3BG0A

Architecture of a coat for the nuclear pore membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
291
structure length
283
Chain Sequence
DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, hydrolase
molecule keywords Protein SEC13 homolog
total genus 52
structure length 283
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg0A00
3CFVA 4L9OA 3MKSB 4H5JA 5FKSA 1S4UX 4LGNA 5B4WA 3VA6A 1JJUB 2GNQA 2PM9B 3SMRA 4O45A 4ZN4A 4O1QD 5HE3B 4ERZA 1MG2A 4BUJC 3IJCA 4GM9A 3RSEC 3AH8B 2MTAH 2YMUA 1JMXB 4AOWA 3AL9A 2Z2PA 2EBSA 3W15A 2HKMA 1XIPA 2B5MA 5CXBA 2P9LC 4CI2A 2I0RA 3AL8A 3OKWA 3V9FA 3I7PA 3UVKA 3BG0A 3I8CA 2IUQA 3OKTA 2W18A 5TF2A 3A0FA 5TDHB 3DSMA 4A0AA 2J55H 2CNXA 3PSCB 5IGOA 2G9AA 4JT5C 2I0TA 2IWKA 3FM0A 3OKYB 3ZWLB 4CY2A 4CY5A 2P9KC 4PC0A 4O3UB 3CFSB 3SWSD 4A0BA 4FWWA 2CE9A 2H68A 4K3JB 1SHYB 4N14A 4QRJA 1K8KC 5TEEA 3OTTA 4CI1A 2H47A 3EI1B 3SN6B 3U4YA 1GOTB 3RFHA 2H13A 5GXHA 3EI2A 3PXSD 5FLXg 2GC7A 4E5ZB 2CN3A 3SXTD 2AH0A 2H9LA 2HYEA 1N6FA 1L0QA 4FAND 5CXCB 5FKQA 2H14A 2AGLA 2CE8A 3VGZA 4JSPC 4J81A 1RI6A 2YBAA 3EI3A 4TZ4A 4ZOZA 5IC7A 4L3GD 2HKRA 5AFU3 3HFQA 5EMKB 4L3HD 3UVLA 3IJ0A 1MG3A 4OZUA 5HE2B 1PEVA 2YNNA 2Z2NA 4ERYA 4O9DA 3AFCA 2HJ4A 3C99A 2BBKH 3ORVD 3BWSA 3C9CA 4CZXA 5C9ZB 3RRMC 3EMHA 3I7LA 2P9UC 2OVQB 5IJ7E 4GQ2P 4CZYA 3L4MD 2CN2A 3JPXA 2P9NC 2YNOA 4QQEA 5FKRA 3SCYA 3J81g 4ESGA 4CI3A 2H3XA 2IWFA 5IGQA 4H5IA 5EM2B 3I7OA 3I7HA 4A11A 4ZOVA 4JSXC 2PM7B 5HE0B 5I5MA 3SLED 1OMWB 4A2MA 3ODTA 3VH0A 5H14A 1TYQC 4G56B 4I79A 4J77A 3IKOA 3F3PA 3SVWD 4E54A 1B9YA 2B5NA 5FXYA 1SQ9A 3P4FA 4J0WA 2I3TA 4XEIC 3EI2B 4O3TB 2YNPA 2PBIB 3V5WB 3CIKB 5C2WB 2H6QA 3SHFA 2G99A 3UVNA 3E0CA 2H6NA 2HXCA 4FHLA 4U7AA 4XYIA 3UVMA 5JWZA 1K32A 4GGCA 4GQ1A 3SBPA 3IIWA 4J82A 5K19A 2OIZA 3PVWB 1MDAH 3I7KA 3RMZD 4A7JA 5THAA 1ERJA 4PBYA 4FB1D 4QT8A 1PGUA 1YFQA 3AL8B 5IT9g 4Z8LA 5EAPA 3PXTD 1Q47A 3I8EA 3UR4A 3ULEC 3DWLC 4NSXA 5EMMB 2P9PC 4J8BA 3N0DA 4JXMA 4J73A 3JB9L 3UKUC 4PBZA 3EU7A 3BG1A 3GFCA 4A2LA 4X63B 3EI1A 4JT6C 1JOFA 1NR0A 4LG8A 1QNIA 2XL3A 4J84A 3L4OD 2I3SA 5AMSA 4ZOYA 2OVPB 5GXIA 2YB8B 2UZYB 3FGBA 3GREA 4BH6A 2XU7A 3IIYA 5EM2A 4MK0B 3J80g 3SFZA 2GC4A 1U2VC 2QXVA 4J78A 4A08A 3MZKA 5TEFA 3KRXB 4E54B 2PM9A 3JZGA 2H9PA 3JZNA 3F3FA 4J87A 5SXMA 4JSNC 3NVXA 3K26A 4X61B 3SBRA 4FA1D 3EWEA 4ES0A 4J8GA 5EALA 4J79A 2H9NA 4IA9A 2J57G 2OJYA 4U1EI 5FQDA 5CYKA 1P22A 2CO0A 5FA5B 2AGZA 2Z2OA 5EMJB 3JRPA 3NVQA 3DXKC 3UKRC 1A0RB 3EI4A 5IJ8E 2XL2A 4JSVC 3F3GA 5H1MA 4YVDA 3EI4B 3DM0A 2QC5A 2H6KA 4BL0A 4PSWB 2I0SA 5GMKn 4GMBA 2AGYA 3FRXA 4Y5RD 4UI9R 4D0KA 3I7NA 4FA9D 5EARA 3DXMC 3EG6A 3OKYA 3JZHA 2AH1A 2CO0C 3SBQA 4A09B 4X3EA 3PE7A 4ZOXA 2XYIA 1GP2B 3C75H 2OK6A 1SQJA 2TRCB 2OK4A 3I89A 3RFGA 4A0AB 4A11B 2B5LA 3B7FA 2UZXB 4IMMA 4FAVD 4JD2C 2J56H 5HE1B 4X60B 4GGAA 5KDOB 4OWRA 4AEZA 5FKTA 2BCJB 5EAMA 4J86A 1OLZA 4EWRA 2IUPA 3C5MA 4A08B 1R5MA 4GQBB 3IJ1A 4CY3A 4PXWA 4A0BB 2OVRB 4E5ZA 3SJLD 4L1QD 4GM3A 2IAAA 5H17A 3EI3B 2O9KA 1GXRA 5I5IA 4R7AB 2H9MA 4XYHA 5CXCA 1GG2B 1U4CA 3V7DB 3MMYA 2AGWA 1N6EA 1PBYB 1VYHC 2P9IC 4GGDA 3MZLA 1XKSA 2P9SC 2AQ5A 3PVUB 4KFMB 4CI8A 4LG9A 4CY1A 3K27A 2AGXA 5AJAA 3UVOA 2B4EA 3PXWD 5A2Qg 4J0XA 1NEXB 4FA5D 5K1CC 5CXBB 4PNKB 3N0EA 4GZ8A 1PI6A 5C2VB 1TBGA 1XHMA 3I2NA 3KRWB 4CZVA 2IURA 4QL1A 4Y7RA 5I5JA 4CC9A 3JAMg 1N6DA 2PM6B 4K3ID 4HDJA 4ERQA 2HJBA 1B9XA 1FWXA 3NVNA 3RN0D 3JROA 4A09A 3PSLA 1JMZB 4FA4D 5GSAA 3MKQA 3RN1D 3OW8A 3OL2A 3MXXA 2HESX 4PSXB 5HQGA 2Q7QA 2IUVA 3RLMD 5EMLB 5CYKB 5HYNB 3OL2B 4D6VA 4GM8A
chains in the Genus database with same CATH superfamily
3CFVA 4L9OA 3MKSB 4H5JA 5FKSA 1S4UX 3IURA 4LGNA 4MMXA 5B4WA 3VA6A 1JJUB 2GNQA 5C92A 2EIBA 3VI4A 2PM9B 3SMRA 4O45A 4ZN4A 4O1QD 5HE3B 4ERZA 1MG2A 4BUJC 3IJCA 2VZ1A 4GM9A 3RSEC 3IJEA 2EIDA 3AH8B 4RE5A 2MTAH 2YMUA 1UOOA 1JMXB 4NBMA 4AOWA 3ZE0A 4Z7QA 3AL9A 2QZPA 2Z2PA 2EBSA 3W15A 2HKMA 1XIPA 2B5MA 3FCSA 5CXBA 3EQ9A 2P9LC 1YR2A 3OF7A 5E6RA 2I0RA 4CI2A 3AL8A 3K71A 3OKWA 3V9FA 1QFSA 3I7PA 5E6UA 3IUQA 3UVKA 3BG0A 4Z7NA 3I8CA 2IUQA 3OKTA 2W18A 5TF2A 3A0FA 5TDHB 2XE4A 3DSMA 4A0AA 4O2WA 2J55H 2CNXA 4WK2A 3PSCB 5IGOA 2G9AA 4JT5C 5C86A 4BP9A 2I0TA 1C9LA 2IWKA 3FM0A 3OKYB 3ZWLB 4CY2A 4CY5A 2P9KC 4PC0A 4O3UB 3CFSB 3SWSD 4A0BA 4FWWA 2CE9A 4WJKA 2H68A 4K3JB 1UTCA 1JTDB 1SHYB 4N14A 3ZE1A 4QRJA 1K8KC 1VZ2A 5TEEA 1H2YA 3OTTA 4CI1A 2H47A 3EI1B 3SN6B 3U4YA 1GOTB 4IRZA 5FFOA 3RFHA 2H13A 5GXHA 3EI2A 3PXSD 5FLXg 2GC7A 4E5ZB 2CN3A 3SXTD 2AH0A 2H9LA 4NAAA 2HYEA 1N6FA 1L0QA 4FAND 5CXCB 5FKQA 3ZDXA 2H14A 2AGLA 2CE8A 3VGZA 4JSPC 3ZDZA 4J81A 1RI6A 2YBAA 3VI3A 3EI3A 4TZ4A 4ZOZA 5IC7A 4L3GD 2HKRA 5AFU3 3HFQA 2QR5A 1I2MB 4NC4A 5EMKB 3GD1I 4L3HD 3UVLA 3IJ0A 1MG3A 4OZUA 4DNVA 5HE2B 1BPOA 1PEVA 2YNNA 2Z2NA 4UM8A 4ERYA 4O9DA 3AFCA 2HJ4A 1A12A 3C99A 2BBKH 3ORVD 2HU7A 3BWSA 3C9CA 4CZXA 5C9ZB 3RRMC 1GOFA 3O4JA 3EMHA 3I7LA 2P9UC 3MUOA 2OVQB 5IJ7E 4GQ2P 4CZYA 3L4MD 2CN2A 3JPXA 2P9NC 1U8CA 2YNOA 4QQEA 5FKRA 3SCYA 4L1MA 3J81g 4ESGA 4CI3A 2H3XA 2IWFA 5IGQA 1O6GA 2VZ3A 4H5IA 2VDQA 2VDMA 5EM2B 3I7OA 3I7HA 4A11A 4ZOVA 4JSXC 2PM7B 5HE0B 4G1EA 5I5MA 3SLED 1OMWB 4G1MA 4A2MA 3ODTA 3VH0A 5H14A 1TYQC 4G56B 4I79A 4J77A 3IKOA 3F3PA 2VDOA 3SVWD 4E54A 1B9YA 3ZE2A 3IUJA 2B5NA 5FXYA 1SQ9A 3P4FA 4J0WA 2VDNA 3IUMA 3K72A 2I3TA 4XEIC 3EI2B 4DNUA 4O3TB 2YNPA 2PBIB 3V5WB 3CIKB 4AN1A 5C2WB 4WK4A 2VDLA 2H6QA 5M5TA 4BCCA 3SHFA 1VE7A 2G99A 3IUNA 3T3MA 3UVNA 3E0CA 2H6NA 2HXCA 4FHLA 4U7AA 4XYIA 3UVMA 5JWZA 3NIGA 1K32A 4GGCA 4GQ1A 3SBPA 3IIWA 4J82A 4AN0A 3QI0A 5K19A 2OIZA 3PVWB 1MDAH 3I7KA 3RMZD 4A7JA 5THAA 1ERJA 1H2WA 4PBYA 4FB1D 4QT8A 1PGUA 1YFQA 3AL8B 5M5RA 5IT9g 4Z8LA 5EAPA 3EQ7A 3FCUA 3PXTD 5M61A 1Q47A 3I8EA 3UR4A 3ULEC 3DWLC 4NSXA 4Z7OA 5EMMB 1C9IA 2P9PC 4J8BA 3N0DA 4JXMA 1M1XA 4J73A 3JB9L 3UKUC 4PBZA 3EU7A 3IVMA 3ZDYA 3BG1A 3GFCA 4A2LA 4X63B 1O6FA 3EI1A 4JT6C 3MUNA 1JOFA 1NR0A 4LG8A 1QNIA 2XL3A 4WK0A 4J84A 3L4OD 2I3SA 5AMSA 4ZOYA 2OVPB 5GXIA 2YB8B 2UZYB 3FGBA 2EIEA 3GREA 4BH6A 2XU7A 4NENA 3IIYA 5EM2A 4MK0B 3J80g 1GOGA 3SFZA 2GC4A 1U2VC 2QXVA 5HDBA 1H2XA 4J78A 4A08A 3V4PA 3MZKA 5TEFA 3KRXB 4E54B 2PM9A 3JZGA 2H9PA 3JZNA 3F3FA 3NIDA 4J87A 4MMZA 5SXMA 4JSNC 3NVXA 3K26A 4X61B 3SBRA 4FA1D 3EWEA 4ES0A 4J8GA 5EALA 3K6SA 4J79A 5E6SA 2H9NA 4IA9A 1UOPA 2J57G 2OJYA 4U1EI 5FQDA 5CYKA 1P22A 3EQ8A 2CO0A 5FA5B 2AGZA 2Z2OA 5EMJB 3JRPA 3NVQA 3DXKC 3UKRC 1A0RB 3EI4A 5IJ8E 2XL2A 4JSVC 3F3GA 5H1MA 4YVDA 3EI4B 3DM0A 2QC5A 2H6KA 4D9SA 4BL0A 4PSWB 4BP8A 3GC3B 2I0SA 4O02A 5GMKn 4GMBA 2VDPA 2AGYA 3FRXA 2HU8A 4Y5RD 5M5SA 4QAMA 2VDKA 4UI9R 4D0KA 3I7NA 4FA9D 5EARA 3V4VA 3DXMC 3EG6A 3OKYA 3JZHA 1E5TA 2AH1A 2CO0C 3SBQA 4A09B 4X3EA 3PE7A 4ZOXA 4AX4A 4BCBA 3KCIA 1E8NA 2XYIA 1GP2B 3C75H 2XZGA 1K3IA 2OK6A 1SQJA 2TRCB 2OK4A 3QHYB 3I89A 3MVDK 3RFGA 4A0AB 2VC2A 1GOHA 2B5LA 3B7FA 3NIFA 2UZXB 1QFMA 4IMMA 4A11B 4FAVD 4JD2C 5FFGA 2J56H 5HE1B 1E8MA 4X60B 5M5VA 4GGAA 5KDOB 3O4HA 4OWRA 4AEZA 5FKTA 2BCJB 5EAMA 4J86A 2XDWA 1OLZA 4EWRA 2IUPA 3C5MA 4A08B 1R5MA 4JHPC 4GQBB 3IJ1A 4CY3A 2EICA 4PXWA 4A0BB 2OVRB 4E5ZA 3SJLD 4L1QD 3O4GA 1T2XA 4GM3A 2IAAA 5H17A 3EI3B 2O9KA 4AMYA 1GXRA 3DDUA 5I5IA 4R7AB 2H9MA 4XYHA 5CXCA 1GG2B 3T3PA 4G55A 1U4CA 4RE6A 1UOQA 3V7DB 3MMYA 2AGWA 1N6EA 1PBYB 1VYHC 2P9IC 3MZLA 4GGDA 3O4IA 1XKSA 2P9SC 2AQ5A 3PVUB 4KFMB 4AMZA 4CI8A 4LG9A 4CY1A 3K27A 4JHNA 2AGXA 5AJAA 3UVOA 2B4EA 3PXWD 5A2Qg 4J0XA 1NEXB 4FA5D 5K1CC 5M5UA 2WQ8A 5CXBB 4PNKB 3N0EA 4GZ8A 1PI6A 5C2VB 1TBGA 1XHMA 3I2NA 3KRWB 1JV2A 4CZVA 2BKLA 2IURA 4QL1A 4Y7RA 5I5JA 4CC9A 3JAMg 1L5GA 1N6DA 2PM6B 2HU5A 4K3ID 4HDJA 4ERQA 2HJBA 1B9XA 2VDRA 1TYEA 1FWXA 3NVNA 3RN0D 4DNWA 3JROA 4A09A 3PSLA 1JMZB 4FA4D 5GSAA 3MKQA 3RN1D 3OW8A 1H2ZA 2JKXA 3IULA 3MXXA 2HESX 3OL2A 4PSXB 5HQGA 2Q7QA 2IUVA 4UM9A 1VE6A 3RLMD 5EMLB 5CYKB 5HYNB 3OL2B 1VZ3A 4BCDA 4MMYA 4D6VA 4GM8A
chains in the Genus database with same CATH topology
3CFVA 4L9OA 3MKSB 4H5JA 5FKSA 1S4UX 4LGNA 5B4WA 3VA6A 1JJUB 2GNQA 2PM9B 3SMRA 4O45A 4ZN4A 4O1QD 5HE3B 4ERZA 1MG2A 4BUJC 3IJCA 4GM9A 3RSEC 3AH8B 2MTAH 2YMUA 1JMXB 4AOWA 3AL9A 2Z2PA 2EBSA 3W15A 2HKMA 1XIPA 2B5MA 5CXBA 2P9LC 4CI2A 2I0RA 3AL8A 3OKWA 3V9FA 3I7PA 3UVKA 3BG0A 3I8CA 2IUQA 3OKTA 2W18A 5TF2A 3A0FA 5TDHB 3DSMA 4A0AA 2J55H 2CNXA 3PSCB 5IGOA 2G9AA 4JT5C 2I0TA 2IWKA 3FM0A 3OKYB 3ZWLB 4CY2A 4CY5A 2P9KC 4PC0A 4O3UB 3CFSB 3SWSD 4A0BA 4FWWA 2CE9A 2H68A 4K3JB 1SHYB 4N14A 4QRJA 1K8KC 5TEEA 3OTTA 4CI1A 2H47A 3EI1B 3SN6B 3U4YA 1GOTB 3RFHA 2H13A 5GXHA 3EI2A 3PXSD 5FLXg 2GC7A 4E5ZB 2CN3A 3SXTD 2AH0A 2H9LA 2HYEA 1N6FA 1L0QA 4FAND 5CXCB 5FKQA 2H14A 2AGLA 2CE8A 3VGZA 4JSPC 4J81A 1RI6A 2YBAA 3EI3A 4TZ4A 4ZOZA 5IC7A 4L3GD 2HKRA 5AFU3 3HFQA 5EMKB 4L3HD 3UVLA 3IJ0A 1MG3A 4OZUA 5HE2B 1PEVA 2YNNA 2Z2NA 4ERYA 4O9DA 3AFCA 2HJ4A 3C99A 2BBKH 3ORVD 3BWSA 3C9CA 4CZXA 5C9ZB 3RRMC 3EMHA 3I7LA 2P9UC 2OVQB 5IJ7E 4GQ2P 4CZYA 3L4MD 2CN2A 3JPXA 2P9NC 2YNOA 4QQEA 5FKRA 3SCYA 3J81g 4ESGA 4CI3A 2H3XA 2IWFA 5IGQA 4H5IA 5EM2B 3I7OA 3I7HA 4A11A 4ZOVA 4JSXC 2PM7B 5HE0B 5I5MA 3SLED 1OMWB 4A2MA 3ODTA 3VH0A 5H14A 1TYQC 4G56B 4I79A 4J77A 3IKOA 3F3PA 3SVWD 4E54A 1B9YA 2B5NA 5FXYA 1SQ9A 3P4FA 4J0WA 2I3TA 4XEIC 3EI2B 4O3TB 2YNPA 2PBIB 3V5WB 3CIKB 5C2WB 2H6QA 3SHFA 2G99A 3UVNA 3E0CA 2H6NA 2HXCA 4FHLA 4U7AA 4XYIA 3UVMA 5JWZA 1K32A 4GGCA 4GQ1A 3SBPA 3IIWA 4J82A 5K19A 2OIZA 3PVWB 1MDAH 3I7KA 3RMZD 4A7JA 5THAA 1ERJA 4PBYA 4FB1D 4QT8A 1PGUA 1YFQA 3AL8B 5IT9g 4Z8LA 5EAPA 3PXTD 1Q47A 3I8EA 3UR4A 3ULEC 3DWLC 4NSXA 5EMMB 2P9PC 4J8BA 3N0DA 4JXMA 4J73A 3JB9L 3UKUC 4PBZA 3EU7A 3BG1A 3GFCA 4A2LA 4X63B 3EI1A 4JT6C 1JOFA 1NR0A 4LG8A 1QNIA 2XL3A 4J84A 3L4OD 2I3SA 5AMSA 4ZOYA 2OVPB 5GXIA 2YB8B 2UZYB 3FGBA 3GREA 4BH6A 2XU7A 3IIYA 5EM2A 4MK0B 3J80g 3SFZA 2GC4A 1U2VC 2QXVA 4J78A 4A08A 3MZKA 5TEFA 3KRXB 4E54B 2PM9A 3JZGA 2H9PA 3JZNA 3F3FA 4J87A 5SXMA 4JSNC 3NVXA 3K26A 4X61B 3SBRA 4FA1D 3EWEA 4ES0A 4J8GA 5EALA 4J79A 2H9NA 4IA9A 2J57G 2OJYA 4U1EI 5FQDA 5CYKA 1P22A 2CO0A 5FA5B 2AGZA 2Z2OA 5EMJB 3JRPA 3NVQA 3DXKC 3UKRC 1A0RB 3EI4A 5IJ8E 2XL2A 4JSVC 3F3GA 5H1MA 4YVDA 3EI4B 3DM0A 2QC5A 2H6KA 4BL0A 4PSWB 2I0SA 5GMKn 4GMBA 2AGYA 3FRXA 4Y5RD 4UI9R 4D0KA 3I7NA 4FA9D 5EARA 3DXMC 3EG6A 3OKYA 3JZHA 2AH1A 2CO0C 3SBQA 4A09B 4X3EA 3PE7A 4ZOXA 2XYIA 1GP2B 3C75H 2OK6A 1SQJA 2TRCB 2OK4A 3I89A 3RFGA 4A0AB 4A11B 2B5LA 3B7FA 2UZXB 4IMMA 4FAVD 4JD2C 2J56H 5HE1B 4X60B 4GGAA 5KDOB 4OWRA 4AEZA 5FKTA 2BCJB 5EAMA 4J86A 1OLZA 4EWRA 2IUPA 3C5MA 4A08B 1R5MA 4GQBB 3IJ1A 4CY3A 4PXWA 4A0BB 2OVRB 4E5ZA 3SJLD 4L1QD 4GM3A 2IAAA 5H17A 3EI3B 2O9KA 1GXRA 5I5IA 4R7AB 2H9MA 4XYHA 5CXCA 1GG2B 1U4CA 3V7DB 3MMYA 2AGWA 1N6EA 1PBYB 1VYHC 2P9IC 4GGDA 3MZLA 1XKSA 2P9SC 2AQ5A 3PVUB 4KFMB 4CI8A 4LG9A 4CY1A 3K27A 2AGXA 5AJAA 3UVOA 2B4EA 3PXWD 5A2Qg 4J0XA 1NEXB 4FA5D 5K1CC 5CXBB 4PNKB 3N0EA 4GZ8A 1PI6A 5C2VB 1TBGA 1XHMA 3I2NA 3KRWB 4CZVA 2IURA 4QL1A 4Y7RA 5I5JA 4CC9A 3JAMg 1N6DA 2PM6B 4K3ID 4HDJA 4ERQA 2HJBA 1B9XA 1FWXA 3NVNA 3RN0D 3JROA 4A09A 3PSLA 1JMZB 4FA4D 5GSAA 3MKQA 3RN1D 3OW8A 3OL2A 3MXXA 2HESX 4PSXB 5HQGA 2Q7QA 2IUVA 3RLMD 5EMLB 5CYKB 5HYNB 3OL2B 4D6VA 4GM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFV A;  4L9O A;  3MKS B;  4H5J A;  5FKS A;  1S4U X;  4LGN A;  5B4W A;  3VA6 A;  1JJU B;  2GNQ A;  2PM9 B;  3SMR A;  4O45 A;  4ZN4 A;  4O1Q D;  5HE3 B;  4ERZ A;  1MG2 A;  4BUJ C;  3IJC A;  4GM9 A;  3RSE C;  3AH8 B;  2MTA H;  2YMU A;  1JMX B;  4AOW A;  3AL9 A;  2Z2P A;  2EBS A;  3W15 A;  2HKM A;  1XIP A;  2B5M A;  5CXB A;  2P9L C;  4CI2 A;  2I0R A;  3AL8 A;  3OKW A;  3V9F A;  3I7P A;  3UVK A;  3BG0 A;  3I8C A;  2IUQ A;  3OKT A;  2W18 A;  5TF2 A;  3A0F A;  5TDH B;  3DSM A;  4A0A A;  2J55 H;  2CNX A;  3PSC B;  5IGO A;  2G9A A;  4JT5 C;  2I0T A;  2IWK A;  3FM0 A;  3OKY B;  3ZWL B;  4CY2 A;  4CY5 A;  2P9K C;  4PC0 A;  4O3U B;  3CFS B;  3SWS D;  4A0B A;  4FWW A;  2CE9 A;  2H68 A;  4K3J B;  1SHY B;  4N14 A;  4QRJ A;  1K8K C;  5TEE A;  3OTT A;  4CI1 A;  2H47 A;  3EI1 B;  3SN6 B;  3U4Y A;  1GOT B;  3RFH A;  2H13 A;  5GXH A;  3EI2 A;  3PXS D;  5FLX g;  2GC7 A;  4E5Z B;  2CN3 A;  3SXT D;  2AH0 A;  2H9L A;  2HYE A;  1N6F A;  1L0Q A;  4FAN D;  5CXC B;  5FKQ A;  2H14 A;  2AGL A;  2CE8 A;  3VGZ A;  4JSP C;  4J81 A;  1RI6 A;  2YBA A;  3EI3 A;  4TZ4 A;  4ZOZ A;  5IC7 A;  4L3G D;  2HKR A;  5AFU 3;  3HFQ A;  5EMK B;  4L3H D;  3UVL A;  3IJ0 A;  1MG3 A;  4OZU A;  5HE2 B;  1PEV A;  2YNN A;  2Z2N A;  4ERY A;  4O9D A;  3AFC A;  2HJ4 A;  3C99 A;  2BBK H;  3ORV D;  3BWS A;  3C9C A;  4CZX A;  5C9Z B;  3RRM C;  3EMH A;  3I7L A;  2P9U C;  2OVQ B;  5IJ7 E;  4GQ2 P;  4CZY A;  3L4M D;  2CN2 A;  3JPX A;  2P9N C;  2YNO A;  4QQE A;  5FKR A;  3SCY A;  3J81 g;  4ESG A;  4CI3 A;  2H3X A;  2IWF A;  5IGQ A;  4H5I A;  5EM2 B;  3I7O A;  3I7H A;  4A11 A;  4ZOV A;  4JSX C;  2PM7 B;  5HE0 B;  5I5M A;  3SLE D;  1OMW B;  4A2M A;  3ODT A;  3VH0 A;  5H14 A;  1TYQ C;  4G56 B;  4I79 A;  4J77 A;  3IKO A;  3F3P A;  3SVW D;  4E54 A;  1B9Y A;  2B5N A;  5FXY A;  1SQ9 A;  3P4F A;  4J0W A;  2I3T A;  4XEI C;  3EI2 B;  4O3T B;  2YNP A;  2PBI B;  3V5W B;  3CIK B;  5C2W B;  2H6Q A;  3SHF A;  2G99 A;  3UVN A;  3E0C A;  2H6N A;  2HXC A;  4FHL A;  4U7A A;  4XYI A;  3UVM A;  5JWZ A;  1K32 A;  4GGC A;  4GQ1 A;  3SBP A;  3IIW A;  4J82 A;  5K19 A;  2OIZ A;  3PVW B;  1MDA H;  3I7K A;  3RMZ D;  4A7J A;  5THA A;  1ERJ A;  4PBY A;  4FB1 D;  4QT8 A;  1PGU A;  1YFQ A;  3AL8 B;  5IT9 g;  4Z8L A;  5EAP A;  3PXT D;  1Q47 A;  3I8E A;  3UR4 A;  3ULE C;  3DWL C;  4NSX A;  5EMM B;  2P9P C;  4J8B A;  3N0D A;  4JXM A;  4J73 A;  3JB9 L;  3UKU C;  4PBZ A;  3EU7 A;  3BG1 A;  3GFC A;  4A2L A;  4X63 B;  3EI1 A;  4JT6 C;  1JOF A;  1NR0 A;  4LG8 A;  1QNI A;  2XL3 A;  4J84 A;  3L4O D;  2I3S A;  5AMS A;  4ZOY A;  2OVP B;  5GXI A;  2YB8 B;  2UZY B;  3FGB A;  3GRE A;  4BH6 A;  2XU7 A;  3IIY A;  5EM2 A;  4MK0 B;  3J80 g;  3SFZ A;  2GC4 A;  1U2V C;  2QXV A;  4J78 A;  4A08 A;  3MZK A;  5TEF A;  3KRX B;  4E54 B;  2PM9 A;  3JZG A;  2H9P A;  3JZN A;  3F3F A;  4J87 A;  5SXM A;  4JSN C;  3NVX A;  3K26 A;  4X61 B;  3SBR A;  4FA1 D;  3EWE A;  4ES0 A;  4J8G A;  5EAL A;  4J79 A;  2H9N A;  4IA9 A;  2J57 G;  2OJY A;  4U1E I;  5FQD A;  5CYK A;  1P22 A;  2CO0 A;  5FA5 B;  2AGZ A;  2Z2O A;  5EMJ B;  3JRP A;  3NVQ A;  3DXK C;  3UKR C;  1A0R B;  3EI4 A;  5IJ8 E;  2XL2 A;  4JSV C;  3F3G A;  5H1M A;  4YVD A;  3EI4 B;  3DM0 A;  2QC5 A;  2H6K A;  4BL0 A;  4PSW B;  2I0S A;  5GMK n;  4GMB A;  2AGY A;  3FRX A;  4Y5R D;  4UI9 R;  4D0K A;  3I7N A;  4FA9 D;  5EAR A;  3DXM C;  3EG6 A;  3OKY A;  3JZH A;  2AH1 A;  2CO0 C;  3SBQ A;  4A09 B;  4X3E A;  3PE7 A;  4ZOX A;  2XYI A;  1GP2 B;  3C75 H;  2OK6 A;  1SQJ A;  2TRC B;  2OK4 A;  3I89 A;  3RFG A;  4A0A B;  4A11 B;  2B5L A;  3B7F A;  2UZX B;  4IMM A;  4FAV D;  4JD2 C;  2J56 H;  5HE1 B;  4X60 B;  4GGA A;  5KDO B;  4OWR A;  4AEZ A;  5FKT A;  2BCJ B;  5EAM A;  4J86 A;  1OLZ A;  4EWR A;  2IUP A;  3C5M A;  4A08 B;  1R5M A;  4GQB B;  3IJ1 A;  4CY3 A;  4PXW A;  4A0B B;  2OVR B;  4E5Z A;  3SJL D;  4L1Q D;  4GM3 A;  2IAA A;  5H17 A;  3EI3 B;  2O9K A;  1GXR A;  5I5I A;  4R7A B;  2H9M A;  4XYH A;  5CXC A;  1GG2 B;  1U4C A;  3V7D B;  3MMY A;  2AGW A;  1N6E A;  1PBY B;  1VYH C;  2P9I C;  4GGD A;  3MZL A;  1XKS A;  2P9S C;  2AQ5 A;  3PVU B;  4KFM B;  4CI8 A;  4LG9 A;  4CY1 A;  3K27 A;  2AGX A;  5AJA A;  3UVO A;  2B4E A;  3PXW D;  5A2Q g;  4J0X A;  1NEX B;  4FA5 D;  5K1C C;  5CXB B;  4PNK B;  3N0E A;  4GZ8 A;  1PI6 A;  5C2V B;  1TBG A;  1XHM A;  3I2N A;  3KRW B;  4CZV A;  2IUR A;  4QL1 A;  4Y7R A;  5I5J A;  4CC9 A;  3JAM g;  1N6D A;  2PM6 B;  4K3I D;  4HDJ A;  4ERQ A;  2HJB A;  1B9X A;  1FWX A;  3NVN A;  3RN0 D;  3JRO A;  4A09 A;  3PSL A;  1JMZ B;  4FA4 D;  5GSA A;  3MKQ A;  3RN1 D;  3OW8 A;  3OL2 A;  3MXX A;  2HES X;  4PSX B;  5HQG A;  2Q7Q A;  2IUV A;  3RLM D;  5EML B;  5CYK B;  5HYN B;  3OL2 B;  4D6V A;  4GM8 A; 
#chains in the Genus database with same CATH topology
 3CFV A;  4L9O A;  3MKS B;  4H5J A;  5FKS A;  1S4U X;  3IUR A;  4LGN A;  4MMX A;  5B4W A;  3VA6 A;  1JJU B;  2GNQ A;  5C92 A;  2EIB A;  3VI4 A;  2PM9 B;  3SMR A;  4O45 A;  4ZN4 A;  4O1Q D;  5HE3 B;  4ERZ A;  1MG2 A;  4BUJ C;  3IJC A;  2VZ1 A;  4GM9 A;  3RSE C;  3IJE A;  2EID A;  3AH8 B;  4RE5 A;  2MTA H;  2YMU A;  1UOO A;  1JMX B;  4NBM A;  4AOW A;  3ZE0 A;  4Z7Q A;  3AL9 A;  2QZP A;  2Z2P A;  2EBS A;  3W15 A;  2HKM A;  1XIP A;  2B5M A;  3FCS A;  5CXB A;  3EQ9 A;  2P9L C;  1YR2 A;  3OF7 A;  5E6R A;  2I0R A;  4CI2 A;  3AL8 A;  3K71 A;  3OKW A;  3V9F A;  1QFS A;  3I7P A;  5E6U A;  3IUQ A;  3UVK A;  3BG0 A;  4Z7N A;  3I8C A;  2IUQ A;  3OKT A;  2W18 A;  5TF2 A;  3A0F A;  5TDH B;  2XE4 A;  3DSM A;  4A0A A;  4O2W A;  2J55 H;  2CNX A;  4WK2 A;  3PSC B;  5IGO A;  2G9A A;  4JT5 C;  5C86 A;  4BP9 A;  2I0T A;  1C9L A;  2IWK A;  3FM0 A;  3OKY B;  3ZWL B;  4CY2 A;  4CY5 A;  2P9K C;  4PC0 A;  4O3U B;  3CFS B;  3SWS D;  4A0B A;  4FWW A;  2CE9 A;  4WJK A;  2H68 A;  4K3J B;  1UTC A;  1JTD B;  1SHY B;  4N14 A;  3ZE1 A;  4QRJ A;  1K8K C;  1VZ2 A;  5TEE A;  1H2Y A;  3OTT A;  4CI1 A;  2H47 A;  3EI1 B;  3SN6 B;  3U4Y A;  1GOT B;  4IRZ A;  5FFO A;  3RFH A;  2H13 A;  5GXH A;  3EI2 A;  3PXS D;  5FLX g;  2GC7 A;  4E5Z B;  2CN3 A;  3SXT D;  2AH0 A;  2H9L A;  4NAA A;  2HYE A;  1N6F A;  1L0Q A;  4FAN D;  5CXC B;  5FKQ A;  3ZDX A;  2H14 A;  2AGL A;  2CE8 A;  3VGZ A;  4JSP C;  3ZDZ A;  4J81 A;  1RI6 A;  2YBA A;  3VI3 A;  3EI3 A;  4TZ4 A;  4ZOZ A;  5IC7 A;  4L3G D;  2HKR A;  5AFU 3;  3HFQ A;  2QR5 A;  1I2M B;  4NC4 A;  5EMK B;  3GD1 I;  4L3H D;  3UVL A;  3IJ0 A;  1MG3 A;  4OZU A;  4DNV A;  5HE2 B;  1BPO A;  1PEV A;  2YNN A;  2Z2N A;  4UM8 A;  4ERY A;  4O9D A;  3AFC A;  2HJ4 A;  1A12 A;  3C99 A;  2BBK H;  3ORV D;  2HU7 A;  3BWS A;  3C9C A;  4CZX A;  5C9Z B;  3RRM C;  1GOF A;  3O4J A;  3EMH A;  3I7L A;  2P9U C;  3MUO A;  2OVQ B;  5IJ7 E;  4GQ2 P;  4CZY A;  3L4M D;  2CN2 A;  3JPX A;  2P9N C;  1U8C A;  2YNO A;  4QQE A;  5FKR A;  3SCY A;  4L1M A;  3J81 g;  4ESG A;  4CI3 A;  2H3X A;  2IWF A;  5IGQ A;  1O6G A;  2VZ3 A;  4H5I A;  2VDQ A;  2VDM A;  5EM2 B;  3I7O A;  3I7H A;  4A11 A;  4ZOV A;  4JSX C;  2PM7 B;  5HE0 B;  4G1E A;  5I5M A;  3SLE D;  1OMW B;  4G1M A;  4A2M A;  3ODT A;  3VH0 A;  5H14 A;  1TYQ C;  4G56 B;  4I79 A;  4J77 A;  3IKO A;  3F3P A;  2VDO A;  3SVW D;  4E54 A;  1B9Y A;  3ZE2 A;  3IUJ A;  2B5N A;  5FXY A;  1SQ9 A;  3P4F A;  4J0W A;  2VDN A;  3IUM A;  3K72 A;  2I3T A;  4XEI C;  3EI2 B;  4DNU A;  4O3T B;  2YNP A;  2PBI B;  3V5W B;  3CIK B;  4AN1 A;  5C2W B;  4WK4 A;  2VDL A;  2H6Q A;  5M5T A;  4BCC A;  3SHF A;  1VE7 A;  2G99 A;  3IUN A;  3T3M A;  3UVN A;  3E0C A;  2H6N A;  2HXC A;  4FHL A;  4U7A A;  4XYI A;  3UVM A;  5JWZ A;  3NIG A;  1K32 A;  4GGC A;  4GQ1 A;  3SBP A;  3IIW A;  4J82 A;  4AN0 A;  3QI0 A;  5K19 A;  2OIZ A;  3PVW B;  1MDA H;  3I7K A;  3RMZ D;  4A7J A;  5THA A;  1ERJ A;  1H2W A;  4PBY A;  4FB1 D;  4QT8 A;  1PGU A;  1YFQ A;  3AL8 B;  5M5R A;  5IT9 g;  4Z8L A;  5EAP A;  3EQ7 A;  3FCU A;  3PXT D;  5M61 A;  1Q47 A;  3I8E A;  3UR4 A;  3ULE C;  3DWL C;  4NSX A;  4Z7O A;  5EMM B;  1C9I A;  2P9P C;  4J8B A;  3N0D A;  4JXM A;  1M1X A;  4J73 A;  3JB9 L;  3UKU C;  4PBZ A;  3EU7 A;  3IVM A;  3ZDY A;  3BG1 A;  3GFC A;  4A2L A;  4X63 B;  1O6F A;  3EI1 A;  4JT6 C;  3MUN A;  1JOF A;  1NR0 A;  4LG8 A;  1QNI A;  2XL3 A;  4WK0 A;  4J84 A;  3L4O D;  2I3S A;  5AMS A;  4ZOY A;  2OVP B;  5GXI A;  2YB8 B;  2UZY B;  3FGB A;  2EIE A;  3GRE A;  4BH6 A;  2XU7 A;  4NEN A;  3IIY A;  5EM2 A;  4MK0 B;  3J80 g;  1GOG A;  3SFZ A;  2GC4 A;  1U2V C;  2QXV A;  5HDB A;  1H2X A;  4J78 A;  4A08 A;  3V4P A;  3MZK A;  5TEF A;  3KRX B;  4E54 B;  2PM9 A;  3JZG A;  2H9P A;  3JZN A;  3F3F A;  3NID A;  4J87 A;  4MMZ A;  5SXM A;  4JSN C;  3NVX A;  3K26 A;  4X61 B;  3SBR A;  4FA1 D;  3EWE A;  4ES0 A;  4J8G A;  5EAL A;  3K6S A;  4J79 A;  5E6S A;  2H9N A;  4IA9 A;  1UOP A;  2J57 G;  2OJY A;  4U1E I;  5FQD A;  5CYK A;  1P22 A;  3EQ8 A;  2CO0 A;  5FA5 B;  2AGZ A;  2Z2O A;  5EMJ B;  3JRP A;  3NVQ A;  3DXK C;  3UKR C;  1A0R B;  3EI4 A;  5IJ8 E;  2XL2 A;  4JSV C;  3F3G A;  5H1M A;  4YVD A;  3EI4 B;  3DM0 A;  2QC5 A;  2H6K A;  4D9S A;  4BL0 A;  4PSW B;  4BP8 A;  3GC3 B;  2I0S A;  4O02 A;  5GMK n;  4GMB A;  2VDP A;  2AGY A;  3FRX A;  2HU8 A;  4Y5R D;  5M5S A;  4QAM A;  2VDK A;  4UI9 R;  4D0K A;  3I7N A;  4FA9 D;  5EAR A;  3V4V A;  3DXM C;  3EG6 A;  3OKY A;  3JZH A;  1E5T A;  2AH1 A;  2CO0 C;  3SBQ A;  4A09 B;  4X3E A;  3PE7 A;  4ZOX A;  4AX4 A;  4BCB A;  3KCI A;  1E8N A;  2XYI A;  1GP2 B;  3C75 H;  2XZG A;  1K3I A;  2OK6 A;  1SQJ A;  2TRC B;  2OK4 A;  3QHY B;  3I89 A;  3MVD K;  3RFG A;  4A0A B;  2VC2 A;  1GOH A;  2B5L A;  3B7F A;  3NIF A;  2UZX B;  1QFM A;  4IMM A;  4A11 B;  4FAV D;  4JD2 C;  5FFG A;  2J56 H;  5HE1 B;  1E8M A;  4X60 B;  5M5V A;  4GGA A;  5KDO B;  3O4H A;  4OWR A;  4AEZ A;  5FKT A;  2BCJ B;  5EAM A;  4J86 A;  2XDW A;  1OLZ A;  4EWR A;  2IUP A;  3C5M A;  4A08 B;  1R5M A;  4JHP C;  4GQB B;  3IJ1 A;  4CY3 A;  2EIC A;  4PXW A;  4A0B B;  2OVR B;  4E5Z A;  3SJL D;  4L1Q D;  3O4G A;  1T2X A;  4GM3 A;  2IAA A;  5H17 A;  3EI3 B;  2O9K A;  4AMY A;  1GXR A;  3DDU A;  5I5I A;  4R7A B;  2H9M A;  4XYH A;  5CXC A;  1GG2 B;  3T3P A;  4G55 A;  1U4C A;  4RE6 A;  1UOQ A;  3V7D B;  3MMY A;  2AGW A;  1N6E A;  1PBY B;  1VYH C;  2P9I C;  3MZL A;  4GGD A;  3O4I A;  1XKS A;  2P9S C;  2AQ5 A;  3PVU B;  4KFM B;  4AMZ A;  4CI8 A;  4LG9 A;  4CY1 A;  3K27 A;  4JHN A;  2AGX A;  5AJA A;  3UVO A;  2B4E A;  3PXW D;  5A2Q g;  4J0X A;  1NEX B;  4FA5 D;  5K1C C;  5M5U A;  2WQ8 A;  5CXB B;  4PNK B;  3N0E A;  4GZ8 A;  1PI6 A;  5C2V B;  1TBG A;  1XHM A;  3I2N A;  3KRW B;  1JV2 A;  4CZV A;  2BKL A;  2IUR A;  4QL1 A;  4Y7R A;  5I5J A;  4CC9 A;  3JAM g;  1L5G A;  1N6D A;  2PM6 B;  2HU5 A;  4K3I D;  4HDJ A;  4ERQ A;  2HJB A;  1B9X A;  2VDR A;  1TYE A;  1FWX A;  3NVN A;  3RN0 D;  4DNW A;  3JRO A;  4A09 A;  3PSL A;  1JMZ B;  4FA4 D;  5GSA A;  3MKQ A;  3RN1 D;  3OW8 A;  1H2Z A;  2JKX A;  3IUL A;  3MXX A;  2HES X;  3OL2 A;  4PSX B;  5HQG A;  2Q7Q A;  2IUV A;  4UM9 A;  1VE6 A;  3RLM D;  5EML B;  5CYK B;  5HYN B;  3OL2 B;  1VZ3 A;  4BCD A;  4MMY A;  4D6V A;  4GM8 A; 
#chains in the Genus database with same CATH homology
 3CFV A;  4L9O A;  3MKS B;  4H5J A;  5FKS A;  1S4U X;  4LGN A;  5B4W A;  3VA6 A;  1JJU B;  2GNQ A;  2PM9 B;  3SMR A;  4O45 A;  4ZN4 A;  4O1Q D;  5HE3 B;  4ERZ A;  1MG2 A;  4BUJ C;  3IJC A;  4GM9 A;  3RSE C;  3AH8 B;  2MTA H;  2YMU A;  1JMX B;  4AOW A;  3AL9 A;  2Z2P A;  2EBS A;  3W15 A;  2HKM A;  1XIP A;  2B5M A;  5CXB A;  2P9L C;  4CI2 A;  2I0R A;  3AL8 A;  3OKW A;  3V9F A;  3I7P A;  3UVK A;  3BG0 A;  3I8C A;  2IUQ A;  3OKT A;  2W18 A;  5TF2 A;  3A0F A;  5TDH B;  3DSM A;  4A0A A;  2J55 H;  2CNX A;  3PSC B;  5IGO A;  2G9A A;  4JT5 C;  2I0T A;  2IWK A;  3FM0 A;  3OKY B;  3ZWL B;  4CY2 A;  4CY5 A;  2P9K C;  4PC0 A;  4O3U B;  3CFS B;  3SWS D;  4A0B A;  4FWW A;  2CE9 A;  2H68 A;  4K3J B;  1SHY B;  4N14 A;  4QRJ A;  1K8K C;  5TEE A;  3OTT A;  4CI1 A;  2H47 A;  3EI1 B;  3SN6 B;  3U4Y A;  1GOT B;  3RFH A;  2H13 A;  5GXH A;  3EI2 A;  3PXS D;  5FLX g;  2GC7 A;  4E5Z B;  2CN3 A;  3SXT D;  2AH0 A;  2H9L A;  2HYE A;  1N6F A;  1L0Q A;  4FAN D;  5CXC B;  5FKQ A;  2H14 A;  2AGL A;  2CE8 A;  3VGZ A;  4JSP C;  4J81 A;  1RI6 A;  2YBA A;  3EI3 A;  4TZ4 A;  4ZOZ A;  5IC7 A;  4L3G D;  2HKR A;  5AFU 3;  3HFQ A;  5EMK B;  4L3H D;  3UVL A;  3IJ0 A;  1MG3 A;  4OZU A;  5HE2 B;  1PEV A;  2YNN A;  2Z2N A;  4ERY A;  4O9D A;  3AFC A;  2HJ4 A;  3C99 A;  2BBK H;  3ORV D;  3BWS A;  3C9C A;  4CZX A;  5C9Z B;  3RRM C;  3EMH A;  3I7L A;  2P9U C;  2OVQ B;  5IJ7 E;  4GQ2 P;  4CZY A;  3L4M D;  2CN2 A;  3JPX A;  2P9N C;  2YNO A;  4QQE A;  5FKR A;  3SCY A;  3J81 g;  4ESG A;  4CI3 A;  2H3X A;  2IWF A;  5IGQ A;  4H5I A;  5EM2 B;  3I7O A;  3I7H A;  4A11 A;  4ZOV A;  4JSX C;  2PM7 B;  5HE0 B;  5I5M A;  3SLE D;  1OMW B;  4A2M A;  3ODT A;  3VH0 A;  5H14 A;  1TYQ C;  4G56 B;  4I79 A;  4J77 A;  3IKO A;  3F3P A;  3SVW D;  4E54 A;  1B9Y A;  2B5N A;  5FXY A;  1SQ9 A;  3P4F A;  4J0W A;  2I3T A;  4XEI C;  3EI2 B;  4O3T B;  2YNP A;  2PBI B;  3V5W B;  3CIK B;  5C2W B;  2H6Q A;  3SHF A;  2G99 A;  3UVN A;  3E0C A;  2H6N A;  2HXC A;  4FHL A;  4U7A A;  4XYI A;  3UVM A;  5JWZ A;  1K32 A;  4GGC A;  4GQ1 A;  3SBP A;  3IIW A;  4J82 A;  5K19 A;  2OIZ A;  3PVW B;  1MDA H;  3I7K A;  3RMZ D;  4A7J A;  5THA A;  1ERJ A;  4PBY A;  4FB1 D;  4QT8 A;  1PGU A;  1YFQ A;  3AL8 B;  5IT9 g;  4Z8L A;  5EAP A;  3PXT D;  1Q47 A;  3I8E A;  3UR4 A;  3ULE C;  3DWL C;  4NSX A;  5EMM B;  2P9P C;  4J8B A;  3N0D A;  4JXM A;  4J73 A;  3JB9 L;  3UKU C;  4PBZ A;  3EU7 A;  3BG1 A;  3GFC A;  4A2L A;  4X63 B;  3EI1 A;  4JT6 C;  1JOF A;  1NR0 A;  4LG8 A;  1QNI A;  2XL3 A;  4J84 A;  3L4O D;  2I3S A;  5AMS A;  4ZOY A;  2OVP B;  5GXI A;  2YB8 B;  2UZY B;  3FGB A;  3GRE A;  4BH6 A;  2XU7 A;  3IIY A;  5EM2 A;  4MK0 B;  3J80 g;  3SFZ A;  2GC4 A;  1U2V C;  2QXV A;  4J78 A;  4A08 A;  3MZK A;  5TEF A;  3KRX B;  4E54 B;  2PM9 A;  3JZG A;  2H9P A;  3JZN A;  3F3F A;  4J87 A;  5SXM A;  4JSN C;  3NVX A;  3K26 A;  4X61 B;  3SBR A;  4FA1 D;  3EWE A;  4ES0 A;  4J8G A;  5EAL A;  4J79 A;  2H9N A;  4IA9 A;  2J57 G;  2OJY A;  4U1E I;  5FQD A;  5CYK A;  1P22 A;  2CO0 A;  5FA5 B;  2AGZ A;  2Z2O A;  5EMJ B;  3JRP A;  3NVQ A;  3DXK C;  3UKR C;  1A0R B;  3EI4 A;  5IJ8 E;  2XL2 A;  4JSV C;  3F3G A;  5H1M A;  4YVD A;  3EI4 B;  3DM0 A;  2QC5 A;  2H6K A;  4BL0 A;  4PSW B;  2I0S A;  5GMK n;  4GMB A;  2AGY A;  3FRX A;  4Y5R D;  4UI9 R;  4D0K A;  3I7N A;  4FA9 D;  5EAR A;  3DXM C;  3EG6 A;  3OKY A;  3JZH A;  2AH1 A;  2CO0 C;  3SBQ A;  4A09 B;  4X3E A;  3PE7 A;  4ZOX A;  2XYI A;  1GP2 B;  3C75 H;  2OK6 A;  1SQJ A;  2TRC B;  2OK4 A;  3I89 A;  3RFG A;  4A0A B;  4A11 B;  2B5L A;  3B7F A;  2UZX B;  4IMM A;  4FAV D;  4JD2 C;  2J56 H;  5HE1 B;  4X60 B;  4GGA A;  5KDO B;  4OWR A;  4AEZ A;  5FKT A;  2BCJ B;  5EAM A;  4J86 A;  1OLZ A;  4EWR A;  2IUP A;  3C5M A;  4A08 B;  1R5M A;  4GQB B;  3IJ1 A;  4CY3 A;  4PXW A;  4A0B B;  2OVR B;  4E5Z A;  3SJL D;  4L1Q D;  4GM3 A;  2IAA A;  5H17 A;  3EI3 B;  2O9K A;  1GXR A;  5I5I A;  4R7A B;  2H9M A;  4XYH A;  5CXC A;  1GG2 B;  1U4C A;  3V7D B;  3MMY A;  2AGW A;  1N6E A;  1PBY B;  1VYH C;  2P9I C;  4GGD A;  3MZL A;  1XKS A;  2P9S C;  2AQ5 A;  3PVU B;  4KFM B;  4CI8 A;  4LG9 A;  4CY1 A;  3K27 A;  2AGX A;  5AJA A;  3UVO A;  2B4E A;  3PXW D;  5A2Q g;  4J0X A;  1NEX B;  4FA5 D;  5K1C C;  5CXB B;  4PNK B;  3N0E A;  4GZ8 A;  1PI6 A;  5C2V B;  1TBG A;  1XHM A;  3I2N A;  3KRW B;  4CZV A;  2IUR A;  4QL1 A;  4Y7R A;  5I5J A;  4CC9 A;  3JAM g;  1N6D A;  2PM6 B;  4K3I D;  4HDJ A;  4ERQ A;  2HJB A;  1B9X A;  1FWX A;  3NVN A;  3RN0 D;  3JRO A;  4A09 A;  3PSL A;  1JMZ B;  4FA4 D;  5GSA A;  3MKQ A;  3RN1 D;  3OW8 A;  3OL2 A;  3MXX A;  2HES X;  4PSX B;  5HQG A;  2Q7Q A;  2IUV A;  3RLM D;  5EML B;  5CYK B;  5HYN B;  3OL2 B;  4D6V A;  4GM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...