3BG0A

Architecture of a coat for the nuclear pore membrane
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
291
structure length
283
Chain Sequence
DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, hydrolase
molecule keywords Protein SEC13 homolog
total genus 52
structure length 283
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg0A00
4GGDA 2CNXA 2H6KA 2YNOA 3I8EA 5I5IA 1NEXB 3SFZA 5CYKB 1MDAH 4IMMA 4A2MA 2I3TA 4A09A 5FKRA 5AMSA 2P9SC 2AH1A 5IT9g 3JB9L 2CE9A 2MTAH 3IKOA 3I7PA 4QT8A 4A0AA 4ERZA 3SHFA 3I7NA 4PSXB 4X61B 2PM9A 3ORVD 3AL9A 1N6EA 2HJBA 1XKSA 2UZXB 3VA6A 3IIWA 4GQ2P 3FRXA 4GZ8A 3AH8B 2H13A 4U1EI 2OVRB 5CXCA 1PBYB 1XHMA 4GMBA 5HE1B 4L3HD 5C2WB 3MKSB 2AGXA 2PM9B 3MXXA 3ODTA 3NVXA 3EG6A 3EI2B 3EI3A 5A2Qg 2B5NA 4PNKB 1A0RB 4U7AA 2XU7A 3SXTD 4I79A 1PEVA 5FKSA 4H5JA 1GOTB 5GXHA 4CI3A 4A2LA 4ES0A 3K26A 3P4FA 4Z8LA 2YMUA 4J78A 3RLMD 3BG0A 5I5JA 4CY2A 3FM0A 4HDJA 2AQ5A 4A0BB 3IJ0A 2I0SA 5JWZA 5IJ8E 4GQBB 4QL1A 1U2VC 4L3GD 4JSVC 3SLED 4FA9D 2AGZA 4E54A 5KDOB 3EI4B 4FA5D 3JZNA 5HQGA 2G99A 4CI1A 4Y7RA 3MKQA 3N0EA 2AGWA 4JT5C 1B9XA 1N6FA 3VGZA 4GM8A 4J84A 4AEZA 5HE2B 2P9NC 4CZYA 1ERJA 2HKRA 4CI2A 3OKTA 4XYIA 3GREA 2AGYA 3K27A 1K8KC 2PBIB 5I5MA 2I3SA 4GQ1A 3IJCA 4JD2C 4CI8A 2W18A 4O1QD 2IURA 4X63B 4J87A 5FKQA 2CN2A 2H9PA 4J0XA 5FKTA 2H3XA 5TF2A 1P22A 5B4WA 3SVWD 3DXMC 4GGCA 3C9CA 3OTTA 2OVPB 3JRPA 2G9AA 4A08B 4PC0A 5IGOA 4CZXA 2IWKA 4OWRA 5K19A 2XL3A 2OK4A 3PVWB 5AFU3 4J73A 4FA4D 3JPXA 5EMMB 4J0WA 3C75H 4KFMB 5CYKA 4BH6A 2B5LA 2Z2NA 4O3TB 5IJ7E 2IAAA 3KRWB 1Q47A 3RSEC 4A0BA 3NVQA 3AFCA 3RRMC 3PSCB 4E5ZA 2IWFA 2I0RA 3UVOA 1U4CA 4PBZA 3I89A 3SBQA 3I2NA 4PBYA 2GNQA 3EWEA 2EBSA 1NR0A 1VYHC 5H14A 3I7LA 5CXBB 5C2VB 3V9FA 2CE8A 5IC7A 4ZOYA 3C5MA 4J79A 2HYEA 2P9IC 4CY1A 3EU7A 5CXBA 4IA9A 3V7DB 3F3PA 1S4UX 2OVQB 3OKYA 3UR4A 2GC7A 3OW8A 3KRXB 2H9NA 2HXCA 2OIZA 5FQDA 3F3GA 4J77A 5GMKn 5H1MA 2H47A 3RN0D 5EMLB 3UVNA 4LG9A 1L0QA 3UVKA 3OL2A 4MK0B 3I7OA 3EMHA 1B9YA 4X3EA 4LG8A 3C99A 4H5IA 2B5MA 3EI3B 1JOFA 5HE3B 4O45A 2GC4A 4GM3A 4O3UB 1SHYB 3I8CA 1SQ9A 5THAA 3RMZD 3OKYB 1PGUA 5GSAA 3JZGA 2CO0C 2HKMA 3J80g 4E5ZB 1YFQA 2H68A 3CFVA 2H14A 5H17A 4PSWB 1GXRA 4EWRA 4JXMA 4BL0A 1XIPA 2OK6A 5EMJB 5HYNB 2QXVA 4BUJC 5AJAA 4K3ID 2YBAA 1MG3A 4ERQA 4XYHA 4OZUA 4R7AB 4FHLA 5GXIA 2BBKH 3UVLA 3UKUC 3IIYA 1SQJA 3HFQA 4GGAA 4PXWA 3FGBA 2YNPA 3PVUB 2AH0A 4K3JB 4X60B 3OKWA 4L1QD 4D6VA 3CIKB 5TDHB 4ZOXA 3MMYA 5EMKB 2CO0A 2IUPA 3E0CA 2P9KC 5FLXg 2HJ4A 3I7KA 4FA1D 3CFSB 2BCJB 4ZOZA 4A0AB 3ULEC 3PE7A 2P9LC 3OL2B 3PXWD 3DXKC 4N14A 2I0TA 2Q7QA 3JAMg 3EI1B 5HE0B 3W15A 4TZ4A 2P9UC 3I7HA 3SWSD 1RI6A 5TEFA 5C9ZB 3L4OD 5CXCB 2QC5A 3EI1A 1GG2B 4D0KA 5EALA 3DSMA 4J8GA 4ESGA 1TBGA 4J82A 3SBRA 4A11B 2XYIA 5SXMA 2PM7B 3SCYA 3SMRA 4LGNA 3JZHA 2HESX 4ERYA 2J55H 3DM0A 4JSNC 4XEIC 1PI6A 3MZLA 5IGQA 3B7FA 2J57G 5EAMA 1OMWB 4A11A 5EAPA 3IJ1A 4A7JA 2H9LA 3EI2A 4J8BA 4QRJA 4FAND 3A0FA 3J81g 4J86A 3BG1A 4ZN4A 3VH0A 2TRCB 4GM9A 4QQEA 4E54B 2PM6B 4ZOVA 2B4EA 1TYQC 1QNIA 3L4MD 4FAVD 2OJYA 4JT6C 3JROA 2H6NA 4CZVA 4O9DA 3SJLD 3AL8A 2XL2A 4CC9A 2AGLA 3EI4A 3RFGA 5TEEA 3SN6B 5K1CC 3RN1D 3UVMA 3PSLA 2Z2PA 5EM2B 3V5WB 3AL8B 3F3FA 3NVNA 2H9MA 4J81A 3BWSA 4CY3A 2H6QA 4A09B 3MZKA 1OLZA 1R5MA 4AOWA 2P9PC 2YNNA 1GP2B 1JJUB 3SBPA 2IUQA 5EM2A 3RFHA 3PXTD 3ZWLB 4YVDA 3GFCA 4JSPC 4FB1D 1FWXA 5FA5B 2O9KA 3PXSD 4NSXA 1JMZB 2Z2OA 4A08A 1K32A 4CY5A 4G56B 2CN3A 1N6DA 5FXYA 2J56H 3U4YA 1MG2A 2YB8B 4JSXC 2UZYB 2IUVA 3DWLC 4UI9R 3N0DA 5EARA 1JMXB 4FWWA 3UKRC 4Y5RD 4L9OA
chains in the Genus database with same CATH superfamily
4GGDA 5E6UA 3DDUA 2CNXA 2H6KA 4RE5A 2YNOA 3I8EA 5I5IA 1NEXB 3SFZA 5CYKB 1MDAH 1UTCA 4IMMA 4A2MA 2I3TA 4A09A 3ZE1A 4O02A 5FKRA 5AMSA 2P9SC 2AH1A 5IT9g 3JB9L 2CE9A 2MTAH 3IKOA 4DNVA 3I7PA 4QT8A 4A0AA 3EQ8A 4ERZA 1GOGA 4G55A 3SHFA 3I7NA 4PSXB 4X61B 2PM9A 3ORVD 3NIGA 4MMZA 3AL9A 5FFOA 4O2WA 1N6EA 2HJBA 1XKSA 2UZXB 3VA6A 3IIWA 2HU5A 2VDPA 4GQ2P 3T3PA 3NIFA 3FRXA 2VZ3A 4GZ8A 3AH8B 2H13A 4U1EI 2OVRB 5CXCA 1PBYB 1XHMA 3QHYB 4WJKA 4AN0A 4GMBA 5M5SA 5HE1B 4L3HD 1JV2A 3MKSB 5C2WB 1YR2A 2AGXA 2PM9B 3MXXA 3ODTA 3NVXA 3EG6A 3FCSA 3EI2B 3EI3A 5A2Qg 2B5NA 1GOHA 4UM9A 4PNKB 1A0RB 4U7AA 2XU7A 3SXTD 3IURA 4I79A 5E6SA 1PEVA 4NC4A 5FKSA 4H5JA 3ZE0A 1GOTB 5GXHA 4CI3A 4A2LA 4ES0A 3K26A 3P4FA 4Z8LA 2YMUA 1T2XA 4J78A 4Z7QA 5M5TA 1E8NA 3RLMD 3BG0A 5I5JA 2BKLA 4CY2A 3FM0A 4HDJA 2AQ5A 2EICA 4A0BB 3IJ0A 2I0SA 5JWZA 5IJ8E 4GQBB 4QL1A 3ZDYA 1U2VC 4L3GD 1O6FA 4JSVC 3SLED 4FA9D 2AGZA 2EIEA 4E54A 4IRZA 5KDOB 3EI4B 3FCUA 4FA5D 3JZNA 5HQGA 2G99A 4CI1A 4WK0A 1H2ZA 2VDKA 4Y7RA 3MKQA 3N0EA 2AGWA 4JT5C 1B9XA 1N6FA 3V4VA 4GM8A 3VGZA 4J84A 3ZE2A 4BCDA 4AEZA 3VI3A 5HE2B 3QI0A 2P9NC 4G1EA 4CZYA 1ERJA 2HKRA 4CI2A 3OKTA 4XYIA 2EIBA 3GREA 1UOOA 2VDQA 2AGYA 3K27A 3K72A 1K8KC 2PBIB 1GOFA 5I5MA 2I3SA 4GQ1A 3IJCA 4JD2C 2VZ1A 3EQ7A 4CI8A 2W18A 4O1QD 2IURA 4X63B 4J87A 5FKQA 2CN2A 2H9PA 4J0XA 5FKTA 2H3XA 5TF2A 1P22A 1BPOA 5B4WA 1JTDB 3SVWD 3DXMC 4GGCA 3C9CA 5HDBA 3OTTA 3K6SA 2OVPB 3K71A 3JRPA 2G9AA 4A08B 4DNWA 4PC0A 5IGOA 4CZXA 2IWKA 4OWRA 5K19A 2XL3A 2OK4A 3PVWB 5AFU3 4J73A 3NIDA 1VZ2A 4FA4D 4UM8A 4MMYA 3JPXA 5EMMB 4J0WA 3C75H 2HU7A 4KFMB 5CYKA 4BH6A 2B5LA 1UOPA 2Z2NA 4O3TB 1H2XA 5IJ7E 2IAAA 3KRWB 3T3MA 2VDLA 1Q47A 4AX4A 2VDNA 3RSEC 3ZDZA 4A0BA 3NVQA 3AFCA 3RRMC 3PSCB 4JHPC 4E5ZA 2VDMA 2IWFA 2I0RA 4Z7OA 3OF7A 3UVOA 1U4CA 4PBZA 3I89A 1VE7A 3SBQA 4BP8A 4NBMA 3O4IA 3I2NA 2EIDA 4PBYA 2GNQA 4RE6A 3EWEA 2EBSA 3O4HA 1NR0A 3GC3B 1VYHC 5H14A 3I7LA 5CXBB 5C2VB 3V9FA 2CE8A 5IC7A 5C86A 4ZOYA 3C5MA 4MMXA 3VI4A 4J79A 2HYEA 2P9IC 4CY1A 3EU7A 5CXBA 4L1MA 4IA9A 4WK2A 3V7DB 3F3PA 1S4UX 2OVQB 3IUQA 3OKYA 3UR4A 2GC7A 3OW8A 1QFMA 4BCCA 3IUNA 3KRXB 2H9NA 2HXCA 2OIZA 4D9SA 5FQDA 3F3GA 4J77A 3O4JA 1O6GA 5GMKn 5H1MA 1VZ3A 2H47A 3RN0D 5EMLB 3UVNA 4LG9A 1L0QA 3UVKA 3OL2A 4MK0B 3I7OA 3EMHA 1B9YA 4X3EA 3IVMA 4LG8A 3C99A 4H5IA 2B5MA 2JKXA 2HU8A 3EI3B 4Z7NA 1JOFA 5HE3B 1I2MB 4O45A 1VE6A 4QAMA 2GC4A 4GM3A 1L5GA 4O3UB 1SHYB 3I8CA 1SQ9A 5THAA 3MUNA 3RMZD 3OKYB 1PGUA 5GSAA 3JZGA 2CO0C 2HKMA 2VDRA 3J80g 4E5ZB 1YFQA 2H68A 3MUOA 3CFVA 3O4GA 2H14A 5H17A 4PSWB 1GXRA 4EWRA 4JXMA 4JHNA 4BL0A 1XIPA 2OK6A 5EMJB 3V4PA 5HYNB 2QXVA 4BUJC 5AJAA 4K3ID 2YBAA 1MG3A 3IJEA 4ERQA 4XYHA 4OZUA 2QZPA 4R7AB 1C9IA 4FHLA 4BCBA 2BBKH 5GXIA 3UVLA 3UKUC 3IIYA 1SQJA 4G1MA 3HFQA 4NAAA 4GGAA 4PXWA 3FGBA 2YNPA 3PVUB 2AH0A 4K3JB 4X60B 3OKWA 4L1QD 4D6VA 3CIKB 5TDHB 4ZOXA 3MMYA 5EMKB 2CO0A 2IUPA 3E0CA 2P9KC 5FLXg 3IULA 2HJ4A 3I7KA 4AN1A 4FA1D 3CFSB 2BCJB 4ZOZA 4A0AB 3ULEC 3PE7A 2P9LC 3OL2B 3PXWD 3DXKC 4N14A 2I0TA 2Q7QA 3JAMg 3EI1B 5HE0B 2XE4A 4BP9A 5FFGA 3W15A 4TZ4A 2P9UC 3I7HA 3SWSD 3IUJA 1RI6A 5TEFA 5M5UA 5C9ZB 3L4OD 5CXCB 2QC5A 3EI1A 1GG2B 4D0KA 5EALA 1A12A 3DSMA 4J8GA 4ESGA 1TBGA 4J82A 3SBRA 4A11B 2XYIA 5SXMA 2PM7B 3SCYA 5M61A 3EQ9A 5E6RA 3SMRA 4LGNA 4WK4A 3JZHA 2HESX 4ERYA 1QFSA 1C9LA 2J55H 3DM0A 4JSNC 4XEIC 1PI6A 3MZLA 1UOQA 5IGQA 3B7FA 2J57G 5EAMA 1H2WA 1OMWB 4A11A 5EAPA 3IJ1A 4A7JA 2H9LA 3EI2A 4J8BA 4QRJA 4FAND 3A0FA 3J81g 2XDWA 4J86A 3BG1A 4ZN4A 3VH0A 2TRCB 4GM9A 4QQEA 4E54B 2PM6B 4ZOVA 2B4EA 1TYQC 1QNIA 3L4MD 4DNUA 4FAVD 2OJYA 4JT6C 3JROA 4AMZA 2H6NA 4CZVA 4NENA 4O9DA 3SJLD 3AL8A 2XL2A 4CC9A 2AGLA 3EI4A 3RFGA 5TEEA 3SN6B 5K1CC 3RN1D 1H2YA 3UVMA 3ZDXA 3PSLA 2Z2PA 4AMYA 5EM2B 3V5WB 3AL8B 1E5TA 3F3FA 3NVNA 3GD1I 2H9MA 4J81A 3BWSA 4CY3A 3MVDK 2H6QA 4A09B 3MZKA 1OLZA 1R5MA 4AOWA 5M5RA 2P9PC 2YNNA 1JJUB 1GP2B 3KCIA 2IUQA 5EM2A 3SBPA 3RFHA 3PXTD 3IUMA 3ZWLB 4YVDA 2QR5A 2WQ8A 3GFCA 4JSPC 4FB1D 1FWXA 5FA5B 2O9KA 3PXSD 4NSXA 1JMZB 2VC2A 2XZGA 2Z2OA 1U8CA 4A08A 2VDOA 1K32A 1K3IA 4CY5A 4G56B 2CN3A 1N6DA 5FXYA 2J56H 3U4YA 1MG2A 2YB8B 4JSXC 2UZYB 2IUVA 3DWLC 4UI9R 3N0DA 5M5VA 5EARA 1M1XA 1JMXB 4FWWA 1TYEA 3UKRC 1E8MA 4Y5RD 5C92A 4L9OA
chains in the Genus database with same CATH topology
4GGDA 2CNXA 2H6KA 2YNOA 3I8EA 5I5IA 1NEXB 3SFZA 5CYKB 1MDAH 4IMMA 4A2MA 2I3TA 4A09A 5FKRA 5AMSA 2P9SC 2AH1A 5IT9g 3JB9L 2CE9A 2MTAH 3IKOA 3I7PA 4QT8A 4A0AA 4ERZA 3SHFA 3I7NA 4PSXB 4X61B 2PM9A 3ORVD 3AL9A 1N6EA 2HJBA 1XKSA 2UZXB 3VA6A 3IIWA 4GQ2P 3FRXA 4GZ8A 3AH8B 2H13A 4U1EI 2OVRB 5CXCA 1PBYB 1XHMA 4GMBA 5HE1B 4L3HD 5C2WB 3MKSB 2AGXA 2PM9B 3MXXA 3ODTA 3NVXA 3EG6A 3EI2B 3EI3A 5A2Qg 2B5NA 4PNKB 1A0RB 4U7AA 2XU7A 3SXTD 4I79A 1PEVA 5FKSA 4H5JA 1GOTB 5GXHA 4CI3A 4A2LA 4ES0A 3K26A 3P4FA 4Z8LA 2YMUA 4J78A 3RLMD 3BG0A 5I5JA 4CY2A 3FM0A 4HDJA 2AQ5A 4A0BB 3IJ0A 2I0SA 5JWZA 5IJ8E 4GQBB 4QL1A 1U2VC 4L3GD 4JSVC 3SLED 4FA9D 2AGZA 4E54A 5KDOB 3EI4B 4FA5D 3JZNA 5HQGA 2G99A 4CI1A 4Y7RA 3MKQA 3N0EA 2AGWA 4JT5C 1B9XA 1N6FA 3VGZA 4GM8A 4J84A 4AEZA 5HE2B 2P9NC 4CZYA 1ERJA 2HKRA 4CI2A 3OKTA 4XYIA 3GREA 2AGYA 3K27A 1K8KC 2PBIB 5I5MA 2I3SA 4GQ1A 3IJCA 4JD2C 4CI8A 2W18A 4O1QD 2IURA 4X63B 4J87A 5FKQA 2CN2A 2H9PA 4J0XA 5FKTA 2H3XA 5TF2A 1P22A 5B4WA 3SVWD 3DXMC 4GGCA 3C9CA 3OTTA 2OVPB 3JRPA 2G9AA 4A08B 4PC0A 5IGOA 4CZXA 2IWKA 4OWRA 5K19A 2XL3A 2OK4A 3PVWB 5AFU3 4J73A 4FA4D 3JPXA 5EMMB 4J0WA 3C75H 4KFMB 5CYKA 4BH6A 2B5LA 2Z2NA 4O3TB 5IJ7E 2IAAA 3KRWB 1Q47A 3RSEC 4A0BA 3NVQA 3AFCA 3RRMC 3PSCB 4E5ZA 2IWFA 2I0RA 3UVOA 1U4CA 4PBZA 3I89A 3SBQA 3I2NA 4PBYA 2GNQA 3EWEA 2EBSA 1NR0A 1VYHC 5H14A 3I7LA 5CXBB 5C2VB 3V9FA 2CE8A 5IC7A 4ZOYA 3C5MA 4J79A 2HYEA 2P9IC 4CY1A 3EU7A 5CXBA 4IA9A 3V7DB 3F3PA 1S4UX 2OVQB 3OKYA 3UR4A 2GC7A 3OW8A 3KRXB 2H9NA 2HXCA 2OIZA 5FQDA 3F3GA 4J77A 5GMKn 5H1MA 2H47A 3RN0D 5EMLB 3UVNA 4LG9A 1L0QA 3UVKA 3OL2A 4MK0B 3I7OA 3EMHA 1B9YA 4X3EA 4LG8A 3C99A 4H5IA 2B5MA 3EI3B 1JOFA 5HE3B 4O45A 2GC4A 4GM3A 4O3UB 1SHYB 3I8CA 1SQ9A 5THAA 3RMZD 3OKYB 1PGUA 5GSAA 3JZGA 2CO0C 2HKMA 3J80g 4E5ZB 1YFQA 2H68A 3CFVA 2H14A 5H17A 4PSWB 1GXRA 4EWRA 4JXMA 4BL0A 1XIPA 2OK6A 5EMJB 5HYNB 2QXVA 4BUJC 5AJAA 4K3ID 2YBAA 1MG3A 4ERQA 4XYHA 4OZUA 4R7AB 4FHLA 5GXIA 2BBKH 3UVLA 3UKUC 3IIYA 1SQJA 3HFQA 4GGAA 4PXWA 3FGBA 2YNPA 3PVUB 2AH0A 4K3JB 4X60B 3OKWA 4L1QD 4D6VA 3CIKB 5TDHB 4ZOXA 3MMYA 5EMKB 2CO0A 2IUPA 3E0CA 2P9KC 5FLXg 2HJ4A 3I7KA 4FA1D 3CFSB 2BCJB 4ZOZA 4A0AB 3ULEC 3PE7A 2P9LC 3OL2B 3PXWD 3DXKC 4N14A 2I0TA 2Q7QA 3JAMg 3EI1B 5HE0B 3W15A 4TZ4A 2P9UC 3I7HA 3SWSD 1RI6A 5TEFA 5C9ZB 3L4OD 5CXCB 2QC5A 3EI1A 1GG2B 4D0KA 5EALA 3DSMA 4J8GA 4ESGA 1TBGA 4J82A 3SBRA 4A11B 2XYIA 5SXMA 2PM7B 3SCYA 3SMRA 4LGNA 3JZHA 2HESX 4ERYA 2J55H 3DM0A 4JSNC 4XEIC 1PI6A 3MZLA 5IGQA 3B7FA 2J57G 5EAMA 1OMWB 4A11A 5EAPA 3IJ1A 4A7JA 2H9LA 3EI2A 4J8BA 4QRJA 4FAND 3A0FA 3J81g 4J86A 3BG1A 4ZN4A 3VH0A 2TRCB 4GM9A 4QQEA 4E54B 2PM6B 4ZOVA 2B4EA 1TYQC 1QNIA 3L4MD 4FAVD 2OJYA 4JT6C 3JROA 2H6NA 4CZVA 4O9DA 3SJLD 3AL8A 2XL2A 4CC9A 2AGLA 3EI4A 3RFGA 5TEEA 3SN6B 5K1CC 3RN1D 3UVMA 3PSLA 2Z2PA 5EM2B 3V5WB 3AL8B 3F3FA 3NVNA 2H9MA 4J81A 3BWSA 4CY3A 2H6QA 4A09B 3MZKA 1OLZA 1R5MA 4AOWA 2P9PC 2YNNA 1GP2B 1JJUB 3SBPA 2IUQA 5EM2A 3RFHA 3PXTD 3ZWLB 4YVDA 3GFCA 4JSPC 4FB1D 1FWXA 5FA5B 2O9KA 3PXSD 4NSXA 1JMZB 2Z2OA 4A08A 1K32A 4CY5A 4G56B 2CN3A 1N6DA 5FXYA 2J56H 3U4YA 1MG2A 2YB8B 4JSXC 2UZYB 2IUVA 3DWLC 4UI9R 3N0DA 5EARA 1JMXB 4FWWA 3UKRC 4Y5RD 4L9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGD A;  2CNX A;  2H6K A;  2YNO A;  3I8E A;  5I5I A;  1NEX B;  3SFZ A;  5CYK B;  1MDA H;  4IMM A;  4A2M A;  2I3T A;  4A09 A;  5FKR A;  5AMS A;  2P9S C;  2AH1 A;  5IT9 g;  3JB9 L;  2CE9 A;  2MTA H;  3IKO A;  3I7P A;  4QT8 A;  4A0A A;  4ERZ A;  3SHF A;  3I7N A;  4PSX B;  4X61 B;  2PM9 A;  3ORV D;  3AL9 A;  1N6E A;  2HJB A;  1XKS A;  2UZX B;  3VA6 A;  3IIW A;  4GQ2 P;  3FRX A;  4GZ8 A;  3AH8 B;  2H13 A;  4U1E I;  2OVR B;  5CXC A;  1PBY B;  1XHM A;  4GMB A;  5HE1 B;  4L3H D;  5C2W B;  3MKS B;  2AGX A;  2PM9 B;  3MXX A;  3ODT A;  3NVX A;  3EG6 A;  3EI2 B;  3EI3 A;  5A2Q g;  2B5N A;  4PNK B;  1A0R B;  4U7A A;  2XU7 A;  3SXT D;  4I79 A;  1PEV A;  5FKS A;  4H5J A;  1GOT B;  5GXH A;  4CI3 A;  4A2L A;  4ES0 A;  3K26 A;  3P4F A;  4Z8L A;  2YMU A;  4J78 A;  3RLM D;  3BG0 A;  5I5J A;  4CY2 A;  3FM0 A;  4HDJ A;  2AQ5 A;  4A0B B;  3IJ0 A;  2I0S A;  5JWZ A;  5IJ8 E;  4GQB B;  4QL1 A;  1U2V C;  4L3G D;  4JSV C;  3SLE D;  4FA9 D;  2AGZ A;  4E54 A;  5KDO B;  3EI4 B;  4FA5 D;  3JZN A;  5HQG A;  2G99 A;  4CI1 A;  4Y7R A;  3MKQ A;  3N0E A;  2AGW A;  4JT5 C;  1B9X A;  1N6F A;  3VGZ A;  4GM8 A;  4J84 A;  4AEZ A;  5HE2 B;  2P9N C;  4CZY A;  1ERJ A;  2HKR A;  4CI2 A;  3OKT A;  4XYI A;  3GRE A;  2AGY A;  3K27 A;  1K8K C;  2PBI B;  5I5M A;  2I3S A;  4GQ1 A;  3IJC A;  4JD2 C;  4CI8 A;  2W18 A;  4O1Q D;  2IUR A;  4X63 B;  4J87 A;  5FKQ A;  2CN2 A;  2H9P A;  4J0X A;  5FKT A;  2H3X A;  5TF2 A;  1P22 A;  5B4W A;  3SVW D;  3DXM C;  4GGC A;  3C9C A;  3OTT A;  2OVP B;  3JRP A;  2G9A A;  4A08 B;  4PC0 A;  5IGO A;  4CZX A;  2IWK A;  4OWR A;  5K19 A;  2XL3 A;  2OK4 A;  3PVW B;  5AFU 3;  4J73 A;  4FA4 D;  3JPX A;  5EMM B;  4J0W A;  3C75 H;  4KFM B;  5CYK A;  4BH6 A;  2B5L A;  2Z2N A;  4O3T B;  5IJ7 E;  2IAA A;  3KRW B;  1Q47 A;  3RSE C;  4A0B A;  3NVQ A;  3AFC A;  3RRM C;  3PSC B;  4E5Z A;  2IWF A;  2I0R A;  3UVO A;  1U4C A;  4PBZ A;  3I89 A;  3SBQ A;  3I2N A;  4PBY A;  2GNQ A;  3EWE A;  2EBS A;  1NR0 A;  1VYH C;  5H14 A;  3I7L A;  5CXB B;  5C2V B;  3V9F A;  2CE8 A;  5IC7 A;  4ZOY A;  3C5M A;  4J79 A;  2HYE A;  2P9I C;  4CY1 A;  3EU7 A;  5CXB A;  4IA9 A;  3V7D B;  3F3P A;  1S4U X;  2OVQ B;  3OKY A;  3UR4 A;  2GC7 A;  3OW8 A;  3KRX B;  2H9N A;  2HXC A;  2OIZ A;  5FQD A;  3F3G A;  4J77 A;  5GMK n;  5H1M A;  2H47 A;  3RN0 D;  5EML B;  3UVN A;  4LG9 A;  1L0Q A;  3UVK A;  3OL2 A;  4MK0 B;  3I7O A;  3EMH A;  1B9Y A;  4X3E A;  4LG8 A;  3C99 A;  4H5I A;  2B5M A;  3EI3 B;  1JOF A;  5HE3 B;  4O45 A;  2GC4 A;  4GM3 A;  4O3U B;  1SHY B;  3I8C A;  1SQ9 A;  5THA A;  3RMZ D;  3OKY B;  1PGU A;  5GSA A;  3JZG A;  2CO0 C;  2HKM A;  3J80 g;  4E5Z B;  1YFQ A;  2H68 A;  3CFV A;  2H14 A;  5H17 A;  4PSW B;  1GXR A;  4EWR A;  4JXM A;  4BL0 A;  1XIP A;  2OK6 A;  5EMJ B;  5HYN B;  2QXV A;  4BUJ C;  5AJA A;  4K3I D;  2YBA A;  1MG3 A;  4ERQ A;  4XYH A;  4OZU A;  4R7A B;  4FHL A;  5GXI A;  2BBK H;  3UVL A;  3UKU C;  3IIY A;  1SQJ A;  3HFQ A;  4GGA A;  4PXW A;  3FGB A;  2YNP A;  3PVU B;  2AH0 A;  4K3J B;  4X60 B;  3OKW A;  4L1Q D;  4D6V A;  3CIK B;  5TDH B;  4ZOX A;  3MMY A;  5EMK B;  2CO0 A;  2IUP A;  3E0C A;  2P9K C;  5FLX g;  2HJ4 A;  3I7K A;  4FA1 D;  3CFS B;  2BCJ B;  4ZOZ A;  4A0A B;  3ULE C;  3PE7 A;  2P9L C;  3OL2 B;  3PXW D;  3DXK C;  4N14 A;  2I0T A;  2Q7Q A;  3JAM g;  3EI1 B;  5HE0 B;  3W15 A;  4TZ4 A;  2P9U C;  3I7H A;  3SWS D;  1RI6 A;  5TEF A;  5C9Z B;  3L4O D;  5CXC B;  2QC5 A;  3EI1 A;  1GG2 B;  4D0K A;  5EAL A;  3DSM A;  4J8G A;  4ESG A;  1TBG A;  4J82 A;  3SBR A;  4A11 B;  2XYI A;  5SXM A;  2PM7 B;  3SCY A;  3SMR A;  4LGN A;  3JZH A;  2HES X;  4ERY A;  2J55 H;  3DM0 A;  4JSN C;  4XEI C;  1PI6 A;  3MZL A;  5IGQ A;  3B7F A;  2J57 G;  5EAM A;  1OMW B;  4A11 A;  5EAP A;  3IJ1 A;  4A7J A;  2H9L A;  3EI2 A;  4J8B A;  4QRJ A;  4FAN D;  3A0F A;  3J81 g;  4J86 A;  3BG1 A;  4ZN4 A;  3VH0 A;  2TRC B;  4GM9 A;  4QQE A;  4E54 B;  2PM6 B;  4ZOV A;  2B4E A;  1TYQ C;  1QNI A;  3L4M D;  4FAV D;  2OJY A;  4JT6 C;  3JRO A;  2H6N A;  4CZV A;  4O9D A;  3SJL D;  3AL8 A;  2XL2 A;  4CC9 A;  2AGL A;  3EI4 A;  3RFG A;  5TEE A;  3SN6 B;  5K1C C;  3RN1 D;  3UVM A;  3PSL A;  2Z2P A;  5EM2 B;  3V5W B;  3AL8 B;  3F3F A;  3NVN A;  2H9M A;  4J81 A;  3BWS A;  4CY3 A;  2H6Q A;  4A09 B;  3MZK A;  1OLZ A;  1R5M A;  4AOW A;  2P9P C;  2YNN A;  1GP2 B;  1JJU B;  3SBP A;  2IUQ A;  5EM2 A;  3RFH A;  3PXT D;  3ZWL B;  4YVD A;  3GFC A;  4JSP C;  4FB1 D;  1FWX A;  5FA5 B;  2O9K A;  3PXS D;  4NSX A;  1JMZ B;  2Z2O A;  4A08 A;  1K32 A;  4CY5 A;  4G56 B;  2CN3 A;  1N6D A;  5FXY A;  2J56 H;  3U4Y A;  1MG2 A;  2YB8 B;  4JSX C;  2UZY B;  2IUV A;  3DWL C;  4UI9 R;  3N0D A;  5EAR A;  1JMX B;  4FWW A;  3UKR C;  4Y5R D;  4L9O A; 
#chains in the Genus database with same CATH topology
 4GGD A;  5E6U A;  3DDU A;  2CNX A;  2H6K A;  4RE5 A;  2YNO A;  3I8E A;  5I5I A;  1NEX B;  3SFZ A;  5CYK B;  1MDA H;  1UTC A;  4IMM A;  4A2M A;  2I3T A;  4A09 A;  3ZE1 A;  4O02 A;  5FKR A;  5AMS A;  2P9S C;  2AH1 A;  5IT9 g;  3JB9 L;  2CE9 A;  2MTA H;  3IKO A;  4DNV A;  3I7P A;  4QT8 A;  4A0A A;  3EQ8 A;  4ERZ A;  1GOG A;  4G55 A;  3SHF A;  3I7N A;  4PSX B;  4X61 B;  2PM9 A;  3ORV D;  3NIG A;  4MMZ A;  3AL9 A;  5FFO A;  4O2W A;  1N6E A;  2HJB A;  1XKS A;  2UZX B;  3VA6 A;  3IIW A;  2HU5 A;  2VDP A;  4GQ2 P;  3T3P A;  3NIF A;  3FRX A;  2VZ3 A;  4GZ8 A;  3AH8 B;  2H13 A;  4U1E I;  2OVR B;  5CXC A;  1PBY B;  1XHM A;  3QHY B;  4WJK A;  4AN0 A;  4GMB A;  5M5S A;  5HE1 B;  4L3H D;  1JV2 A;  3MKS B;  5C2W B;  1YR2 A;  2AGX A;  2PM9 B;  3MXX A;  3ODT A;  3NVX A;  3EG6 A;  3FCS A;  3EI2 B;  3EI3 A;  5A2Q g;  2B5N A;  1GOH A;  4UM9 A;  4PNK B;  1A0R B;  4U7A A;  2XU7 A;  3SXT D;  3IUR A;  4I79 A;  5E6S A;  1PEV A;  4NC4 A;  5FKS A;  4H5J A;  3ZE0 A;  1GOT B;  5GXH A;  4CI3 A;  4A2L A;  4ES0 A;  3K26 A;  3P4F A;  4Z8L A;  2YMU A;  1T2X A;  4J78 A;  4Z7Q A;  5M5T A;  1E8N A;  3RLM D;  3BG0 A;  5I5J A;  2BKL A;  4CY2 A;  3FM0 A;  4HDJ A;  2AQ5 A;  2EIC A;  4A0B B;  3IJ0 A;  2I0S A;  5JWZ A;  5IJ8 E;  4GQB B;  4QL1 A;  3ZDY A;  1U2V C;  4L3G D;  1O6F A;  4JSV C;  3SLE D;  4FA9 D;  2AGZ A;  2EIE A;  4E54 A;  4IRZ A;  5KDO B;  3EI4 B;  3FCU A;  4FA5 D;  3JZN A;  5HQG A;  2G99 A;  4CI1 A;  4WK0 A;  1H2Z A;  2VDK A;  4Y7R A;  3MKQ A;  3N0E A;  2AGW A;  4JT5 C;  1B9X A;  1N6F A;  3V4V A;  4GM8 A;  3VGZ A;  4J84 A;  3ZE2 A;  4BCD A;  4AEZ A;  3VI3 A;  5HE2 B;  3QI0 A;  2P9N C;  4G1E A;  4CZY A;  1ERJ A;  2HKR A;  4CI2 A;  3OKT A;  4XYI A;  2EIB A;  3GRE A;  1UOO A;  2VDQ A;  2AGY A;  3K27 A;  3K72 A;  1K8K C;  2PBI B;  1GOF A;  5I5M A;  2I3S A;  4GQ1 A;  3IJC A;  4JD2 C;  2VZ1 A;  3EQ7 A;  4CI8 A;  2W18 A;  4O1Q D;  2IUR A;  4X63 B;  4J87 A;  5FKQ A;  2CN2 A;  2H9P A;  4J0X A;  5FKT A;  2H3X A;  5TF2 A;  1P22 A;  1BPO A;  5B4W A;  1JTD B;  3SVW D;  3DXM C;  4GGC A;  3C9C A;  5HDB A;  3OTT A;  3K6S A;  2OVP B;  3K71 A;  3JRP A;  2G9A A;  4A08 B;  4DNW A;  4PC0 A;  5IGO A;  4CZX A;  2IWK A;  4OWR A;  5K19 A;  2XL3 A;  2OK4 A;  3PVW B;  5AFU 3;  4J73 A;  3NID A;  1VZ2 A;  4FA4 D;  4UM8 A;  4MMY A;  3JPX A;  5EMM B;  4J0W A;  3C75 H;  2HU7 A;  4KFM B;  5CYK A;  4BH6 A;  2B5L A;  1UOP A;  2Z2N A;  4O3T B;  1H2X A;  5IJ7 E;  2IAA A;  3KRW B;  3T3M A;  2VDL A;  1Q47 A;  4AX4 A;  2VDN A;  3RSE C;  3ZDZ A;  4A0B A;  3NVQ A;  3AFC A;  3RRM C;  3PSC B;  4JHP C;  4E5Z A;  2VDM A;  2IWF A;  2I0R A;  4Z7O A;  3OF7 A;  3UVO A;  1U4C A;  4PBZ A;  3I89 A;  1VE7 A;  3SBQ A;  4BP8 A;  4NBM A;  3O4I A;  3I2N A;  2EID A;  4PBY A;  2GNQ A;  4RE6 A;  3EWE A;  2EBS A;  3O4H A;  1NR0 A;  3GC3 B;  1VYH C;  5H14 A;  3I7L A;  5CXB B;  5C2V B;  3V9F A;  2CE8 A;  5IC7 A;  5C86 A;  4ZOY A;  3C5M A;  4MMX A;  3VI4 A;  4J79 A;  2HYE A;  2P9I C;  4CY1 A;  3EU7 A;  5CXB A;  4L1M A;  4IA9 A;  4WK2 A;  3V7D B;  3F3P A;  1S4U X;  2OVQ B;  3IUQ A;  3OKY A;  3UR4 A;  2GC7 A;  3OW8 A;  1QFM A;  4BCC A;  3IUN A;  3KRX B;  2H9N A;  2HXC A;  2OIZ A;  4D9S A;  5FQD A;  3F3G A;  4J77 A;  3O4J A;  1O6G A;  5GMK n;  5H1M A;  1VZ3 A;  2H47 A;  3RN0 D;  5EML B;  3UVN A;  4LG9 A;  1L0Q A;  3UVK A;  3OL2 A;  4MK0 B;  3I7O A;  3EMH A;  1B9Y A;  4X3E A;  3IVM A;  4LG8 A;  3C99 A;  4H5I A;  2B5M A;  2JKX A;  2HU8 A;  3EI3 B;  4Z7N A;  1JOF A;  5HE3 B;  1I2M B;  4O45 A;  1VE6 A;  4QAM A;  2GC4 A;  4GM3 A;  1L5G A;  4O3U B;  1SHY B;  3I8C A;  1SQ9 A;  5THA A;  3MUN A;  3RMZ D;  3OKY B;  1PGU A;  5GSA A;  3JZG A;  2CO0 C;  2HKM A;  2VDR A;  3J80 g;  4E5Z B;  1YFQ A;  2H68 A;  3MUO A;  3CFV A;  3O4G A;  2H14 A;  5H17 A;  4PSW B;  1GXR A;  4EWR A;  4JXM A;  4JHN A;  4BL0 A;  1XIP A;  2OK6 A;  5EMJ B;  3V4P A;  5HYN B;  2QXV A;  4BUJ C;  5AJA A;  4K3I D;  2YBA A;  1MG3 A;  3IJE A;  4ERQ A;  4XYH A;  4OZU A;  2QZP A;  4R7A B;  1C9I A;  4FHL A;  4BCB A;  2BBK H;  5GXI A;  3UVL A;  3UKU C;  3IIY A;  1SQJ A;  4G1M A;  3HFQ A;  4NAA A;  4GGA A;  4PXW A;  3FGB A;  2YNP A;  3PVU B;  2AH0 A;  4K3J B;  4X60 B;  3OKW A;  4L1Q D;  4D6V A;  3CIK B;  5TDH B;  4ZOX A;  3MMY A;  5EMK B;  2CO0 A;  2IUP A;  3E0C A;  2P9K C;  5FLX g;  3IUL A;  2HJ4 A;  3I7K A;  4AN1 A;  4FA1 D;  3CFS B;  2BCJ B;  4ZOZ A;  4A0A B;  3ULE C;  3PE7 A;  2P9L C;  3OL2 B;  3PXW D;  3DXK C;  4N14 A;  2I0T A;  2Q7Q A;  3JAM g;  3EI1 B;  5HE0 B;  2XE4 A;  4BP9 A;  5FFG A;  3W15 A;  4TZ4 A;  2P9U C;  3I7H A;  3SWS D;  3IUJ A;  1RI6 A;  5TEF A;  5M5U A;  5C9Z B;  3L4O D;  5CXC B;  2QC5 A;  3EI1 A;  1GG2 B;  4D0K A;  5EAL A;  1A12 A;  3DSM A;  4J8G A;  4ESG A;  1TBG A;  4J82 A;  3SBR A;  4A11 B;  2XYI A;  5SXM A;  2PM7 B;  3SCY A;  5M61 A;  3EQ9 A;  5E6R A;  3SMR A;  4LGN A;  4WK4 A;  3JZH A;  2HES X;  4ERY A;  1QFS A;  1C9L A;  2J55 H;  3DM0 A;  4JSN C;  4XEI C;  1PI6 A;  3MZL A;  1UOQ A;  5IGQ A;  3B7F A;  2J57 G;  5EAM A;  1H2W A;  1OMW B;  4A11 A;  5EAP A;  3IJ1 A;  4A7J A;  2H9L A;  3EI2 A;  4J8B A;  4QRJ A;  4FAN D;  3A0F A;  3J81 g;  2XDW A;  4J86 A;  3BG1 A;  4ZN4 A;  3VH0 A;  2TRC B;  4GM9 A;  4QQE A;  4E54 B;  2PM6 B;  4ZOV A;  2B4E A;  1TYQ C;  1QNI A;  3L4M D;  4DNU A;  4FAV D;  2OJY A;  4JT6 C;  3JRO A;  4AMZ A;  2H6N A;  4CZV A;  4NEN A;  4O9D A;  3SJL D;  3AL8 A;  2XL2 A;  4CC9 A;  2AGL A;  3EI4 A;  3RFG A;  5TEE A;  3SN6 B;  5K1C C;  3RN1 D;  1H2Y A;  3UVM A;  3ZDX A;  3PSL A;  2Z2P A;  4AMY A;  5EM2 B;  3V5W B;  3AL8 B;  1E5T A;  3F3F A;  3NVN A;  3GD1 I;  2H9M A;  4J81 A;  3BWS A;  4CY3 A;  3MVD K;  2H6Q A;  4A09 B;  3MZK A;  1OLZ A;  1R5M A;  4AOW A;  5M5R A;  2P9P C;  2YNN A;  1JJU B;  1GP2 B;  3KCI A;  2IUQ A;  5EM2 A;  3SBP A;  3RFH A;  3PXT D;  3IUM A;  3ZWL B;  4YVD A;  2QR5 A;  2WQ8 A;  3GFC A;  4JSP C;  4FB1 D;  1FWX A;  5FA5 B;  2O9K A;  3PXS D;  4NSX A;  1JMZ B;  2VC2 A;  2XZG A;  2Z2O A;  1U8C A;  4A08 A;  2VDO A;  1K32 A;  1K3I A;  4CY5 A;  4G56 B;  2CN3 A;  1N6D A;  5FXY A;  2J56 H;  3U4Y A;  1MG2 A;  2YB8 B;  4JSX C;  2UZY B;  2IUV A;  3DWL C;  4UI9 R;  3N0D A;  5M5V A;  5EAR A;  1M1X A;  1JMX B;  4FWW A;  1TYE A;  3UKR C;  1E8M A;  4Y5R D;  5C92 A;  4L9O A; 
#chains in the Genus database with same CATH homology
 4GGD A;  2CNX A;  2H6K A;  2YNO A;  3I8E A;  5I5I A;  1NEX B;  3SFZ A;  5CYK B;  1MDA H;  4IMM A;  4A2M A;  2I3T A;  4A09 A;  5FKR A;  5AMS A;  2P9S C;  2AH1 A;  5IT9 g;  3JB9 L;  2CE9 A;  2MTA H;  3IKO A;  3I7P A;  4QT8 A;  4A0A A;  4ERZ A;  3SHF A;  3I7N A;  4PSX B;  4X61 B;  2PM9 A;  3ORV D;  3AL9 A;  1N6E A;  2HJB A;  1XKS A;  2UZX B;  3VA6 A;  3IIW A;  4GQ2 P;  3FRX A;  4GZ8 A;  3AH8 B;  2H13 A;  4U1E I;  2OVR B;  5CXC A;  1PBY B;  1XHM A;  4GMB A;  5HE1 B;  4L3H D;  5C2W B;  3MKS B;  2AGX A;  2PM9 B;  3MXX A;  3ODT A;  3NVX A;  3EG6 A;  3EI2 B;  3EI3 A;  5A2Q g;  2B5N A;  4PNK B;  1A0R B;  4U7A A;  2XU7 A;  3SXT D;  4I79 A;  1PEV A;  5FKS A;  4H5J A;  1GOT B;  5GXH A;  4CI3 A;  4A2L A;  4ES0 A;  3K26 A;  3P4F A;  4Z8L A;  2YMU A;  4J78 A;  3RLM D;  3BG0 A;  5I5J A;  4CY2 A;  3FM0 A;  4HDJ A;  2AQ5 A;  4A0B B;  3IJ0 A;  2I0S A;  5JWZ A;  5IJ8 E;  4GQB B;  4QL1 A;  1U2V C;  4L3G D;  4JSV C;  3SLE D;  4FA9 D;  2AGZ A;  4E54 A;  5KDO B;  3EI4 B;  4FA5 D;  3JZN A;  5HQG A;  2G99 A;  4CI1 A;  4Y7R A;  3MKQ A;  3N0E A;  2AGW A;  4JT5 C;  1B9X A;  1N6F A;  3VGZ A;  4GM8 A;  4J84 A;  4AEZ A;  5HE2 B;  2P9N C;  4CZY A;  1ERJ A;  2HKR A;  4CI2 A;  3OKT A;  4XYI A;  3GRE A;  2AGY A;  3K27 A;  1K8K C;  2PBI B;  5I5M A;  2I3S A;  4GQ1 A;  3IJC A;  4JD2 C;  4CI8 A;  2W18 A;  4O1Q D;  2IUR A;  4X63 B;  4J87 A;  5FKQ A;  2CN2 A;  2H9P A;  4J0X A;  5FKT A;  2H3X A;  5TF2 A;  1P22 A;  5B4W A;  3SVW D;  3DXM C;  4GGC A;  3C9C A;  3OTT A;  2OVP B;  3JRP A;  2G9A A;  4A08 B;  4PC0 A;  5IGO A;  4CZX A;  2IWK A;  4OWR A;  5K19 A;  2XL3 A;  2OK4 A;  3PVW B;  5AFU 3;  4J73 A;  4FA4 D;  3JPX A;  5EMM B;  4J0W A;  3C75 H;  4KFM B;  5CYK A;  4BH6 A;  2B5L A;  2Z2N A;  4O3T B;  5IJ7 E;  2IAA A;  3KRW B;  1Q47 A;  3RSE C;  4A0B A;  3NVQ A;  3AFC A;  3RRM C;  3PSC B;  4E5Z A;  2IWF A;  2I0R A;  3UVO A;  1U4C A;  4PBZ A;  3I89 A;  3SBQ A;  3I2N A;  4PBY A;  2GNQ A;  3EWE A;  2EBS A;  1NR0 A;  1VYH C;  5H14 A;  3I7L A;  5CXB B;  5C2V B;  3V9F A;  2CE8 A;  5IC7 A;  4ZOY A;  3C5M A;  4J79 A;  2HYE A;  2P9I C;  4CY1 A;  3EU7 A;  5CXB A;  4IA9 A;  3V7D B;  3F3P A;  1S4U X;  2OVQ B;  3OKY A;  3UR4 A;  2GC7 A;  3OW8 A;  3KRX B;  2H9N A;  2HXC A;  2OIZ A;  5FQD A;  3F3G A;  4J77 A;  5GMK n;  5H1M A;  2H47 A;  3RN0 D;  5EML B;  3UVN A;  4LG9 A;  1L0Q A;  3UVK A;  3OL2 A;  4MK0 B;  3I7O A;  3EMH A;  1B9Y A;  4X3E A;  4LG8 A;  3C99 A;  4H5I A;  2B5M A;  3EI3 B;  1JOF A;  5HE3 B;  4O45 A;  2GC4 A;  4GM3 A;  4O3U B;  1SHY B;  3I8C A;  1SQ9 A;  5THA A;  3RMZ D;  3OKY B;  1PGU A;  5GSA A;  3JZG A;  2CO0 C;  2HKM A;  3J80 g;  4E5Z B;  1YFQ A;  2H68 A;  3CFV A;  2H14 A;  5H17 A;  4PSW B;  1GXR A;  4EWR A;  4JXM A;  4BL0 A;  1XIP A;  2OK6 A;  5EMJ B;  5HYN B;  2QXV A;  4BUJ C;  5AJA A;  4K3I D;  2YBA A;  1MG3 A;  4ERQ A;  4XYH A;  4OZU A;  4R7A B;  4FHL A;  5GXI A;  2BBK H;  3UVL A;  3UKU C;  3IIY A;  1SQJ A;  3HFQ A;  4GGA A;  4PXW A;  3FGB A;  2YNP A;  3PVU B;  2AH0 A;  4K3J B;  4X60 B;  3OKW A;  4L1Q D;  4D6V A;  3CIK B;  5TDH B;  4ZOX A;  3MMY A;  5EMK B;  2CO0 A;  2IUP A;  3E0C A;  2P9K C;  5FLX g;  2HJ4 A;  3I7K A;  4FA1 D;  3CFS B;  2BCJ B;  4ZOZ A;  4A0A B;  3ULE C;  3PE7 A;  2P9L C;  3OL2 B;  3PXW D;  3DXK C;  4N14 A;  2I0T A;  2Q7Q A;  3JAM g;  3EI1 B;  5HE0 B;  3W15 A;  4TZ4 A;  2P9U C;  3I7H A;  3SWS D;  1RI6 A;  5TEF A;  5C9Z B;  3L4O D;  5CXC B;  2QC5 A;  3EI1 A;  1GG2 B;  4D0K A;  5EAL A;  3DSM A;  4J8G A;  4ESG A;  1TBG A;  4J82 A;  3SBR A;  4A11 B;  2XYI A;  5SXM A;  2PM7 B;  3SCY A;  3SMR A;  4LGN A;  3JZH A;  2HES X;  4ERY A;  2J55 H;  3DM0 A;  4JSN C;  4XEI C;  1PI6 A;  3MZL A;  5IGQ A;  3B7F A;  2J57 G;  5EAM A;  1OMW B;  4A11 A;  5EAP A;  3IJ1 A;  4A7J A;  2H9L A;  3EI2 A;  4J8B A;  4QRJ A;  4FAN D;  3A0F A;  3J81 g;  4J86 A;  3BG1 A;  4ZN4 A;  3VH0 A;  2TRC B;  4GM9 A;  4QQE A;  4E54 B;  2PM6 B;  4ZOV A;  2B4E A;  1TYQ C;  1QNI A;  3L4M D;  4FAV D;  2OJY A;  4JT6 C;  3JRO A;  2H6N A;  4CZV A;  4O9D A;  3SJL D;  3AL8 A;  2XL2 A;  4CC9 A;  2AGL A;  3EI4 A;  3RFG A;  5TEE A;  3SN6 B;  5K1C C;  3RN1 D;  3UVM A;  3PSL A;  2Z2P A;  5EM2 B;  3V5W B;  3AL8 B;  3F3F A;  3NVN A;  2H9M A;  4J81 A;  3BWS A;  4CY3 A;  2H6Q A;  4A09 B;  3MZK A;  1OLZ A;  1R5M A;  4AOW A;  2P9P C;  2YNN A;  1GP2 B;  1JJU B;  3SBP A;  2IUQ A;  5EM2 A;  3RFH A;  3PXT D;  3ZWL B;  4YVD A;  3GFC A;  4JSP C;  4FB1 D;  1FWX A;  5FA5 B;  2O9K A;  3PXS D;  4NSX A;  1JMZ B;  2Z2O A;  4A08 A;  1K32 A;  4CY5 A;  4G56 B;  2CN3 A;  1N6D A;  5FXY A;  2J56 H;  3U4Y A;  1MG2 A;  2YB8 B;  4JSX C;  2UZY B;  2IUV A;  3DWL C;  4UI9 R;  3N0D A;  5EAR A;  1JMX B;  4FWW A;  3UKR C;  4Y5R D;  4L9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...