3BG0A

Architecture of a coat for the nuclear pore membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
291
structure length
283
Chain Sequence
b'DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SEC13 homolog
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, hydrolase
total genus 52
structure length 283
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg0A00
3I7OA 2GNQA 1N6DA 3OKTA 4LGNA 3EI1A 1FWXA 5HE2B 3I7KA 5EMKB 3GREA 5JWZA 4GGDA 2H3XA 5I5IA 2Z2NA 2HXCA 3B7FA 4O45A 3C5MA 4CI8A 2B5MA 4ERYA 4UI9R 3RN0D 4A09A 1L0QA 2J56H 2PBIB 2XL2A 3PE7A 2GC7A 3UR4A 3C9CA 4J87A 3JROA 4X61B 3EI3A 3AL8A 3V5WB 3NVXA 3EG6A 2P9NC 5FXYA 2CE9A 4GQBB 3EI2A 2QXVA 3SXTD 2PM6B 2PM9B 3OKWA 4GQ2P 4CI3A 2P9KC 4R7AB 3IIWA 3N0EA 1JOFA 5AMSA 2I0TA 3JB9L 2B5LA 2BBKH 5EAMA 5FKQA 4J0XA 2H6KA 4L3HD 4ERQA 2MTAH 4X60B 3JZHA 1N6FA 1VYHC 2IUPA 3FGBA 4FA4D 4JT5C 3UVKA 4GM9A 4Y7RA 4ZOYA 4L9OA 1Q47A 3BWSA 1OLZA 2H13A 2XU7A 5H17A 3MXXA 2BCJB 2PM7B 3AL9A 3L4OD 2G9AA 3SMRA 2Z2OA 2IWKA 4A0AA 2G99A 4FA5D 3I2NA 3MMYA 3EI4A 3OL2A 4JXMA 2H9PA 3KRXB 3HFQA 2J55H 1XKSA 4O3UB 1MG2A 3RRMC 3MZLA 5K1CC 2P9IC 3UVMA 3E0CA 3PSCB 2I0SA 1PBYB 3IJ1A 1PGUA 1MDAH 3UKRC 1A0RB 2H14A 4ZOVA 4GGAA 4K3JB 4GM8A 5SXMA 2UZYB 3BG0A 5FKRA 2IAAA 3SWSD 1NEXB 2H9LA 2P9LC 3JAMg 1XIPA 4D6VA 4ZN4A 4PNKB 5TDHB 4GZ8A 3ULEC 5C2WB 2H9MA 5CXBA 5TEEA 4A0BA 2TRCB 3IKOA 2OK4A 5H14A 4GQ1A 3JZNA 3UVOA 5GXIA 4PBYA 2H47A 4D0KA 1P22A 3K26A 3AFCA 2GC4A 4A11A 2IURA 4A7JA 3JRPA 3N0DA 5EAPA 4BL0A 3C75H 2YB8B 3SLED 4ERZA 3CFSB 3JPXA 4H5JA 3PXWD 4AOWA 4CY5A 2XYIA 2OK6A 5GSAA 3CIKB 4J84A 4XYHA 3SCYA 2AQ5A 4JSVC 4CI1A 2I3TA 4LG8A 1N6EA 5EMJB 4FA1D 5C9ZB 5K19A 4KFMB 2CO0C 2Z2PA 4A2MA 4BUJC 4A08B 1PI6A 2IUVA 3IIYA 4BH6A 1RI6A 3A0FA 3ORVD 1ERJA 1B9XA 2CN3A 5HE3B 3FM0A 3MKSB 3ZWLB 3EU7A 3GFCA 3C99A 1K32A 3AH8B 5EARA 3I7HA 4NSXA 4QL1A 2HYEA 2P9PC 4E5ZA 2XL3A 5TF2A 4CZXA 4FAND 1JJUB 3V9FA 4MK0B 5KDOB 2AGXA 1JMXB 4O1QD 1PEVA 3NVNA 1GG2B 4E54B 2AGZA 1SQ9A 5HQGA 4A2LA 5CXCB 4CY2A 2YNPA 4J86A 5CYKB 3EWEA 4OZUA 1TBGA 3DWLC 2HJBA 3OKYB 3CFVA 3U4YA 4CZYA 4FB1D 3VH0A 4JSPC 4ZOZA 4O3TB 3I8EA 5TEFA 3EMHA 2AH0A 4Y5RD 4PSWB 4Z8LA 2Q7QA 5IT9g 2OJYA 3EI1B 3OW8A 4CZVA 3DM0A 4J79A 4QT8A 1MG3A 2EBSA 3PSLA 2HKMA 3SN6B 1JMZB 4YVDA 5EM2A 3UVNA 4J8BA 2OVRB 5B4WA 4FA9D 5FKTA 2H6NA 3PVWB 2IUQA 2AGLA 2YNNA 5HE1B 4PC0A 2AGYA 4ESGA 3RMZD 3W15A 3IJCA 1SQJA 4ES0A 2YNOA 5IGOA 4A09B 4K3ID 5IGQA 4GMBA 4QRJA 2W18A 1S4UX 3EI3B 4X63B 3AL8B 3UVLA 3SFZA 3V7DB 2HESX 3SBQA 3EI2B 3DSMA 5FA5B 4CY3A 3J80g 5IJ8E 3VA6A 4IA9A 5AJAA 5H1MA 4PSXB 4GM3A 3J81g 5EALA 2AGWA 3SHFA 5EMMB 4OWRA 2OVPB 3BG1A 4U1EI 4JD2C 3L4MD 4O9DA 1QNIA 2H6QA 2CE8A 3JZGA 3MKQA 5IC7A 5THAA 5HE0B 3DXMC 4E5ZB 2UZXB 4XYIA 4QQEA 1SHYB 4IMMA 2H68A 2CN2A 1GXRA 4FAVD 4CY1A 5EMLB 2I0RA 4J77A 2AH1A 3I7NA 4I79A 3RFHA 4J8GA 3PXSD 3NVQA 4FWWA 1YFQA 4L3GD 2HKRA 3RN1D 2CNXA 4J78A 1XHMA 5FQDA 4A0AB 3MZKA 2IWFA 3VGZA 3OTTA 3ODTA 3EI4B 3OL2B 2P9SC 3SVWD 3FRXA 3RLMD 4XEIC 3UKUC 4HDJA 4PBZA 3SJLD 3F3FA 3PXTD 5I5JA 3KRWB 1GOTB 4JSXC 5GXHA 4ZOXA 4FHLA 4EWRA 4L1QD 4U7AA 4H5IA 2H9NA 5EM2B 3I89A 1U2VC 4X3EA 3SBPA 1OMWB 5IJ7E 4G56B 1B9YA 1GP2B 5GMKn 2I3SA 4A08A 1K8KC 2PM9A 5A2Qg 1R5MA 4CC9A 3SBRA 5HYNB 1U4CA 2O9KA 3F3PA 1TYQC 3IJ0A 3I7PA 2OVQB 4N14A 5CXBB 4A0BB 4GGCA 4AEZA 4LG9A 2YMUA 5I5MA 1NR0A 2YBAA 3RSEC 4JT6C 2J57G 3PVUB 4JSNC 3DXKC 4CI2A 3F3GA 5C2VB 4A11B 5FLXg 2B5NA 4J82A 2QC5A 4E54A 4TZ4A 5CXCA 2B4EA 3P4FA 5CYKA 5FKSA 4J73A 3RFGA 3OKYA 4J81A 3I7LA 2HJ4A 4J0WA 3I8CA 2CO0A 2P9UC 5AFU3 4PXWA 3K27A 2OIZA
chains in the Genus database with same CATH superfamily
3I7OA 2GNQA 1N6DA 3OKTA 4LGNA 3EI1A 1FWXA 3V4PA 3EQ7A 4QAMA 5HE2B 2HU5A 2HU7A 3I7KA 5EMKB 3GREA 4RE5A 5JWZA 4GGDA 2H3XA 5I5IA 2Z2NA 2HXCA 3B7FA 4UM9A 1H2XA 4O45A 3EQ9A 3C5MA 1GOHA 3KCIA 4CI8A 2B5MA 4ERYA 4UI9R 3RN0D 4A09A 1L0QA 2J56H 2PBIB 2XL2A 3PE7A 2GC7A 3UR4A 3C9CA 4J87A 4WK2A 1VZ2A 3JROA 4X61B 3EI3A 1O6GA 3AL8A 1O6FA 3V5WB 3NIGA 3NVXA 5C86A 3EG6A 2P9NC 5FXYA 2CE9A 4GQBB 3EI2A 2QXVA 3IJEA 3SXTD 2PM6B 2PM9B 3OKWA 4D9SA 4GQ2P 4CI3A 2P9KC 4R7AB 3IIWA 3N0EA 1JOFA 5AMSA 2I0TA 3JB9L 2B5LA 3GD1I 2BBKH 5EAMA 5FKQA 2VZ1A 4J0XA 2H6KA 2VDLA 3NIFA 2VDPA 1QFMA 4L3HD 3QHYB 4ERQA 2VDKA 2MTAH 1GOGA 4X60B 3JZHA 1N6FA 1VYHC 2VC2A 2IUPA 3FGBA 3O4HA 3ZE1A 3VI4A 4AN1A 4FA4D 4JT5C 4WK4A 3UVKA 4GM9A 4Y7RA 4ZOYA 4L9OA 1Q47A 1E5TA 3BWSA 1OLZA 2H13A 2XU7A 5H17A 3MXXA 2BCJB 2PM7B 4MMZA 3VI3A 4MMYA 3AL9A 2XE4A 2G9AA 3L4OD 3SMRA 2Z2OA 2IWKA 4NC4A 4AN0A 2G99A 4A0AA 4AX4A 4FA5D 3I2NA 3MMYA 3EI4A 3OL2A 3ZE2A 4JXMA 2H9PA 3KRXB 3HFQA 2J55H 4BCDA 1XKSA 4O3UB 1MG2A 3RRMC 5M5RA 3MZLA 5K1CC 2P9IC 3UVMA 3E0CA 3PSCB 2I0SA 3O4JA 1PBYB 3IJ1A 1PGUA 1MDAH 1M1XA 3UKRC 1A0RB 2H14A 4ZOVA 1UOQA 4GGAA 4K3JB 4GM8A 5SXMA 2UZYB 3BG0A 5FKRA 2IAAA 3SWSD 1NEXB 2H9LA 2P9LC 3JAMg 4AMZA 1XIPA 4D6VA 3O4GA 4ZN4A 4PNKB 5TDHB 4GZ8A 3ULEC 5C2WB 3OF7A 2H9MA 5CXBA 5TEEA 2XZGA 4A0BA 2TRCB 3IKOA 2OK4A 4RE6A 5H14A 4GQ1A 3JZNA 3UVOA 1I2MB 3IUNA 4BCCA 5GXIA 4PBYA 4NENA 2H47A 4D0KA 1P22A 3K26A 3AFCA 2GC4A 4A11A 2IURA 4A7JA 3JRPA 2VZ3A 3N0DA 5EAPA 4BL0A 4Z7OA 3C75H 2YB8B 3IVMA 3SLED 4ERZA 3CFSB 3JPXA 4H5JA 3PXWD 4AOWA 1UOPA 4CY5A 5M5UA 2XYIA 2OK6A 2VDNA 5M61A 5GSAA 5HDBA 3CIKB 5E6SA 3DDUA 4J84A 4XYHA 3SCYA 3ZDZA 2VDOA 2AQ5A 4JSVC 4CI1A 2I3TA 4LG8A 1N6EA 5EMJB 4FA1D 5C9ZB 5C92A 5K19A 4KFMB 2CO0C 2Z2PA 5M5TA 1C9IA 4A2MA 1QFSA 2VDMA 4BUJC 4A08B 1PI6A 2IUVA 3IIYA 4BH6A 1RI6A 3A0FA 3ORVD 1ERJA 4G1EA 1B9XA 2CN3A 5HE3B 3FM0A 3MKSB 3ZWLB 3EU7A 3EQ8A 3GFCA 3C99A 1K32A 3V4VA 4IRZA 3AH8B 5EARA 3I7HA 4NSXA 4QL1A 1BPOA 2HYEA 2P9PC 4E5ZA 4UM8A 2XL3A 1L5GA 5TF2A 4CZXA 4FAND 1JJUB 3IUJA 3V9FA 4MK0B 5KDOB 2AGXA 1JMXB 4O1QD 1PEVA 3NVNA 1A12A 4Z7NA 1H2WA 1GG2B 4E54B 1GOFA 1UOOA 1SQ9A 2AGZA 5HQGA 1K3IA 4A2LA 5CXCB 4CY2A 2YNPA 4J86A 5CYKB 3EWEA 4OZUA 4Z7QA 1TBGA 2XDWA 3DWLC 2HJBA 3GC3B 3OKYB 3MUOA 3CFVA 1UTCA 3U4YA 4CZYA 4G55A 4FB1D 3VH0A 1H2ZA 4JSPC 4ZOZA 4O3TB 3I8EA 5TEFA 3EMHA 2AH0A 4Y5RD 4PSWB 4Z8LA 2Q7QA 5IT9g 2OJYA 3EI1B 3OW8A 4CZVA 3DM0A 4J79A 4QT8A 2EIDA 1MG3A 2EBSA 3PSLA 4WK0A 2HKMA 3SN6B 1JMZB 4YVDA 5EM2A 3UVNA 2EIBA 4J8BA 2OVRB 3FCUA 2WQ8A 5B4WA 4FA9D 1VE6A 5FKTA 2H6NA 4DNVA 2VDRA 1T2XA 3PVWB 2IUQA 2AGLA 1VZ3A 2YNNA 5HE1B 4DNUA 4PC0A 3K6SA 2AGYA 4ESGA 3IULA 3RMZD 3W15A 3IJCA 1SQJA 4ES0A 2YNOA 5IGOA 1E8MA 4A09B 4K3ID 5IGQA 4GMBA 3K71A 4QRJA 2W18A 1S4UX 1U8CA 3ZDYA 3EI3B 4X63B 2QR5A 3AL8B 3UVLA 5E6UA 4O02A 3SFZA 3V7DB 2HESX 3ZE0A 3SBQA 3EI2B 3DSMA 5FA5B 4CY3A 3J80g 5IJ8E 3IURA 3VA6A 4IA9A 5AJAA 5H1MA 4PSXB 3MUNA 4GM3A 3FCSA 3J81g 5EALA 4WJKA 2AGWA 3SHFA 5EMMB 4OWRA 2OVPB 3BG1A 4U1EI 4JD2C 3L4MD 4O9DA 5M5SA 1QNIA 5FFOA 2H6QA 3ZDXA 2CE8A 3JZGA 3MKQA 5IC7A 5THAA 5HE0B 3DXMC 4E5ZB 2UZXB 4XYIA 4QQEA 1SHYB 4IMMA 2H68A 2CN2A 1GXRA 2QZPA 4FAVD 1JV2A 4CY1A 2HU8A 5EMLB 2I0RA 4J77A 2AH1A 3I7NA 4I79A 4JHPC 5FFGA 4J8GA 3RFHA 3PXSD 4DNWA 3NIDA 3NVQA 4FWWA 1YFQA 4L3GD 2HKRA 3RN1D 2CNXA 4J78A 1XHMA 5FQDA 4A0AB 3MZKA 2EIEA 1H2YA 2IWFA 4G1MA 3VGZA 3OTTA 3ODTA 3EI4B 3OL2B 2P9SC 3SVWD 3FRXA 3RLMD 4L1MA 4XEIC 3UKUC 4HDJA 4PBZA 3SJLD 3IUMA 3F3FA 3PXTD 5I5JA 3KRWB 4MMXA 1GOTB 4JSXC 5GXHA 4ZOXA 4FHLA 4EWRA 4L1QD 4U7AA 4H5IA 1TYEA 2H9NA 5EM2B 3I89A 1U2VC 3MVDK 4X3EA 3SBPA 1OMWB 5IJ7E 4G56B 1B9YA 1GP2B 5GMKn 2I3SA 4A08A 1K8KC 2PM9A 5A2Qg 1R5MA 4CC9A 3O4IA 3SBRA 5HYNB 1U4CA 2O9KA 3F3PA 1TYQC 4NAAA 3IJ0A 3I7PA 2OVQB 4N14A 5CXBB 1C9LA 5E6RA 4A0BB 4GGCA 4AEZA 4LG9A 1E8NA 2YMUA 1NR0A 5I5MA 2YBAA 3RSEC 4JT6C 2J57G 2BKLA 3K72A 3PVUB 4JSNC 3DXKC 4AMYA 3T3MA 4CI2A 2JKXA 5M5VA 3F3GA 3QI0A 4A11B 5C2VB 5FLXg 2B5NA 4O2WA 4NBMA 3IUQA 4J82A 1JTDB 2QC5A 2EICA 4E54A 2VDQA 4BP9A 4TZ4A 5CXCA 2B4EA 3P4FA 4BCBA 5CYKA 3T3PA 4JHNA 5FKSA 1VE7A 1YR2A 4J73A 3OKYA 3RFGA 4J81A 3I7LA 2HJ4A 4J0WA 3I8CA 2CO0A 2P9UC 5AFU3 4PXWA 3K27A 4BP8A 2OIZA
chains in the Genus database with same CATH topology
3I7OA 2GNQA 1N6DA 3OKTA 4LGNA 3EI1A 1FWXA 5HE2B 3I7KA 5EMKB 3GREA 5JWZA 4GGDA 2H3XA 5I5IA 2Z2NA 2HXCA 3B7FA 4O45A 3C5MA 4CI8A 2B5MA 4ERYA 4UI9R 3RN0D 4A09A 1L0QA 2J56H 2PBIB 2XL2A 3PE7A 2GC7A 3UR4A 3C9CA 4J87A 3JROA 4X61B 3EI3A 3AL8A 3V5WB 3NVXA 3EG6A 2P9NC 5FXYA 2CE9A 4GQBB 3EI2A 2QXVA 3SXTD 2PM6B 2PM9B 3OKWA 4GQ2P 4CI3A 2P9KC 4R7AB 3IIWA 3N0EA 1JOFA 5AMSA 2I0TA 3JB9L 2B5LA 2BBKH 5EAMA 5FKQA 4J0XA 2H6KA 4L3HD 4ERQA 2MTAH 4X60B 3JZHA 1N6FA 1VYHC 2IUPA 3FGBA 4FA4D 4JT5C 3UVKA 4GM9A 4Y7RA 4ZOYA 4L9OA 1Q47A 3BWSA 1OLZA 2H13A 2XU7A 5H17A 3MXXA 2BCJB 2PM7B 3AL9A 3L4OD 2G9AA 3SMRA 2Z2OA 2IWKA 4A0AA 2G99A 4FA5D 3I2NA 3MMYA 3EI4A 3OL2A 4JXMA 2H9PA 3KRXB 3HFQA 2J55H 1XKSA 4O3UB 1MG2A 3RRMC 3MZLA 5K1CC 2P9IC 3UVMA 3E0CA 3PSCB 2I0SA 1PBYB 3IJ1A 1PGUA 1MDAH 3UKRC 1A0RB 2H14A 4ZOVA 4GGAA 4K3JB 4GM8A 5SXMA 2UZYB 3BG0A 5FKRA 2IAAA 3SWSD 1NEXB 2H9LA 2P9LC 3JAMg 1XIPA 4D6VA 4ZN4A 4PNKB 5TDHB 4GZ8A 3ULEC 5C2WB 2H9MA 5CXBA 5TEEA 4A0BA 2TRCB 3IKOA 2OK4A 5H14A 4GQ1A 3JZNA 3UVOA 5GXIA 4PBYA 2H47A 4D0KA 1P22A 3K26A 3AFCA 2GC4A 4A11A 2IURA 4A7JA 3JRPA 3N0DA 5EAPA 4BL0A 3C75H 2YB8B 3SLED 4ERZA 3CFSB 3JPXA 4H5JA 3PXWD 4AOWA 4CY5A 2XYIA 2OK6A 5GSAA 3CIKB 4J84A 4XYHA 3SCYA 2AQ5A 4JSVC 4CI1A 2I3TA 4LG8A 1N6EA 5EMJB 4FA1D 5C9ZB 5K19A 4KFMB 2CO0C 2Z2PA 4A2MA 4BUJC 4A08B 1PI6A 2IUVA 3IIYA 4BH6A 1RI6A 3A0FA 3ORVD 1ERJA 1B9XA 2CN3A 5HE3B 3FM0A 3MKSB 3ZWLB 3EU7A 3GFCA 3C99A 1K32A 3AH8B 5EARA 3I7HA 4NSXA 4QL1A 2HYEA 2P9PC 4E5ZA 2XL3A 5TF2A 4CZXA 4FAND 1JJUB 3V9FA 4MK0B 5KDOB 2AGXA 1JMXB 4O1QD 1PEVA 3NVNA 1GG2B 4E54B 2AGZA 1SQ9A 5HQGA 4A2LA 5CXCB 4CY2A 2YNPA 4J86A 5CYKB 3EWEA 4OZUA 1TBGA 3DWLC 2HJBA 3OKYB 3CFVA 3U4YA 4CZYA 4FB1D 3VH0A 4JSPC 4ZOZA 4O3TB 3I8EA 5TEFA 3EMHA 2AH0A 4Y5RD 4PSWB 4Z8LA 2Q7QA 5IT9g 2OJYA 3EI1B 3OW8A 4CZVA 3DM0A 4J79A 4QT8A 1MG3A 2EBSA 3PSLA 2HKMA 3SN6B 1JMZB 4YVDA 5EM2A 3UVNA 4J8BA 2OVRB 5B4WA 4FA9D 5FKTA 2H6NA 3PVWB 2IUQA 2AGLA 2YNNA 5HE1B 4PC0A 2AGYA 4ESGA 3RMZD 3W15A 3IJCA 1SQJA 4ES0A 2YNOA 5IGOA 4A09B 4K3ID 5IGQA 4GMBA 4QRJA 2W18A 1S4UX 3EI3B 4X63B 3AL8B 3UVLA 3SFZA 3V7DB 2HESX 3SBQA 3EI2B 3DSMA 5FA5B 4CY3A 3J80g 5IJ8E 3VA6A 4IA9A 5AJAA 5H1MA 4PSXB 4GM3A 3J81g 5EALA 2AGWA 3SHFA 5EMMB 4OWRA 2OVPB 3BG1A 4U1EI 4JD2C 3L4MD 4O9DA 1QNIA 2H6QA 2CE8A 3JZGA 3MKQA 5IC7A 5THAA 5HE0B 3DXMC 4E5ZB 2UZXB 4XYIA 4QQEA 1SHYB 4IMMA 2H68A 2CN2A 1GXRA 4FAVD 4CY1A 5EMLB 2I0RA 4J77A 2AH1A 3I7NA 4I79A 3RFHA 4J8GA 3PXSD 3NVQA 4FWWA 1YFQA 4L3GD 2HKRA 3RN1D 2CNXA 4J78A 1XHMA 5FQDA 4A0AB 3MZKA 2IWFA 3VGZA 3OTTA 3ODTA 3EI4B 3OL2B 2P9SC 3SVWD 3FRXA 3RLMD 4XEIC 3UKUC 4HDJA 4PBZA 3SJLD 3F3FA 3PXTD 5I5JA 3KRWB 1GOTB 4JSXC 5GXHA 4ZOXA 4FHLA 4EWRA 4L1QD 4U7AA 4H5IA 2H9NA 5EM2B 3I89A 1U2VC 4X3EA 3SBPA 1OMWB 5IJ7E 4G56B 1B9YA 1GP2B 5GMKn 2I3SA 4A08A 1K8KC 2PM9A 5A2Qg 1R5MA 4CC9A 3SBRA 5HYNB 1U4CA 2O9KA 3F3PA 1TYQC 3IJ0A 3I7PA 2OVQB 4N14A 5CXBB 4A0BB 4GGCA 4AEZA 4LG9A 2YMUA 5I5MA 1NR0A 2YBAA 3RSEC 4JT6C 2J57G 3PVUB 4JSNC 3DXKC 4CI2A 3F3GA 5C2VB 4A11B 5FLXg 2B5NA 4J82A 2QC5A 4E54A 4TZ4A 5CXCA 2B4EA 3P4FA 5CYKA 5FKSA 4J73A 3RFGA 3OKYA 4J81A 3I7LA 2HJ4A 4J0WA 3I8CA 2CO0A 2P9UC 5AFU3 4PXWA 3K27A 2OIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7O A;  2GNQ A;  1N6D A;  3OKT A;  4LGN A;  3EI1 A;  1FWX A;  5HE2 B;  3I7K A;  5EMK B;  3GRE A;  5JWZ A;  4GGD A;  2H3X A;  5I5I A;  2Z2N A;  2HXC A;  3B7F A;  4O45 A;  3C5M A;  4CI8 A;  2B5M A;  4ERY A;  4UI9 R;  3RN0 D;  4A09 A;  1L0Q A;  2J56 H;  2PBI B;  2XL2 A;  3PE7 A;  2GC7 A;  3UR4 A;  3C9C A;  4J87 A;  3JRO A;  4X61 B;  3EI3 A;  3AL8 A;  3V5W B;  3NVX A;  3EG6 A;  2P9N C;  5FXY A;  2CE9 A;  4GQB B;  3EI2 A;  2QXV A;  3SXT D;  2PM6 B;  2PM9 B;  3OKW A;  4GQ2 P;  4CI3 A;  2P9K C;  4R7A B;  3IIW A;  3N0E A;  1JOF A;  5AMS A;  2I0T A;  3JB9 L;  2B5L A;  2BBK H;  5EAM A;  5FKQ A;  4J0X A;  2H6K A;  4L3H D;  4ERQ A;  2MTA H;  4X60 B;  3JZH A;  1N6F A;  1VYH C;  2IUP A;  3FGB A;  4FA4 D;  4JT5 C;  3UVK A;  4GM9 A;  4Y7R A;  4ZOY A;  4L9O A;  1Q47 A;  3BWS A;  1OLZ A;  2H13 A;  2XU7 A;  5H17 A;  3MXX A;  2BCJ B;  2PM7 B;  3AL9 A;  3L4O D;  2G9A A;  3SMR A;  2Z2O A;  2IWK A;  4A0A A;  2G99 A;  4FA5 D;  3I2N A;  3MMY A;  3EI4 A;  3OL2 A;  4JXM A;  2H9P A;  3KRX B;  3HFQ A;  2J55 H;  1XKS A;  4O3U B;  1MG2 A;  3RRM C;  3MZL A;  5K1C C;  2P9I C;  3UVM A;  3E0C A;  3PSC B;  2I0S A;  1PBY B;  3IJ1 A;  1PGU A;  1MDA H;  3UKR C;  1A0R B;  2H14 A;  4ZOV A;  4GGA A;  4K3J B;  4GM8 A;  5SXM A;  2UZY B;  3BG0 A;  5FKR A;  2IAA A;  3SWS D;  1NEX B;  2H9L A;  2P9L C;  3JAM g;  1XIP A;  4D6V A;  4ZN4 A;  4PNK B;  5TDH B;  4GZ8 A;  3ULE C;  5C2W B;  2H9M A;  5CXB A;  5TEE A;  4A0B A;  2TRC B;  3IKO A;  2OK4 A;  5H14 A;  4GQ1 A;  3JZN A;  3UVO A;  5GXI A;  4PBY A;  2H47 A;  4D0K A;  1P22 A;  3K26 A;  3AFC A;  2GC4 A;  4A11 A;  2IUR A;  4A7J A;  3JRP A;  3N0D A;  5EAP A;  4BL0 A;  3C75 H;  2YB8 B;  3SLE D;  4ERZ A;  3CFS B;  3JPX A;  4H5J A;  3PXW D;  4AOW A;  4CY5 A;  2XYI A;  2OK6 A;  5GSA A;  3CIK B;  4J84 A;  4XYH A;  3SCY A;  2AQ5 A;  4JSV C;  4CI1 A;  2I3T A;  4LG8 A;  1N6E A;  5EMJ B;  4FA1 D;  5C9Z B;  5K19 A;  4KFM B;  2CO0 C;  2Z2P A;  4A2M A;  4BUJ C;  4A08 B;  1PI6 A;  2IUV A;  3IIY A;  4BH6 A;  1RI6 A;  3A0F A;  3ORV D;  1ERJ A;  1B9X A;  2CN3 A;  5HE3 B;  3FM0 A;  3MKS B;  3ZWL B;  3EU7 A;  3GFC A;  3C99 A;  1K32 A;  3AH8 B;  5EAR A;  3I7H A;  4NSX A;  4QL1 A;  2HYE A;  2P9P C;  4E5Z A;  2XL3 A;  5TF2 A;  4CZX A;  4FAN D;  1JJU B;  3V9F A;  4MK0 B;  5KDO B;  2AGX A;  1JMX B;  4O1Q D;  1PEV A;  3NVN A;  1GG2 B;  4E54 B;  2AGZ A;  1SQ9 A;  5HQG A;  4A2L A;  5CXC B;  4CY2 A;  2YNP A;  4J86 A;  5CYK B;  3EWE A;  4OZU A;  1TBG A;  3DWL C;  2HJB A;  3OKY B;  3CFV A;  3U4Y A;  4CZY A;  4FB1 D;  3VH0 A;  4JSP C;  4ZOZ A;  4O3T B;  3I8E A;  5TEF A;  3EMH A;  2AH0 A;  4Y5R D;  4PSW B;  4Z8L A;  2Q7Q A;  5IT9 g;  2OJY A;  3EI1 B;  3OW8 A;  4CZV A;  3DM0 A;  4J79 A;  4QT8 A;  1MG3 A;  2EBS A;  3PSL A;  2HKM A;  3SN6 B;  1JMZ B;  4YVD A;  5EM2 A;  3UVN A;  4J8B A;  2OVR B;  5B4W A;  4FA9 D;  5FKT A;  2H6N A;  3PVW B;  2IUQ A;  2AGL A;  2YNN A;  5HE1 B;  4PC0 A;  2AGY A;  4ESG A;  3RMZ D;  3W15 A;  3IJC A;  1SQJ A;  4ES0 A;  2YNO A;  5IGO A;  4A09 B;  4K3I D;  5IGQ A;  4GMB A;  4QRJ A;  2W18 A;  1S4U X;  3EI3 B;  4X63 B;  3AL8 B;  3UVL A;  3SFZ A;  3V7D B;  2HES X;  3SBQ A;  3EI2 B;  3DSM A;  5FA5 B;  4CY3 A;  3J80 g;  5IJ8 E;  3VA6 A;  4IA9 A;  5AJA A;  5H1M A;  4PSX B;  4GM3 A;  3J81 g;  5EAL A;  2AGW A;  3SHF A;  5EMM B;  4OWR A;  2OVP B;  3BG1 A;  4U1E I;  4JD2 C;  3L4M D;  4O9D A;  1QNI A;  2H6Q A;  2CE8 A;  3JZG A;  3MKQ A;  5IC7 A;  5THA A;  5HE0 B;  3DXM C;  4E5Z B;  2UZX B;  4XYI A;  4QQE A;  1SHY B;  4IMM A;  2H68 A;  2CN2 A;  1GXR A;  4FAV D;  4CY1 A;  5EML B;  2I0R A;  4J77 A;  2AH1 A;  3I7N A;  4I79 A;  3RFH A;  4J8G A;  3PXS D;  3NVQ A;  4FWW A;  1YFQ A;  4L3G D;  2HKR A;  3RN1 D;  2CNX A;  4J78 A;  1XHM A;  5FQD A;  4A0A B;  3MZK A;  2IWF A;  3VGZ A;  3OTT A;  3ODT A;  3EI4 B;  3OL2 B;  2P9S C;  3SVW D;  3FRX A;  3RLM D;  4XEI C;  3UKU C;  4HDJ A;  4PBZ A;  3SJL D;  3F3F A;  3PXT D;  5I5J A;  3KRW B;  1GOT B;  4JSX C;  5GXH A;  4ZOX A;  4FHL A;  4EWR A;  4L1Q D;  4U7A A;  4H5I A;  2H9N A;  5EM2 B;  3I89 A;  1U2V C;  4X3E A;  3SBP A;  1OMW B;  5IJ7 E;  4G56 B;  1B9Y A;  1GP2 B;  5GMK n;  2I3S A;  4A08 A;  1K8K C;  2PM9 A;  5A2Q g;  1R5M A;  4CC9 A;  3SBR A;  5HYN B;  1U4C A;  2O9K A;  3F3P A;  1TYQ C;  3IJ0 A;  3I7P A;  2OVQ B;  4N14 A;  5CXB B;  4A0B B;  4GGC A;  4AEZ A;  4LG9 A;  2YMU A;  5I5M A;  1NR0 A;  2YBA A;  3RSE C;  4JT6 C;  2J57 G;  3PVU B;  4JSN C;  3DXK C;  4CI2 A;  3F3G A;  5C2V B;  4A11 B;  5FLX g;  2B5N A;  4J82 A;  2QC5 A;  4E54 A;  4TZ4 A;  5CXC A;  2B4E A;  3P4F A;  5CYK A;  5FKS A;  4J73 A;  3RFG A;  3OKY A;  4J81 A;  3I7L A;  2HJ4 A;  4J0W A;  3I8C A;  2CO0 A;  2P9U C;  5AFU 3;  4PXW A;  3K27 A;  2OIZ A; 
#chains in the Genus database with same CATH topology
 3I7O A;  2GNQ A;  1N6D A;  3OKT A;  4LGN A;  3EI1 A;  1FWX A;  3V4P A;  3EQ7 A;  4QAM A;  5HE2 B;  2HU5 A;  2HU7 A;  3I7K A;  5EMK B;  3GRE A;  4RE5 A;  5JWZ A;  4GGD A;  2H3X A;  5I5I A;  2Z2N A;  2HXC A;  3B7F A;  4UM9 A;  1H2X A;  4O45 A;  3EQ9 A;  3C5M A;  1GOH A;  3KCI A;  4CI8 A;  2B5M A;  4ERY A;  4UI9 R;  3RN0 D;  4A09 A;  1L0Q A;  2J56 H;  2PBI B;  2XL2 A;  3PE7 A;  2GC7 A;  3UR4 A;  3C9C A;  4J87 A;  4WK2 A;  1VZ2 A;  3JRO A;  4X61 B;  3EI3 A;  1O6G A;  3AL8 A;  1O6F A;  3V5W B;  3NIG A;  3NVX A;  5C86 A;  3EG6 A;  2P9N C;  5FXY A;  2CE9 A;  4GQB B;  3EI2 A;  2QXV A;  3IJE A;  3SXT D;  2PM6 B;  2PM9 B;  3OKW A;  4D9S A;  4GQ2 P;  4CI3 A;  2P9K C;  4R7A B;  3IIW A;  3N0E A;  1JOF A;  5AMS A;  2I0T A;  3JB9 L;  2B5L A;  3GD1 I;  2BBK H;  5EAM A;  5FKQ A;  2VZ1 A;  4J0X A;  2H6K A;  2VDL A;  3NIF A;  2VDP A;  1QFM A;  4L3H D;  3QHY B;  4ERQ A;  2VDK A;  2MTA H;  1GOG A;  4X60 B;  3JZH A;  1N6F A;  1VYH C;  2VC2 A;  2IUP A;  3FGB A;  3O4H A;  3ZE1 A;  3VI4 A;  4AN1 A;  4FA4 D;  4JT5 C;  4WK4 A;  3UVK A;  4GM9 A;  4Y7R A;  4ZOY A;  4L9O A;  1Q47 A;  1E5T A;  3BWS A;  1OLZ A;  2H13 A;  2XU7 A;  5H17 A;  3MXX A;  2BCJ B;  2PM7 B;  4MMZ A;  3VI3 A;  4MMY A;  3AL9 A;  2XE4 A;  2G9A A;  3L4O D;  3SMR A;  2Z2O A;  2IWK A;  4NC4 A;  4AN0 A;  2G99 A;  4A0A A;  4AX4 A;  4FA5 D;  3I2N A;  3MMY A;  3EI4 A;  3OL2 A;  3ZE2 A;  4JXM A;  2H9P A;  3KRX B;  3HFQ A;  2J55 H;  4BCD A;  1XKS A;  4O3U B;  1MG2 A;  3RRM C;  5M5R A;  3MZL A;  5K1C C;  2P9I C;  3UVM A;  3E0C A;  3PSC B;  2I0S A;  3O4J A;  1PBY B;  3IJ1 A;  1PGU A;  1MDA H;  1M1X A;  3UKR C;  1A0R B;  2H14 A;  4ZOV A;  1UOQ A;  4GGA A;  4K3J B;  4GM8 A;  5SXM A;  2UZY B;  3BG0 A;  5FKR A;  2IAA A;  3SWS D;  1NEX B;  2H9L A;  2P9L C;  3JAM g;  4AMZ A;  1XIP A;  4D6V A;  3O4G A;  4ZN4 A;  4PNK B;  5TDH B;  4GZ8 A;  3ULE C;  5C2W B;  3OF7 A;  2H9M A;  5CXB A;  5TEE A;  2XZG A;  4A0B A;  2TRC B;  3IKO A;  2OK4 A;  4RE6 A;  5H14 A;  4GQ1 A;  3JZN A;  3UVO A;  1I2M B;  3IUN A;  4BCC A;  5GXI A;  4PBY A;  4NEN A;  2H47 A;  4D0K A;  1P22 A;  3K26 A;  3AFC A;  2GC4 A;  4A11 A;  2IUR A;  4A7J A;  3JRP A;  2VZ3 A;  3N0D A;  5EAP A;  4BL0 A;  4Z7O A;  3C75 H;  2YB8 B;  3IVM A;  3SLE D;  4ERZ A;  3CFS B;  3JPX A;  4H5J A;  3PXW D;  4AOW A;  1UOP A;  4CY5 A;  5M5U A;  2XYI A;  2OK6 A;  2VDN A;  5M61 A;  5GSA A;  5HDB A;  3CIK B;  5E6S A;  3DDU A;  4J84 A;  4XYH A;  3SCY A;  3ZDZ A;  2VDO A;  2AQ5 A;  4JSV C;  4CI1 A;  2I3T A;  4LG8 A;  1N6E A;  5EMJ B;  4FA1 D;  5C9Z B;  5C92 A;  5K19 A;  4KFM B;  2CO0 C;  2Z2P A;  5M5T A;  1C9I A;  4A2M A;  1QFS A;  2VDM A;  4BUJ C;  4A08 B;  1PI6 A;  2IUV A;  3IIY A;  4BH6 A;  1RI6 A;  3A0F A;  3ORV D;  1ERJ A;  4G1E A;  1B9X A;  2CN3 A;  5HE3 B;  3FM0 A;  3MKS B;  3ZWL B;  3EU7 A;  3EQ8 A;  3GFC A;  3C99 A;  1K32 A;  3V4V A;  4IRZ A;  3AH8 B;  5EAR A;  3I7H A;  4NSX A;  4QL1 A;  1BPO A;  2HYE A;  2P9P C;  4E5Z A;  4UM8 A;  2XL3 A;  1L5G A;  5TF2 A;  4CZX A;  4FAN D;  1JJU B;  3IUJ A;  3V9F A;  4MK0 B;  5KDO B;  2AGX A;  1JMX B;  4O1Q D;  1PEV A;  3NVN A;  1A12 A;  4Z7N A;  1H2W A;  1GG2 B;  4E54 B;  1GOF A;  1UOO A;  1SQ9 A;  2AGZ A;  5HQG A;  1K3I A;  4A2L A;  5CXC B;  4CY2 A;  2YNP A;  4J86 A;  5CYK B;  3EWE A;  4OZU A;  4Z7Q A;  1TBG A;  2XDW A;  3DWL C;  2HJB A;  3GC3 B;  3OKY B;  3MUO A;  3CFV A;  1UTC A;  3U4Y A;  4CZY A;  4G55 A;  4FB1 D;  3VH0 A;  1H2Z A;  4JSP C;  4ZOZ A;  4O3T B;  3I8E A;  5TEF A;  3EMH A;  2AH0 A;  4Y5R D;  4PSW B;  4Z8L A;  2Q7Q A;  5IT9 g;  2OJY A;  3EI1 B;  3OW8 A;  4CZV A;  3DM0 A;  4J79 A;  4QT8 A;  2EID A;  1MG3 A;  2EBS A;  3PSL A;  4WK0 A;  2HKM A;  3SN6 B;  1JMZ B;  4YVD A;  5EM2 A;  3UVN A;  2EIB A;  4J8B A;  2OVR B;  3FCU A;  2WQ8 A;  5B4W A;  4FA9 D;  1VE6 A;  5FKT A;  2H6N A;  4DNV A;  2VDR A;  1T2X A;  3PVW B;  2IUQ A;  2AGL A;  1VZ3 A;  2YNN A;  5HE1 B;  4DNU A;  4PC0 A;  3K6S A;  2AGY A;  4ESG A;  3IUL A;  3RMZ D;  3W15 A;  3IJC A;  1SQJ A;  4ES0 A;  2YNO A;  5IGO A;  1E8M A;  4A09 B;  4K3I D;  5IGQ A;  4GMB A;  3K71 A;  4QRJ A;  2W18 A;  1S4U X;  1U8C A;  3ZDY A;  3EI3 B;  4X63 B;  2QR5 A;  3AL8 B;  3UVL A;  5E6U A;  4O02 A;  3SFZ A;  3V7D B;  2HES X;  3ZE0 A;  3SBQ A;  3EI2 B;  3DSM A;  5FA5 B;  4CY3 A;  3J80 g;  5IJ8 E;  3IUR A;  3VA6 A;  4IA9 A;  5AJA A;  5H1M A;  4PSX B;  3MUN A;  4GM3 A;  3FCS A;  3J81 g;  5EAL A;  4WJK A;  2AGW A;  3SHF A;  5EMM B;  4OWR A;  2OVP B;  3BG1 A;  4U1E I;  4JD2 C;  3L4M D;  4O9D A;  5M5S A;  1QNI A;  5FFO A;  2H6Q A;  3ZDX A;  2CE8 A;  3JZG A;  3MKQ A;  5IC7 A;  5THA A;  5HE0 B;  3DXM C;  4E5Z B;  2UZX B;  4XYI A;  4QQE A;  1SHY B;  4IMM A;  2H68 A;  2CN2 A;  1GXR A;  2QZP A;  4FAV D;  1JV2 A;  4CY1 A;  2HU8 A;  5EML B;  2I0R A;  4J77 A;  2AH1 A;  3I7N A;  4I79 A;  4JHP C;  5FFG A;  4J8G A;  3RFH A;  3PXS D;  4DNW A;  3NID A;  3NVQ A;  4FWW A;  1YFQ A;  4L3G D;  2HKR A;  3RN1 D;  2CNX A;  4J78 A;  1XHM A;  5FQD A;  4A0A B;  3MZK A;  2EIE A;  1H2Y A;  2IWF A;  4G1M A;  3VGZ A;  3OTT A;  3ODT A;  3EI4 B;  3OL2 B;  2P9S C;  3SVW D;  3FRX A;  3RLM D;  4L1M A;  4XEI C;  3UKU C;  4HDJ A;  4PBZ A;  3SJL D;  3IUM A;  3F3F A;  3PXT D;  5I5J A;  3KRW B;  4MMX A;  1GOT B;  4JSX C;  5GXH A;  4ZOX A;  4FHL A;  4EWR A;  4L1Q D;  4U7A A;  4H5I A;  1TYE A;  2H9N A;  5EM2 B;  3I89 A;  1U2V C;  3MVD K;  4X3E A;  3SBP A;  1OMW B;  5IJ7 E;  4G56 B;  1B9Y A;  1GP2 B;  5GMK n;  2I3S A;  4A08 A;  1K8K C;  2PM9 A;  5A2Q g;  1R5M A;  4CC9 A;  3O4I A;  3SBR A;  5HYN B;  1U4C A;  2O9K A;  3F3P A;  1TYQ C;  4NAA A;  3IJ0 A;  3I7P A;  2OVQ B;  4N14 A;  5CXB B;  1C9L A;  5E6R A;  4A0B B;  4GGC A;  4AEZ A;  4LG9 A;  1E8N A;  2YMU A;  1NR0 A;  5I5M A;  2YBA A;  3RSE C;  4JT6 C;  2J57 G;  2BKL A;  3K72 A;  3PVU B;  4JSN C;  3DXK C;  4AMY A;  3T3M A;  4CI2 A;  2JKX A;  5M5V A;  3F3G A;  3QI0 A;  4A11 B;  5C2V B;  5FLX g;  2B5N A;  4O2W A;  4NBM A;  3IUQ A;  4J82 A;  1JTD B;  2QC5 A;  2EIC A;  4E54 A;  2VDQ A;  4BP9 A;  4TZ4 A;  5CXC A;  2B4E A;  3P4F A;  4BCB A;  5CYK A;  3T3P A;  4JHN A;  5FKS A;  1VE7 A;  1YR2 A;  4J73 A;  3OKY A;  3RFG A;  4J81 A;  3I7L A;  2HJ4 A;  4J0W A;  3I8C A;  2CO0 A;  2P9U C;  5AFU 3;  4PXW A;  3K27 A;  4BP8 A;  2OIZ A; 
#chains in the Genus database with same CATH homology
 3I7O A;  2GNQ A;  1N6D A;  3OKT A;  4LGN A;  3EI1 A;  1FWX A;  5HE2 B;  3I7K A;  5EMK B;  3GRE A;  5JWZ A;  4GGD A;  2H3X A;  5I5I A;  2Z2N A;  2HXC A;  3B7F A;  4O45 A;  3C5M A;  4CI8 A;  2B5M A;  4ERY A;  4UI9 R;  3RN0 D;  4A09 A;  1L0Q A;  2J56 H;  2PBI B;  2XL2 A;  3PE7 A;  2GC7 A;  3UR4 A;  3C9C A;  4J87 A;  3JRO A;  4X61 B;  3EI3 A;  3AL8 A;  3V5W B;  3NVX A;  3EG6 A;  2P9N C;  5FXY A;  2CE9 A;  4GQB B;  3EI2 A;  2QXV A;  3SXT D;  2PM6 B;  2PM9 B;  3OKW A;  4GQ2 P;  4CI3 A;  2P9K C;  4R7A B;  3IIW A;  3N0E A;  1JOF A;  5AMS A;  2I0T A;  3JB9 L;  2B5L A;  2BBK H;  5EAM A;  5FKQ A;  4J0X A;  2H6K A;  4L3H D;  4ERQ A;  2MTA H;  4X60 B;  3JZH A;  1N6F A;  1VYH C;  2IUP A;  3FGB A;  4FA4 D;  4JT5 C;  3UVK A;  4GM9 A;  4Y7R A;  4ZOY A;  4L9O A;  1Q47 A;  3BWS A;  1OLZ A;  2H13 A;  2XU7 A;  5H17 A;  3MXX A;  2BCJ B;  2PM7 B;  3AL9 A;  3L4O D;  2G9A A;  3SMR A;  2Z2O A;  2IWK A;  4A0A A;  2G99 A;  4FA5 D;  3I2N A;  3MMY A;  3EI4 A;  3OL2 A;  4JXM A;  2H9P A;  3KRX B;  3HFQ A;  2J55 H;  1XKS A;  4O3U B;  1MG2 A;  3RRM C;  3MZL A;  5K1C C;  2P9I C;  3UVM A;  3E0C A;  3PSC B;  2I0S A;  1PBY B;  3IJ1 A;  1PGU A;  1MDA H;  3UKR C;  1A0R B;  2H14 A;  4ZOV A;  4GGA A;  4K3J B;  4GM8 A;  5SXM A;  2UZY B;  3BG0 A;  5FKR A;  2IAA A;  3SWS D;  1NEX B;  2H9L A;  2P9L C;  3JAM g;  1XIP A;  4D6V A;  4ZN4 A;  4PNK B;  5TDH B;  4GZ8 A;  3ULE C;  5C2W B;  2H9M A;  5CXB A;  5TEE A;  4A0B A;  2TRC B;  3IKO A;  2OK4 A;  5H14 A;  4GQ1 A;  3JZN A;  3UVO A;  5GXI A;  4PBY A;  2H47 A;  4D0K A;  1P22 A;  3K26 A;  3AFC A;  2GC4 A;  4A11 A;  2IUR A;  4A7J A;  3JRP A;  3N0D A;  5EAP A;  4BL0 A;  3C75 H;  2YB8 B;  3SLE D;  4ERZ A;  3CFS B;  3JPX A;  4H5J A;  3PXW D;  4AOW A;  4CY5 A;  2XYI A;  2OK6 A;  5GSA A;  3CIK B;  4J84 A;  4XYH A;  3SCY A;  2AQ5 A;  4JSV C;  4CI1 A;  2I3T A;  4LG8 A;  1N6E A;  5EMJ B;  4FA1 D;  5C9Z B;  5K19 A;  4KFM B;  2CO0 C;  2Z2P A;  4A2M A;  4BUJ C;  4A08 B;  1PI6 A;  2IUV A;  3IIY A;  4BH6 A;  1RI6 A;  3A0F A;  3ORV D;  1ERJ A;  1B9X A;  2CN3 A;  5HE3 B;  3FM0 A;  3MKS B;  3ZWL B;  3EU7 A;  3GFC A;  3C99 A;  1K32 A;  3AH8 B;  5EAR A;  3I7H A;  4NSX A;  4QL1 A;  2HYE A;  2P9P C;  4E5Z A;  2XL3 A;  5TF2 A;  4CZX A;  4FAN D;  1JJU B;  3V9F A;  4MK0 B;  5KDO B;  2AGX A;  1JMX B;  4O1Q D;  1PEV A;  3NVN A;  1GG2 B;  4E54 B;  2AGZ A;  1SQ9 A;  5HQG A;  4A2L A;  5CXC B;  4CY2 A;  2YNP A;  4J86 A;  5CYK B;  3EWE A;  4OZU A;  1TBG A;  3DWL C;  2HJB A;  3OKY B;  3CFV A;  3U4Y A;  4CZY A;  4FB1 D;  3VH0 A;  4JSP C;  4ZOZ A;  4O3T B;  3I8E A;  5TEF A;  3EMH A;  2AH0 A;  4Y5R D;  4PSW B;  4Z8L A;  2Q7Q A;  5IT9 g;  2OJY A;  3EI1 B;  3OW8 A;  4CZV A;  3DM0 A;  4J79 A;  4QT8 A;  1MG3 A;  2EBS A;  3PSL A;  2HKM A;  3SN6 B;  1JMZ B;  4YVD A;  5EM2 A;  3UVN A;  4J8B A;  2OVR B;  5B4W A;  4FA9 D;  5FKT A;  2H6N A;  3PVW B;  2IUQ A;  2AGL A;  2YNN A;  5HE1 B;  4PC0 A;  2AGY A;  4ESG A;  3RMZ D;  3W15 A;  3IJC A;  1SQJ A;  4ES0 A;  2YNO A;  5IGO A;  4A09 B;  4K3I D;  5IGQ A;  4GMB A;  4QRJ A;  2W18 A;  1S4U X;  3EI3 B;  4X63 B;  3AL8 B;  3UVL A;  3SFZ A;  3V7D B;  2HES X;  3SBQ A;  3EI2 B;  3DSM A;  5FA5 B;  4CY3 A;  3J80 g;  5IJ8 E;  3VA6 A;  4IA9 A;  5AJA A;  5H1M A;  4PSX B;  4GM3 A;  3J81 g;  5EAL A;  2AGW A;  3SHF A;  5EMM B;  4OWR A;  2OVP B;  3BG1 A;  4U1E I;  4JD2 C;  3L4M D;  4O9D A;  1QNI A;  2H6Q A;  2CE8 A;  3JZG A;  3MKQ A;  5IC7 A;  5THA A;  5HE0 B;  3DXM C;  4E5Z B;  2UZX B;  4XYI A;  4QQE A;  1SHY B;  4IMM A;  2H68 A;  2CN2 A;  1GXR A;  4FAV D;  4CY1 A;  5EML B;  2I0R A;  4J77 A;  2AH1 A;  3I7N A;  4I79 A;  3RFH A;  4J8G A;  3PXS D;  3NVQ A;  4FWW A;  1YFQ A;  4L3G D;  2HKR A;  3RN1 D;  2CNX A;  4J78 A;  1XHM A;  5FQD A;  4A0A B;  3MZK A;  2IWF A;  3VGZ A;  3OTT A;  3ODT A;  3EI4 B;  3OL2 B;  2P9S C;  3SVW D;  3FRX A;  3RLM D;  4XEI C;  3UKU C;  4HDJ A;  4PBZ A;  3SJL D;  3F3F A;  3PXT D;  5I5J A;  3KRW B;  1GOT B;  4JSX C;  5GXH A;  4ZOX A;  4FHL A;  4EWR A;  4L1Q D;  4U7A A;  4H5I A;  2H9N A;  5EM2 B;  3I89 A;  1U2V C;  4X3E A;  3SBP A;  1OMW B;  5IJ7 E;  4G56 B;  1B9Y A;  1GP2 B;  5GMK n;  2I3S A;  4A08 A;  1K8K C;  2PM9 A;  5A2Q g;  1R5M A;  4CC9 A;  3SBR A;  5HYN B;  1U4C A;  2O9K A;  3F3P A;  1TYQ C;  3IJ0 A;  3I7P A;  2OVQ B;  4N14 A;  5CXB B;  4A0B B;  4GGC A;  4AEZ A;  4LG9 A;  2YMU A;  5I5M A;  1NR0 A;  2YBA A;  3RSE C;  4JT6 C;  2J57 G;  3PVU B;  4JSN C;  3DXK C;  4CI2 A;  3F3G A;  5C2V B;  4A11 B;  5FLX g;  2B5N A;  4J82 A;  2QC5 A;  4E54 A;  4TZ4 A;  5CXC A;  2B4E A;  3P4F A;  5CYK A;  5FKS A;  4J73 A;  3RFG A;  3OKY A;  4J81 A;  3I7L A;  2HJ4 A;  4J0W A;  3I8C A;  2CO0 A;  2P9U C;  5AFU 3;  4PXW A;  3K27 A;  2OIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...