXRA 4CC9A 3AL9A 3RRMC 3UVKA 2Q7QA 3N0DA 3FGBA 3NVNA 2P9PC 3ODTA 3DXKC 3BG0A 3GFCA 3SMRA 3EI2A 3EI4A 3AL8A 2OVRB 1U4CA 5FA5B 5I5IA 3V7DB 2Z2OA 4X3EA 4A08B 5EAMA 4QT8A 3DM0A 3I8CA 3PXWD 3RMZD 5C9ZB 3OL2A 2HJBA 4QRJA 4ZOYA 5EMLB 5FKQA 3FRXA 2UZYB 4NSXA 3I7LA 3I7PA 1K8KC 4AEZA 3BG1A 4A0BB 2H14A 4J86A 3J80g 1B9YA 1P22A 5HE3B 4PBZA 2IURA 4O3TB 5GXHA 1MG2A 4XYIA 4LG9A 4PSWB 1B9XA 2HESX 3UKUC 4ESGA 3L4OD 2B5LA 4L3HD 2UZXB 4FB1D 5TEFA 4E54A 2H47A 3IIYA 4L3GD 4O1QD 4O9DA 2AGWA 3MKSB 5GSAA 4K3JB 4I79A 2H9LA 3I7OA 5TDHB 3SBQA 5EM2A 4E5ZA 2J57G 5CXBB 3A0FA 4GM3A 4OWRA 1SQJA 4QQEA 2AGXA 1XHMA 2H3XA 4CY1A 3MMYA 3OKYA 2EBSA 4CI3A 2I3SA 2O9KA 3OW8A 5HE1B 3JROA 4A11A 5H14A 4J82A 3DXMC 3IJCA 4A2LA 4CY3A 4IMMA 3SJLD 4FA1D 2Z2NA 3AFCA 4PBYA 4X60B 2P9LC 3PXTD 1N6DA 4CI1A 5CYKA 3OKTA 4CZXA 4G56B 4A2MA 3JAMg 4U7AA 4UI9R 4GMBA 5IGQA 2PM7B 5EMJB 5K19A 2H13A 3PXSD 3C75H 2MTAH 1PGUA 3UVLA 2G99A 1XIPA 4GGCA 3MXXA 4PXWA 2PM9B 4H5JA 3C99A 4LGNA 4J81A 5CXCA 4IA9A 5EAPA 3SVWD 3PE7A 2YMUA 2XL3A 2GNQA 5H1MA 2AGZA 5GMKn 3JZNA 4ZOVA 2IUPA 4A08A 3PVWB 5IC7A 3EMHA 4MK0B 2HYEA 2OK6A 4KFMB 3SXTD 5K1CC 2H9PA 2IWKA 4FWWA 4N14A 2YB8B 2OIZA 1RI6A 4FA4D 2GC7A 5FQDA 3I8EA 5A2Qg 4QL1A 1QNIA 3MZLA 2I3TA 3EU7A 5AMSA 3SCYA 5FKTA 2H6NA 3SLED 1MDAH 3FM0A 5IT9g 4GQBB 3EI1A 3IKOA 5EMKB 3P4FA 1VYHC 4J77A 5H17A 5EARA 3RLMD 3SBRA 3VGZA 1R5MA 4H5IA 3I7NA 1PBYB 4XEIC 3SFZA 3SHFA 2AGYA 2I0TA 2P9IC 5FKSA 1PI6A 3F3GA 5CXBA 4JT6C 2P9NC 2H68A 4JXMA 2P9KC 2H9NA 2CN2A 3PSCB 3SBPA 3EI3B 3UR4A 2PBIB 3I89A 4CY2A 2Z2PA 3PVUB 5B4WA 4GGAA 3EWEA 4L1QD 1K32A 3UKRC 5C2VB 3I7HA 4Y5RD 2YNNA 5AJAA 5HE0B 2GC4A 2P9SC 5THAA 1GP2B 5FXYA 2HXCA 1A0RB 5EMMB 4FA9D 1FWXA 5HE2B 3E0CA 1YFQA 3RN1D 5FKRA 3JPXA 3CFVA 4JD2C 2AQ5A 5I5JA 4J84A 2BBKH 2OVQB 1TBGA 2AH0A 2CNXA 2CO0C 2YBAA 5I5MA 4J8GA 4J8BA 3OTTA 3KRWB 2CE8A 2YNOA 5GXIA 2PM9A 3IIWA 3VH0A 2AGLA 1GOTB 3IJ0A 1JJUB 2OVPB 3BWSA 1GG2B 2G9AA 1NR0A 4A11B 3UVMA 3EG6A 3F3PA 2HKRA 4J73A 5HQGA 5IJ8E 3K26A 2XL2A 4GZ8A 4J78A 4A09B 1Q47A 3IJ1A 3RFGA 5KDOB 3OKWA 2XYIA 3DSMA 2IUVA 3W15A 1JOFA 2B5MA 4J0XA 2HJ4A 4AOWA 2I0RA 3KRXB 4CI2A 3V5WB 3I2NA 2IAAA 4YVDA 4ERZA 5AFU3 4A0AB 4GM9A 4A0BA 4Z8LA 5IGOA 2CE9A 4O3UB 5HYNB 1JMZB 4FHLA 3V9FA 3HFQA 4JT5C 5IJ7E 5CXCB 4X61B 4FAVD 3RFHA 4HDJA 3L4MD 4FAND 2XU7A 4J87A 2CN3A 2J55H 4OZUA 5FLXg 2HKMA 3UVNA 4J79A 3EI2B 1SHYB 3EI4B 4BUJC 1ERJA 2H6KA 3AL8B 5C2WB 2AH1A 3C5MA 1SQ9A 3N0EA 3EI3A 3JZHA 3MKQA 2J56H 4JSPC 1N6EA 4ZOXA 4GQ2P 2B4EA 2P9UC 3GREA
chains in the Genus database with same CATH superfamily
2WQ8A 3SN6B 5TEEA 2QC5A 3CFSB 3OL2B 4CY5A 4GQ1A 4ZN4A 3GC3B 5E6SA 2IWFA 2OJYA 4PSXB 3F3FA 3EI1B 1U2VC 1PEVA 3RN0D 3PSLA 2H6QA 5TF2A 4JSVC 3IULA 4ZOZA 1XKSA 5EALA 1JMXB 2TRCB 2VDMA 3JZGA 2CO0A 4K3ID 4A7JA 4CZYA 5M61A 2H9MA 3EQ9A 4ERQA 4AX4A 3IUJA 2QXVA 3ORVD 1OMWB 4E54B 1S4UX 3U4YA 3K27A 4XYHA 3RSEC 2PM6B 3J81g 3NVQA 3B7FA 4Y7RA 4BL0A 4EWRA 4G1EA 3ZDXA 2B5NA 4MMZA 4JSNC 4FA5D 1VE6A 3AH8B 4J0WA 4D6VA 3UVOA 2IUQA 1MG3A 3ZWLB 5EM2B 1NEXB 2EIBA 4E5ZB 4R7AB 4JSXC 4CZVA 1OLZA 1N6FA 3CIKB 2VZ1A 1TYQC 3EQ7A 2I0SA 3OKYB 3MZKA 4A09A 4BCCA 3VA6A 4JHNA 2W18A 4GM8A 3C9CA 4GGDA 4LG8A 4X63B 5JWZA 4BH6A 4PC0A 4PNKB 3JRPA 1L0QA 3SWSD 3O4IA 1E8NA 4BP9A 4A0AA 2BCJB 4D0KA 4ES0A 5CYKB 5SXMA 1JTDB 2YNPA 2BKLA 3DWLC 4ERYA 4U1EI 3ULEC 4L9OA 5C92A 2VDKA 4TZ4A 4O45A 3I7KA 1VE7A 3NVXA 3ZDZA 4CI8A 3JB9L 5M5VA 2OK4A 1GXRA 4CC9A 3AL9A 1VZ2A 3RRMC 3UVKA 2Q7QA 1UTCA 3N0DA 3FGBA 3NVNA 3MUNA 2P9PC 3ODTA 3DXKC 4QAMA 2VDOA 3BG0A 3GFCA 3SMRA 3EI2A 3EI4A 3AL8A 2OVRB 2VC2A 1U4CA 4G1MA 5FA5B 5I5IA 3V7DB 2Z2OA 4X3EA 4A08B 5EAMA 4UM8A 4QT8A 3DM0A 3I8CA 3PXWD 3RMZD 2VZ3A 5C9ZB 3OL2A 3ZE1A 2HJBA 4QRJA 4ZOYA 5EMLB 5FKQA 3FRXA 2UZYB 4NSXA 3I7LA 3I7PA 1K8KC 4AEZA 3BG1A 4A0BB 2H14A 4J86A 3J80g 1B9YA 1P22A 3QHYB 5HE3B 4PBZA 2IURA 4O3TB 5GXHA 1MG2A 4XYIA 3T3PA 4MMYA 4NBMA 4LG9A 4PSWB 1B9XA 5HDBA 2EIEA 2HESX 3MUOA 3UKUC 4ESGA 3L4OD 1E5TA 1C9LA 2B5LA 4L3HD 2UZXB 4FB1D 2HU7A 4UM9A 5TEFA 4E54A 2H47A 3IIYA 4L3GD 4O1QD 4O9DA 3NIGA 2AGWA 3MKSB 5GSAA 4K3JB 4I79A 2H9LA 4O02A 5E6RA 3I7OA 5FFOA 2QR5A 5TDHB 3SBQA 5EM2A 4E5ZA 2J57G 5CXBB 3A0FA 4GM3A 4OWRA 1SQJA 4QQEA 2AGXA 1XHMA 2H3XA 4WK2A 5FFGA 4CY1A 3MMYA 3OKYA 2EBSA 4CI3A 2I3SA 2O9KA 3OW8A 5HE1B 3JROA 4A11A 2HU5A 5H14A 4J82A 3V4VA 3DXMC 3IJCA 4A2LA 4RE5A 4CY3A 2VDNA 4IMMA 4DNUA 3SJLD 4FA1D 2Z2NA 1GOGA 3AFCA 4PBYA 4BCDA 4X60B 2P9LC 3PXTD 1N6DA 4CI1A 5CYKA 3OKTA 1L5GA 4CZXA 4G56B 4A2MA 5M5SA 3JAMg 4U7AA 4UI9R 1K3IA 4GMBA 5IGQA 2PM7B 5EMJB 3V4PA 3T3MA 5K19A 1O6FA 2H13A 3PXSD 3C75H 2MTAH 1PGUA 2QZPA 3UVLA 2G99A 5E6UA 1XIPA 4GGCA 4G55A 1QFMA 2XDWA 3MXXA 2VDPA 3K72A 4PXWA 2PM9B 4H5JA 3C99A 2EICA 4LGNA 4J81A 5CXCA 3IJEA 4IA9A 5EAPA 3SVWD 3PE7A 2YMUA 2XL3A 2GNQA 1BPOA 2AGZA 5H1MA 3JZNA 4ZOVA 5GMKn 1GOFA 2IUPA 4A08A 3PVWB 5IC7A 1GOHA 3EMHA 3QI0A 3IVMA 4MK0B 2HYEA 3ZDYA 3IUMA 2OK6A 4KFMB 3SXTD 5K1CC 3NIFA 2H9PA 3OF7A 2IWKA 1U8CA 4FWWA 4N14A 2YB8B 2OIZA 1RI6A 2VDRA 3FCUA 4FA4D 2GC7A 5FQDA 3I8EA 5A2Qg 4QL1A 1QNIA 3MZLA 2I3TA 1UOPA 3EU7A 5AMSA 3SCYA 1H2ZA 5FKTA 2H6NA 3SLED 1T2XA 1MDAH 3FM0A 5IT9g 4GQBB 3EI1A 3IKOA 5EMKB 3P4FA 1VYHC 1QFSA 4J77A 5H17A 5EARA 3RLMD 1H2XA 4BCBA 3FCSA 3SBRA 3VGZA 1R5MA 4JHPC 4NENA 4H5IA 3I7NA 1PBYB 4XEIC 3SFZA 3SHFA 4D9SA 2AGYA 2I0TA 2P9IC 5FKSA 1PI6A 5M5UA 3IUQA 3F3GA 5CXBA 1A12A 4JT6C 2P9NC 2H68A 4JXMA 2P9KC 2H9NA 4BP8A 4DNWA 2EIDA 2CN2A 3PSCB 1H2WA 5M5RA 3SBPA 3EI3B 4RE6A 3UR4A 2PBIB 3I89A 4AN0A 4CY2A 2Z2PA 3PVUB 5B4WA 4GGAA 2XZGA 3EWEA 4L1QD 1K32A 3UKRC 3VI3A 5C2VB 4L1MA 3I7HA 4Y5RD 3MVDK 1VZ3A 2YNNA 5AJAA 5HE0B 2GC4A 2P9SC 5THAA 1GP2B 5FXYA 1C9IA 2HXCA 1A0RB 5EMMB 4FA9D 1FWXA 5HE2B 3E0CA 1YFQA 2VDQA 3O4JA 3RN1D 5FKRA 3JPXA 2JKXA 3CFVA 4JD2C 2AQ5A 5I5JA 3O4HA 1TYEA 4Z7QA 4J84A 2BBKH 2OVQB 1JV2A 2HU8A 1TBGA 4AN1A 2AH0A 2CNXA 2CO0C 2YBAA 3KCIA 5I5MA 4J8GA 4J8BA 3OTTA 3KRWB 2CE8A 2YNOA 5GXIA 2PM9A 3IIWA 3VH0A 2AGLA 1GOTB 3IJ0A 1YR2A 1JJUB 2OVPB 3BWSA 1GG2B 4MMXA 2G9AA 1NR0A 3NIDA 4A11B 3UVMA 3EG6A 3F3PA 2HKRA 1H2YA 3DDUA 1M1XA 3ZE2A 4J73A 5HQGA 4AMZA 5IJ8E 3K26A 2XL2A 4GZ8A 4J78A 4A09B 1Q47A 3IJ1A 3RFGA 4WJKA 4IRZA 4NAAA 3OKWA 2XYIA 3DSMA 5KDOB 3K71A 3O4GA 2IUVA 3W15A 1JOFA 2B5MA 2XE4A 2HJ4A 4J0XA 4AMYA 4AOWA 2I0RA 1UOOA 2VDLA 3KRXB 3V5WB 4CI2A 3I2NA 4DNVA 2IAAA 4YVDA 4ERZA 4NC4A 5AFU3 4A0AB 4Z7OA 3VI4A 4GM9A 3EQ8A 3GD1I 3IUNA 4A0BA 4Z8LA 4WK0A 5IGOA 2CE9A 4O3UB 5HYNB 1E8MA 1JMZB 4FHLA 3V9FA 3HFQA 4JT5C 5IJ7E 5CXCB 4X61B 1UOQA 4WK4A 1O6GA 4FAVD 3IURA 3RFHA 4O2WA 4HDJA 3L4MD 4FAND 2XU7A 4J87A 1I2MB 4Z7NA 2CN3A 2J55H 4OZUA 5FLXg 2HKMA 3UVNA 4J79A 3EI2B 1SHYB 3EI4B 3ZE0A 4BUJC 1ERJA 2H6KA 3AL8B 5C2WB 5C86A 2AH1A 3C5MA 1SQ9A 3N0EA 3EI3A 3JZHA 3K6SA 3MKQA 2J56H 4JSPC 1N6EA 4ZOXA 4GQ2P 2B4EA 2P9UC 3GREA 5M5TA
chains in the Genus database with same CATH topology
3SN6B 5TEEA 2QC5A 3CFSB 3OL2B 4CY5A 4GQ1A 4ZN4A 2IWFA 2OJYA 4PSXB 3F3FA 3EI1B 1U2VC 1PEVA 3RN0D 3PSLA 2H6QA 5TF2A 4JSVC 4ZOZA 1XKSA 5EALA 1JMXB 2TRCB 3JZGA 2CO0A 4K3ID 4A7JA 4CZYA 2H9MA 4ERQA 2QXVA 3ORVD 1OMWB 4E54B 1S4UX 3U4YA 3K27A 4XYHA 3RSEC 2PM6B 3J81g 3NVQA 3B7FA 4Y7RA 4BL0A 4EWRA 2B5NA 4JSNC 4FA5D 3AH8B 4J0WA 4D6VA 3UVOA 2IUQA 1MG3A 3ZWLB 5EM2B 1NEXB 4E5ZB 4R7AB 4JSXC 4CZVA 1OLZA 1N6FA 3CIKB 1TYQC 2I0SA 3OKYB 3MZKA 4A09A 3VA6A 2W18A 4GM8A 3C9CA 4GGDA 4LG8A 4X63B 5JWZA 4BH6A 4PC0A 4PNKB 3JRPA 1L0QA 3SWSD 4A0AA 2BCJB 4D0KA 4ES0A 5CYKB 5SXMA 2YNPA 3DWLC 4ERYA 4U1EI 3ULEC 4L9OA 4TZ4A 4O45A 3I7KA 3NVXA 4CI8A 3JB9L 2OK4A 1GXRA 4CC9A 3AL9A 3RRMC 3UVKA 2Q7QA 3N0DA 3FGBA 3NVNA 2P9PC 3ODTA 3DXKC 3BG0A 3GFCA 3SMRA 3EI2A 3EI4A 3AL8A 2OVRB 1U4CA 5FA5B 5I5IA 3V7DB 2Z2OA 4X3EA 4A08B 5EAMA 4QT8A 3DM0A 3I8CA 3PXWD 3RMZD 5C9ZB 3OL2A 2HJBA 4QRJA 4ZOYA 5EMLB 5FKQA 3FRXA 2UZYB 4NSXA 3I7LA 3I7PA 1K8KC 4AEZA 3BG1A 4A0BB 2H14A 4J86A 3J80g 1B9YA 1P22A 5HE3B 4PBZA 2IURA 4O3TB 5GXHA 1MG2A 4XYIA 4LG9A 4PSWB 1B9XA 2HESX 3UKUC 4ESGA 3L4OD 2B5LA 4L3HD 2UZXB 4FB1D 5TEFA 4E54A 2H47A 3IIYA 4L3GD 4O1QD 4O9DA 2AGWA 3MKSB 5GSAA 4K3JB 4I79A 2H9LA 3I7OA 5TDHB 3SBQA 5EM2A 4E5ZA 2J57G 5CXBB 3A0FA 4GM3A 4OWRA 1SQJA 4QQEA 2AGXA 1XHMA 2H3XA 4CY1A 3MMYA 3OKYA 2EBSA 4CI3A 2I3SA 2O9KA 3OW8A 5HE1B 3JROA 4A11A 5H14A 4J82A 3DXMC 3IJCA 4A2LA 4CY3A 4IMMA 3SJLD 4FA1D 2Z2NA 3AFCA 4PBYA 4X60B 2P9LC 3PXTD 1N6DA 4CI1A 5CYKA 3OKTA 4CZXA 4G56B 4A2MA 3JAMg 4U7AA 4UI9R 4GMBA 5IGQA 2PM7B 5EMJB 5K19A 2H13A 3PXSD 3C75H 2MTAH 1PGUA 3UVLA 2G99A 1XIPA 4GGCA 3MXXA 4PXWA 2PM9B 4H5JA 3C99A 4LGNA 4J81A 5CXCA 4IA9A 5EAPA 3SVWD 3PE7A 2YMUA 2XL3A 2GNQA 5H1MA 2AGZA 5GMKn 3JZNA 4ZOVA 2IUPA 4A08A 3PVWB 5IC7A 3EMHA 4MK0B 2HYEA 2OK6A 4KFMB 3SXTD 5K1CC 2H9PA 2IWKA 4FWWA 4N14A 2YB8B 2OIZA 1RI6A 4FA4D 2GC7A 5FQDA 3I8EA 5A2Qg 4QL1A 1QNIA 3MZLA 2I3TA 3EU7A 5AMSA 3SCYA 5FKTA 2H6NA 3SLED 1MDAH 3FM0A 5IT9g 4GQBB 3EI1A 3IKOA 5EMKB 3P4FA 1VYHC 4J77A 5H17A 5EARA 3RLMD 3SBRA 3VGZA 1R5MA 4H5IA 3I7NA 1PBYB 4XEIC 3SFZA 3SHFA 2AGYA 2I0TA 2P9IC 5FKSA 1PI6A 3F3GA 5CXBA 4JT6C 2P9NC 2H68A 4JXMA 2P9KC 2H9NA 2CN2A 3PSCB 3SBPA 3EI3B 3UR4A 2PBIB 3I89A 4CY2A 2Z2PA 3PVUB 5B4WA 4GGAA 3EWEA 4L1QD 1K32A 3UKRC 5C2VB 3I7HA 4Y5RD 2YNNA 5AJAA 5HE0B 2GC4A 2P9SC 5THAA 1GP2B 5FXYA 2HXCA 1A0RB 5EMMB 4FA9D 1FWXA 5HE2B 3E0CA 1YFQA 3RN1D 5FKRA 3JPXA 3CFVA 4JD2C 2AQ5A 5I5JA 4J84A 2BBKH 2OVQB 1TBGA 2AH0A 2CNXA 2CO0C 2YBAA 5I5MA 4J8GA 4J8BA 3OTTA 3KRWB 2CE8A 2YNOA 5GXIA 2PM9A 3IIWA 3VH0A 2AGLA 1GOTB 3IJ0A 1JJUB 2OVPB 3BWSA 1GG2B 2G9AA 1NR0A 4A11B 3UVMA 3EG6A 3F3PA 2HKRA 4J73A 5HQGA 5IJ8E 3K26A 2XL2A 4GZ8A 4J78A 4A09B 1Q47A 3IJ1A 3RFGA 5KDOB 3OKWA 2XYIA 3DSMA 2IUVA 3W15A 1JOFA 2B5MA 4J0XA 2HJ4A 4AOWA 2I0RA 3KRXB 4CI2A 3V5WB 3I2NA 2IAAA 4YVDA 4ERZA 5AFU3 4A0AB 4GM9A 4A0BA 4Z8LA 5IGOA 2CE9A 4O3UB 5HYNB 1JMZB 4FHLA 3V9FA 3HFQA 4JT5C 5IJ7E 5CXCB 4X61B 4FAVD 3RFHA 4HDJA 3L4MD 4FAND 2XU7A 4J87A 2CN3A 2J55H 4OZUA 5FLXg 2HKMA 3UVNA 4J79A 3EI2B 1SHYB 3EI4B 4BUJC 1ERJA 2H6KA 3AL8B 5C2WB 2AH1A 3C5MA 1SQ9A 3N0EA 3EI3A 3JZHA 3MKQA 2J56H 4JSPC 1N6EA 4ZOXA 4GQ2P 2B4EA 2P9UC 3GREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SN6 B;  5TEE A;  2QC5 A;  3CFS B;  3OL2 B;  4CY5 A;  4GQ1 A;  4ZN4 A;  2IWF A;  2OJY A;  4PSX B;  3F3F A;  3EI1 B;  1U2V C;  1PEV A;  3RN0 D;  3PSL A;  2H6Q A;  5TF2 A;  4JSV C;  4ZOZ A;  1XKS A;  5EAL A;  1JMX B;  2TRC B;  3JZG A;  2CO0 A;  4K3I D;  4A7J A;  4CZY A;  2H9M A;  4ERQ A;  2QXV A;  3ORV D;  1OMW B;  4E54 B;  1S4U X;  3U4Y A;  3K27 A;  4XYH A;  3RSE C;  2PM6 B;  3J81 g;  3NVQ A;  3B7F A;  4Y7R A;  4BL0 A;  4EWR A;  2B5N A;  4JSN C;  4FA5 D;  3AH8 B;  4J0W A;  4D6V A;  3UVO A;  2IUQ A;  1MG3 A;  3ZWL B;  5EM2 B;  1NEX B;  4E5Z B;  4R7A B;  4JSX C;  4CZV A;  1OLZ A;  1N6F A;  3CIK B;  1TYQ C;  2I0S A;  3OKY B;  3MZK A;  4A09 A;  3VA6 A;  2W18 A;  4GM8 A;  3C9C A;  4GGD A;  4LG8 A;  4X63 B;  5JWZ A;  4BH6 A;  4PC0 A;  4PNK B;  3JRP A;  1L0Q A;  3SWS D;  4A0A A;  2BCJ B;  4D0K A;  4ES0 A;  5CYK B;  5SXM A;  2YNP A;  3DWL C;  4ERY A;  4U1E I;  3ULE C;  4L9O A;  4TZ4 A;  4O45 A;  3I7K A;  3NVX A;  4CI8 A;  3JB9 L;  2OK4 A;  1GXR A;  4CC9 A;  3AL9 A;  3RRM C;  3UVK A;  2Q7Q A;  3N0D A;  3FGB A;  3NVN A;  2P9P C;  3ODT A;  3DXK C;  3BG0 A;  3GFC A;  3SMR A;  3EI2 A;  3EI4 A;  3AL8 A;  2OVR B;  1U4C A;  5FA5 B;  5I5I A;  3V7D B;  2Z2O A;  4X3E A;  4A08 B;  5EAM A;  4QT8 A;  3DM0 A;  3I8C A;  3PXW D;  3RMZ D;  5C9Z B;  3OL2 A;  2HJB A;  4QRJ A;  4ZOY A;  5EML B;  5FKQ A;  3FRX A;  2UZY B;  4NSX A;  3I7L A;  3I7P A;  1K8K C;  4AEZ A;  3BG1 A;  4A0B B;  2H14 A;  4J86 A;  3J80 g;  1B9Y A;  1P22 A;  5HE3 B;  4PBZ A;  2IUR A;  4O3T B;  5GXH A;  1MG2 A;  4XYI A;  4LG9 A;  4PSW B;  1B9X A;  2HES X;  3UKU C;  4ESG A;  3L4O D;  2B5L A;  4L3H D;  2UZX B;  4FB1 D;  5TEF A;  4E54 A;  2H47 A;  3IIY A;  4L3G D;  4O1Q D;  4O9D A;  2AGW A;  3MKS B;  5GSA A;  4K3J B;  4I79 A;  2H9L A;  3I7O A;  5TDH B;  3SBQ A;  5EM2 A;  4E5Z A;  2J57 G;  5CXB B;  3A0F A;  4GM3 A;  4OWR A;  1SQJ A;  4QQE A;  2AGX A;  1XHM A;  2H3X A;  4CY1 A;  3MMY A;  3OKY A;  2EBS A;  4CI3 A;  2I3S A;  2O9K A;  3OW8 A;  5HE1 B;  3JRO A;  4A11 A;  5H14 A;  4J82 A;  3DXM C;  3IJC A;  4A2L A;  4CY3 A;  4IMM A;  3SJL D;  4FA1 D;  2Z2N A;  3AFC A;  4PBY A;  4X60 B;  2P9L C;  3PXT D;  1N6D A;  4CI1 A;  5CYK A;  3OKT A;  4CZX A;  4G56 B;  4A2M A;  3JAM g;  4U7A A;  4UI9 R;  4GMB A;  5IGQ A;  2PM7 B;  5EMJ B;  5K19 A;  2H13 A;  3PXS D;  3C75 H;  2MTA H;  1PGU A;  3UVL A;  2G99 A;  1XIP A;  4GGC A;  3MXX A;  4PXW A;  2PM9 B;  4H5J A;  3C99 A;  4LGN A;  4J81 A;  5CXC A;  4IA9 A;  5EAP A;  3SVW D;  3PE7 A;  2YMU A;  2XL3 A;  2GNQ A;  5H1M A;  2AGZ A;  5GMK n;  3JZN A;  4ZOV A;  2IUP A;  4A08 A;  3PVW B;  5IC7 A;  3EMH A;  4MK0 B;  2HYE A;  2OK6 A;  4KFM B;  3SXT D;  5K1C C;  2H9P A;  2IWK A;  4FWW A;  4N14 A;  2YB8 B;  2OIZ A;  1RI6 A;  4FA4 D;  2GC7 A;  5FQD A;  3I8E A;  5A2Q g;  4QL1 A;  1QNI A;  3MZL A;  2I3T A;  3EU7 A;  5AMS A;  3SCY A;  5FKT A;  2H6N A;  3SLE D;  1MDA H;  3FM0 A;  5IT9 g;  4GQB B;  3EI1 A;  3IKO A;  5EMK B;  3P4F A;  1VYH C;  4J77 A;  5H17 A;  5EAR A;  3RLM D;  3SBR A;  3VGZ A;  1R5M A;  4H5I A;  3I7N A;  1PBY B;  4XEI C;  3SFZ A;  3SHF A;  2AGY A;  2I0T A;  2P9I C;  5FKS A;  1PI6 A;  3F3G A;  5CXB A;  4JT6 C;  2P9N C;  2H68 A;  4JXM A;  2P9K C;  2H9N A;  2CN2 A;  3PSC B;  3SBP A;  3EI3 B;  3UR4 A;  2PBI B;  3I89 A;  4CY2 A;  2Z2P A;  3PVU B;  5B4W A;  4GGA A;  3EWE A;  4L1Q D;  1K32 A;  3UKR C;  5C2V B;  3I7H A;  4Y5R D;  2YNN A;  5AJA A;  5HE0 B;  2GC4 A;  2P9S C;  5THA A;  1GP2 B;  5FXY A;  2HXC A;  1A0R B;  5EMM B;  4FA9 D;  1FWX A;  5HE2 B;  3E0C A;  1YFQ A;  3RN1 D;  5FKR A;  3JPX A;  3CFV A;  4JD2 C;  2AQ5 A;  5I5J A;  4J84 A;  2BBK H;  2OVQ B;  1TBG A;  2AH0 A;  2CNX A;  2CO0 C;  2YBA A;  5I5M A;  4J8G A;  4J8B A;  3OTT A;  3KRW B;  2CE8 A;  2YNO A;  5GXI A;  2PM9 A;  3IIW A;  3VH0 A;  2AGL A;  1GOT B;  3IJ0 A;  1JJU B;  2OVP B;  3BWS A;  1GG2 B;  2G9A A;  1NR0 A;  4A11 B;  3UVM A;  3EG6 A;  3F3P A;  2HKR A;  4J73 A;  5HQG A;  5IJ8 E;  3K26 A;  2XL2 A;  4GZ8 A;  4J78 A;  4A09 B;  1Q47 A;  3IJ1 A;  3RFG A;  5KDO B;  3OKW A;  2XYI A;  3DSM A;  2IUV A;  3W15 A;  1JOF A;  2B5M A;  4J0X A;  2HJ4 A;  4AOW A;  2I0R A;  3KRX B;  4CI2 A;  3V5W B;  3I2N A;  2IAA A;  4YVD A;  4ERZ A;  5AFU 3;  4A0A B;  4GM9 A;  4A0B A;  4Z8L A;  5IGO A;  2CE9 A;  4O3U B;  5HYN B;  1JMZ B;  4FHL A;  3V9F A;  3HFQ A;  4JT5 C;  5IJ7 E;  5CXC B;  4X61 B;  4FAV D;  3RFH A;  4HDJ A;  3L4M D;  4FAN D;  2XU7 A;  4J87 A;  2CN3 A;  2J55 H;  4OZU A;  5FLX g;  2HKM A;  3UVN A;  4J79 A;  3EI2 B;  1SHY B;  3EI4 B;  4BUJ C;  1ERJ A;  2H6K A;  3AL8 B;  5C2W B;  2AH1 A;  3C5M A;  1SQ9 A;  3N0E A;  3EI3 A;  3JZH A;  3MKQ A;  2J56 H;  4JSP C;  1N6E A;  4ZOX A;  4GQ2 P;  2B4E A;  2P9U C;  3GRE A; 
#chains in the Genus database with same CATH topology
 2WQ8 A;  3SN6 B;  5TEE A;  2QC5 A;  3CFS B;  3OL2 B;  4CY5 A;  4GQ1 A;  4ZN4 A;  3GC3 B;  5E6S A;  2IWF A;  2OJY A;  4PSX B;  3F3F A;  3EI1 B;  1U2V C;  1PEV A;  3RN0 D;  3PSL A;  2H6Q A;  5TF2 A;  4JSV C;  3IUL A;  4ZOZ A;  1XKS A;  5EAL A;  1JMX B;  2TRC B;  2VDM A;  3JZG A;  2CO0 A;  4K3I D;  4A7J A;  4CZY A;  5M61 A;  2H9M A;  3EQ9 A;  4ERQ A;  4AX4 A;  3IUJ A;  2QXV A;  3ORV D;  1OMW B;  4E54 B;  1S4U X;  3U4Y A;  3K27 A;  4XYH A;  3RSE C;  2PM6 B;  3J81 g;  3NVQ A;  3B7F A;  4Y7R A;  4BL0 A;  4EWR A;  4G1E A;  3ZDX A;  2B5N A;  4MMZ A;  4JSN C;  4FA5 D;  1VE6 A;  3AH8 B;  4J0W A;  4D6V A;  3UVO A;  2IUQ A;  1MG3 A;  3ZWL B;  5EM2 B;  1NEX B;  2EIB A;  4E5Z B;  4R7A B;  4JSX C;  4CZV A;  1OLZ A;  1N6F A;  3CIK B;  2VZ1 A;  1TYQ C;  3EQ7 A;  2I0S A;  3OKY B;  3MZK A;  4A09 A;  4BCC A;  3VA6 A;  4JHN A;  2W18 A;  4GM8 A;  3C9C A;  4GGD A;  4LG8 A;  4X63 B;  5JWZ A;  4BH6 A;  4PC0 A;  4PNK B;  3JRP A;  1L0Q A;  3SWS D;  3O4I A;  1E8N A;  4BP9 A;  4A0A A;  2BCJ B;  4D0K A;  4ES0 A;  5CYK B;  5SXM A;  1JTD B;  2YNP A;  2BKL A;  3DWL C;  4ERY A;  4U1E I;  3ULE C;  4L9O A;  5C92 A;  2VDK A;  4TZ4 A;  4O45 A;  3I7K A;  1VE7 A;  3NVX A;  3ZDZ A;  4CI8 A;  3JB9 L;  5M5V A;  2OK4 A;  1GXR A;  4CC9 A;  3AL9 A;  1VZ2 A;  3RRM C;  3UVK A;  2Q7Q A;  1UTC A;  3N0D A;  3FGB A;  3NVN A;  3MUN A;  2P9P C;  3ODT A;  3DXK C;  4QAM A;  2VDO A;  3BG0 A;  3GFC A;  3SMR A;  3EI2 A;  3EI4 A;  3AL8 A;  2OVR B;  2VC2 A;  1U4C A;  4G1M A;  5FA5 B;  5I5I A;  3V7D B;  2Z2O A;  4X3E A;  4A08 B;  5EAM A;  4UM8 A;  4QT8 A;  3DM0 A;  3I8C A;  3PXW D;  3RMZ D;  2VZ3 A;  5C9Z B;  3OL2 A;  3ZE1 A;  2HJB A;  4QRJ A;  4ZOY A;  5EML B;  5FKQ A;  3FRX A;  2UZY B;  4NSX A;  3I7L A;  3I7P A;  1K8K C;  4AEZ A;  3BG1 A;  4A0B B;  2H14 A;  4J86 A;  3J80 g;  1B9Y A;  1P22 A;  3QHY B;  5HE3 B;  4PBZ A;  2IUR A;  4O3T B;  5GXH A;  1MG2 A;  4XYI A;  3T3P A;  4MMY A;  4NBM A;  4LG9 A;  4PSW B;  1B9X A;  5HDB A;  2EIE A;  2HES X;  3MUO A;  3UKU C;  4ESG A;  3L4O D;  1E5T A;  1C9L A;  2B5L A;  4L3H D;  2UZX B;  4FB1 D;  2HU7 A;  4UM9 A;  5TEF A;  4E54 A;  2H47 A;  3IIY A;  4L3G D;  4O1Q D;  4O9D A;  3NIG A;  2AGW A;  3MKS B;  5GSA A;  4K3J B;  4I79 A;  2H9L A;  4O02 A;  5E6R A;  3I7O A;  5FFO A;  2QR5 A;  5TDH B;  3SBQ A;  5EM2 A;  4E5Z A;  2J57 G;  5CXB B;  3A0F A;  4GM3 A;  4OWR A;  1SQJ A;  4QQE A;  2AGX A;  1XHM A;  2H3X A;  4WK2 A;  5FFG A;  4CY1 A;  3MMY A;  3OKY A;  2EBS A;  4CI3 A;  2I3S A;  2O9K A;  3OW8 A;  5HE1 B;  3JRO A;  4A11 A;  2HU5 A;  5H14 A;  4J82 A;  3V4V A;  3DXM C;  3IJC A;  4A2L A;  4RE5 A;  4CY3 A;  2VDN A;  4IMM A;  4DNU A;  3SJL D;  4FA1 D;  2Z2N A;  1GOG A;  3AFC A;  4PBY A;  4BCD A;  4X60 B;  2P9L C;  3PXT D;  1N6D A;  4CI1 A;  5CYK A;  3OKT A;  1L5G A;  4CZX A;  4G56 B;  4A2M A;  5M5S A;  3JAM g;  4U7A A;  4UI9 R;  1K3I A;  4GMB A;  5IGQ A;  2PM7 B;  5EMJ B;  3V4P A;  3T3M A;  5K19 A;  1O6F A;  2H13 A;  3PXS D;  3C75 H;  2MTA H;  1PGU A;  2QZP A;  3UVL A;  2G99 A;  5E6U A;  1XIP A;  4GGC A;  4G55 A;  1QFM A;  2XDW A;  3MXX A;  2VDP A;  3K72 A;  4PXW A;  2PM9 B;  4H5J A;  3C99 A;  2EIC A;  4LGN A;  4J81 A;  5CXC A;  3IJE A;  4IA9 A;  5EAP A;  3SVW D;  3PE7 A;  2YMU A;  2XL3 A;  2GNQ A;  1BPO A;  2AGZ A;  5H1M A;  3JZN A;  4ZOV A;  5GMK n;  1GOF A;  2IUP A;  4A08 A;  3PVW B;  5IC7 A;  1GOH A;  3EMH A;  3QI0 A;  3IVM A;  4MK0 B;  2HYE A;  3ZDY A;  3IUM A;  2OK6 A;  4KFM B;  3SXT D;  5K1C C;  3NIF A;  2H9P A;  3OF7 A;  2IWK A;  1U8C A;  4FWW A;  4N14 A;  2YB8 B;  2OIZ A;  1RI6 A;  2VDR A;  3FCU A;  4FA4 D;  2GC7 A;  5FQD A;  3I8E A;  5A2Q g;  4QL1 A;  1QNI A;  3MZL A;  2I3T A;  1UOP A;  3EU7 A;  5AMS A;  3SCY A;  1H2Z A;  5FKT A;  2H6N A;  3SLE D;  1T2X A;  1MDA H;  3FM0 A;  5IT9 g;  4GQB B;  3EI1 A;  3IKO A;  5EMK B;  3P4F A;  1VYH C;  1QFS A;  4J77 A;  5H17 A;  5EAR A;  3RLM D;  1H2X A;  4BCB A;  3FCS A;  3SBR A;  3VGZ A;  1R5M A;  4JHP C;  4NEN A;  4H5I A;  3I7N A;  1PBY B;  4XEI C;  3SFZ A;  3SHF A;  4D9S A;  2AGY A;  2I0T A;  2P9I C;  5FKS A;  1PI6 A;  5M5U A;  3IUQ A;  3F3G A;  5CXB A;  1A12 A;  4JT6 C;  2P9N C;  2H68 A;  4JXM A;  2P9K C;  2H9N A;  4BP8 A;  4DNW A;  2EID A;  2CN2 A;  3PSC B;  1H2W A;  5M5R A;  3SBP A;  3EI3 B;  4RE6 A;  3UR4 A;  2PBI B;  3I89 A;  4AN0 A;  4CY2 A;  2Z2P A;  3PVU B;  5B4W A;  4GGA A;  2XZG A;  3EWE A;  4L1Q D;  1K32 A;  3UKR C;  3VI3 A;  5C2V B;  4L1M A;  3I7H A;  4Y5R D;  3MVD K;  1VZ3 A;  2YNN A;  5AJA A;  5HE0 B;  2GC4 A;  2P9S C;  5THA A;  1GP2 B;  5FXY A;  1C9I A;  2HXC A;  1A0R B;  5EMM B;  4FA9 D;  1FWX A;  5HE2 B;  3E0C A;  1YFQ A;  2VDQ A;  3O4J A;  3RN1 D;  5FKR A;  3JPX A;  2JKX A;  3CFV A;  4JD2 C;  2AQ5 A;  5I5J A;  3O4H A;  1TYE A;  4Z7Q A;  4J84 A;  2BBK H;  2OVQ B;  1JV2 A;  2HU8 A;  1TBG A;  4AN1 A;  2AH0 A;  2CNX A;  2CO0 C;  2YBA A;  3KCI A;  5I5M A;  4J8G A;  4J8B A;  3OTT A;  3KRW B;  2CE8 A;  2YNO A;  5GXI A;  2PM9 A;  3IIW A;  3VH0 A;  2AGL A;  1GOT B;  3IJ0 A;  1YR2 A;  1JJU B;  2OVP B;  3BWS A;  1GG2 B;  4MMX A;  2G9A A;  1NR0 A;  3NID A;  4A11 B;  3UVM A;  3EG6 A;  3F3P A;  2HKR A;  1H2Y A;  3DDU A;  1M1X A;  3ZE2 A;  4J73 A;  5HQG A;  4AMZ A;  5IJ8 E;  3K26 A;  2XL2 A;  4GZ8 A;  4J78 A;  4A09 B;  1Q47 A;  3IJ1 A;  3RFG A;  4WJK A;  4IRZ A;  4NAA A;  3OKW A;  2XYI A;  3DSM A;  5KDO B;  3K71 A;  3O4G A;  2IUV A;  3W15 A;  1JOF A;  2B5M A;  2XE4 A;  2HJ4 A;  4J0X A;  4AMY A;  4AOW A;  2I0R A;  1UOO A;  2VDL A;  3KRX B;  3V5W B;  4CI2 A;  3I2N A;  4DNV A;  2IAA A;  4YVD A;  4ERZ A;  4NC4 A;  5AFU 3;  4A0A B;  4Z7O A;  3VI4 A;  4GM9 A;  3EQ8 A;  3GD1 I;  3IUN A;  4A0B A;  4Z8L A;  4WK0 A;  5IGO A;  2CE9 A;  4O3U B;  5HYN B;  1E8M A;  1JMZ B;  4FHL A;  3V9F A;  3HFQ A;  4JT5 C;  5IJ7 E;  5CXC B;  4X61 B;  1UOQ A;  4WK4 A;  1O6G A;  4FAV D;  3IUR A;  3RFH A;  4O2W A;  4HDJ A;  3L4M D;  4FAN D;  2XU7 A;  4J87 A;  1I2M B;  4Z7N A;  2CN3 A;  2J55 H;  4OZU A;  5FLX g;  2HKM A;  3UVN A;  4J79 A;  3EI2 B;  1SHY B;  3EI4 B;  3ZE0 A;  4BUJ C;  1ERJ A;  2H6K A;  3AL8 B;  5C2W B;  5C86 A;  2AH1 A;  3C5M A;  1SQ9 A;  3N0E A;  3EI3 A;  3JZH A;  3K6S A;  3MKQ A;  2J56 H;  4JSP C;  1N6E A;  4ZOX A;  4GQ2 P;  2B4E A;  2P9U C;  3GRE A;  5M5T A; 
#chains in the Genus database with same CATH homology
 3SN6 B;  5TEE A;  2QC5 A;  3CFS B;  3OL2 B;  4CY5 A;  4GQ1 A;  4ZN4 A;  2IWF A;  2OJY A;  4PSX B;  3F3F A;  3EI1 B;  1U2V C;  1PEV A;  3RN0 D;  3PSL A;  2H6Q A;  5TF2 A;  4JSV C;  4ZOZ A;  1XKS A;  5EAL A;  1JMX B;  2TRC B;  3JZG A;  2CO0 A;  4K3I D;  4A7J A;  4CZY A;  2H9M A;  4ERQ A;  2QXV A;  3ORV D;  1OMW B;  4E54 B;  1S4U X;  3U4Y A;  3K27 A;  4XYH A;  3RSE C;  2PM6 B;  3J81 g;  3NVQ A;  3B7F A;  4Y7R A;  4BL0 A;  4EWR A;  2B5N A;  4JSN C;  4FA5 D;  3AH8 B;  4J0W A;  4D6V A;  3UVO A;  2IUQ A;  1MG3 A;  3ZWL B;  5EM2 B;  1NEX B;  4E5Z B;  4R7A B;  4JSX C;  4CZV A;  1OLZ A;  1N6F A;  3CIK B;  1TYQ C;  2I0S A;  3OKY B;  3MZK A;  4A09 A;  3VA6 A;  2W18 A;  4GM8 A;  3C9C A;  4GGD A;  4LG8 A;  4X63 B;  5JWZ A;  4BH6 A;  4PC0 A;  4PNK B;  3JRP A;  1L0Q A;  3SWS D;  4A0A A;  2BCJ B;  4D0K A;  4ES0 A;  5CYK B;  5SXM A;  2YNP A;  3DWL C;  4ERY A;  4U1E I;  3ULE C;  4L9O A;  4TZ4 A;  4O45 A;  3I7K A;  3NVX A;  4CI8 A;  3JB9 L;  2OK4 A;  1GXR A;  4CC9 A;  3AL9 A;  3RRM C;  3UVK A;  2Q7Q A;  3N0D A;  3FGB A;  3NVN A;  2P9P C;  3ODT A;  3DXK C;  3BG0 A;  3GFC A;  3SMR A;  3EI2 A;  3EI4 A;  3AL8 A;  2OVR B;  1U4C A;  5FA5 B;  5I5I A;  3V7D B;  2Z2O A;  4X3E A;  4A08 B;  5EAM A;  4QT8 A;  3DM0 A;  3I8C A;  3PXW D;  3RMZ D;  5C9Z B;  3OL2 A;  2HJB A;  4QRJ A;  4ZOY A;  5EML B;  5FKQ A;  3FRX A;  2UZY B;  4NSX A;  3I7L A;  3I7P A;  1K8K C;  4AEZ A;  3BG1 A;  4A0B B;  2H14 A;  4J86 A;  3J80 g;  1B9Y A;  1P22 A;  5HE3 B;  4PBZ A;  2IUR A;  4O3T B;  5GXH A;  1MG2 A;  4XYI A;  4LG9 A;  4PSW B;  1B9X A;  2HES X;  3UKU C;  4ESG A;  3L4O D;  2B5L A;  4L3H D;  2UZX B;  4FB1 D;  5TEF A;  4E54 A;  2H47 A;  3IIY A;  4L3G D;  4O1Q D;  4O9D A;  2AGW A;  3MKS B;  5GSA A;  4K3J B;  4I79 A;  2H9L A;  3I7O A;  5TDH B;  3SBQ A;  5EM2 A;  4E5Z A;  2J57 G;  5CXB B;  3A0F A;  4GM3 A;  4OWR A;  1SQJ A;  4QQE A;  2AGX A;  1XHM A;  2H3X A;  4CY1 A;  3MMY A;  3OKY A;  2EBS A;  4CI3 A;  2I3S A;  2O9K A;  3OW8 A;  5HE1 B;  3JRO A;  4A11 A;  5H14 A;  4J82 A;  3DXM C;  3IJC A;  4A2L A;  4CY3 A;  4IMM A;  3SJL D;  4FA1 D;  2Z2N A;  3AFC A;  4PBY A;  4X60 B;  2P9L C;  3PXT D;  1N6D A;  4CI1 A;  5CYK A;  3OKT A;  4CZX A;  4G56 B;  4A2M A;  3JAM g;  4U7A A;  4UI9 R;  4GMB A;  5IGQ A;  2PM7 B;  5EMJ B;  5K19 A;  2H13 A;  3PXS D;  3C75 H;  2MTA H;  1PGU A;  3UVL A;  2G99 A;  1XIP A;  4GGC A;  3MXX A;  4PXW A;  2PM9 B;  4H5J A;  3C99 A;  4LGN A;  4J81 A;  5CXC A;  4IA9 A;  5EAP A;  3SVW D;  3PE7 A;  2YMU A;  2XL3 A;  2GNQ A;  5H1M A;  2AGZ A;  5GMK n;  3JZN A;  4ZOV A;  2IUP A;  4A08 A;  3PVW B;  5IC7 A;  3EMH A;  4MK0 B;  2HYE A;  2OK6 A;  4KFM B;  3SXT D;  5K1C C;  2H9P A;  2IWK A;  4FWW A;  4N14 A;  2YB8 B;  2OIZ A;  1RI6 A;  4FA4 D;  2GC7 A;  5FQD A;  3I8E A;  5A2Q g;  4QL1 A;  1QNI A;  3MZL A;  2I3T A;  3EU7 A;  5AMS A;  3SCY A;  5FKT A;  2H6N A;  3SLE D;  1MDA H;  3FM0 A;  5IT9 g;  4GQB B;  3EI1 A;  3IKO A;  5EMK B;  3P4F A;  1VYH C;  4J77 A;  5H17 A;  5EAR A;  3RLM D;  3SBR A;  3VGZ A;  1R5M A;  4H5I A;  3I7N A;  1PBY B;  4XEI C;  3SFZ A;  3SHF A;  2AGY A;  2I0T A;  2P9I C;  5FKS A;  1PI6 A;  3F3G A;  5CXB A;  4JT6 C;  2P9N C;  2H68 A;  4JXM A;  2P9K C;  2H9N A;  2CN2 A;  3PSC B;  3SBP A;  3EI3 B;  3UR4 A;  2PBI B;  3I89 A;  4CY2 A;  2Z2P A;  3PVU B;  5B4W A;  4GGA A;  3EWE A;  4L1Q D;  1K32 A;  3UKR C;  5C2V B;  3I7H A;  4Y5R D;  2YNN A;  5AJA A;  5HE0 B;  2GC4 A;  2P9S C;  5THA A;  1GP2 B;  5FXY A;  2HXC A;  1A0R B;  5EMM B;  4FA9 D;  1FWX A;  5HE2 B;  3E0C A;  1YFQ A;  3RN1 D;  5FKR A;  3JPX A;  3CFV A;  4JD2 C;  2AQ5 A;  5I5J A;  4J84 A;  2BBK H;  2OVQ B;  1TBG A;  2AH0 A;  2CNX A;  2CO0 C;  2YBA A;  5I5M A;  4J8G A;  4J8B A;  3OTT A;  3KRW B;  2CE8 A;  2YNO A;  5GXI A;  2PM9 A;  3IIW A;  3VH0 A;  2AGL A;  1GOT B;  3IJ0 A;  1JJU B;  2OVP B;  3BWS A;  1GG2 B;  2G9A A;  1NR0 A;  4A11 B;  3UVM A;  3EG6 A;  3F3P A;  2HKR A;  4J73 A;  5HQG A;  5IJ8 E;  3K26 A;  2XL2 A;  4GZ8 A;  4J78 A;  4A09 B;  1Q47 A;  3IJ1 A;  3RFG A;  5KDO B;  3OKW A;  2XYI A;  3DSM A;  2IUV A;  3W15 A;  1JOF A;  2B5M A;  4J0X A;  2HJ4 A;  4AOW A;  2I0R A;  3KRX B;  4CI2 A;  3V5W B;  3I2N A;  2IAA A;  4YVD A;  4ERZ A;  5AFU 3;  4A0A B;  4GM9 A;  4A0B A;  4Z8L A;  5IGO A;  2CE9 A;  4O3U B;  5HYN B;  1JMZ B;  4FHL A;  3V9F A;  3HFQ A;  4JT5 C;  5IJ7 E;  5CXC B;  4X61 B;  4FAV D;  3RFH A;  4HDJ A;  3L4M D;  4FAN D;  2XU7 A;  4J87 A;  2CN3 A;  2J55 H;  4OZU A;  5FLX g;  2HKM A;  3UVN A;  4J79 A;  3EI2 B;  1SHY B;  3EI4 B;  4BUJ C;  1ERJ A;  2H6K A;  3AL8 B;  5C2W B;  2AH1 A;  3C5M A;  1SQ9 A;  3N0E A;  3EI3 A;  3JZH A;  3MKQ A;  2J56 H;  4JSP C;  1N6E A;  4ZOX A;  4GQ2 P;  2B4E A;  2P9U C;  3GRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...