1UTCA

Clathrin terminal domain complexed with tlpwdlwtt
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
352
structure length
352
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords CLATHRIN HEAVY CHAIN
publication title Two distinct interaction motifs in amphiphysin bind two independent sites on the clathrin terminal domain beta-propeller.
pubmed doi rcsb
source organism Bos taurus
total genus 86
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1utcA00
5M5SA 1UTCA 1C9LA 5M5UA 3GD1I 4G55A 5M5VA 3GC3B 5M5TA 1BPOA 5M61A 5M5RA 2XZGA 1C9IA
chains in the Genus database with same CATH superfamily
5TF2A 3RRMC 2YMUA 3CIKB 3MKSB 3U4YA 2AGWA 3IJCA 3BG1A 4AN1A 3MZKA 3VGZA 3OKYB 3NVQA 4WK4A 4EWRA 5JWZA 3IIWA 4L3GD 2P9KC 4GGAA 5H14A 4RE5A 3QI0A 4BUJC 1H2YA 5C2VB 3I8CA 5M5RA 3AL9A 2P9UC 3IULA 3UKRC 4BCCA 4NSXA 2VDPA 3IJEA 4CZVA 3RN1D 1VE6A 1JOFA 1H2WA 2CN3A 4J81A 5IGQA 1VZ2A 5M61A 4A08A 1O6GA 3JB9L 1FWXA 4O45A 3SN6B 4J84A 1VE7A 3SWSD 1QFMA 4MMYA 1S4UX 1BPOA 3AFCA 2VZ1A 4GM8A 2H6QA 3PVUB 2VZ3A 5H1MA 3RMZD 3SVWD 5CXCA 3GREA 4QT8A 2H47A 3V4VA 4A7JA 1B9YA 2EIDA 2XZGA 5CYKA 3SBPA 3K26A 3ZDYA 3UVNA 1C9LA 3EG6A 2PM9A 2B5NA 2J55H 1GOGA 2Q7QA 3PSLA 3J81g 2OVRB 1N6FA 4JD2C 4AX4A 4GZ8A 1QNIA 4X61B 4GQBB 5M5SA 3F3GA 4Y5RD 2XL2A 3UVOA 2BCJB 4K3ID 2BBKH 4DNWA 5E6SA 4BCDA 1A12A 4Y7RA 3BWSA 1UTCA 4J0WA 5GSAA 1QFSA 3ORVD 1YFQA 3ZDXA 2OJYA 4JT5C 1OLZA 2HU8A 5SXMA 3NVNA 2XYIA 1XHMA 2AGYA 3E0CA 3HFQA 2H14A 4DNVA 4JSXC 2CE8A 3I7NA 2PBIB 3ZWLB 2EICA 3V7DB 4CY1A 4MMXA 5E6UA 1GOHA 4N14A 4Z7NA 2IUPA 2OK6A 4X3EA 1NEXB 3PVWB 4NENA 4BP8A 2IUVA 2H9MA 1C9IA 2H9PA 1OMWB 3PXTD 1H2XA 2QZPA 4CI1A 4CY2A 3MMYA 3VA6A 1E8MA 2W18A 3JZGA 4BCBA 1GOTB 5AMSA 4WK2A 1VZ3A 3QHYB 5FA5B 5EARA 1VYHC 5EMKB 2H9NA 3FM0A 3KRXB 2H68A 1T2XA 4MMZA 4A11A 3FRXA 3GC3B 5EAPA 2CE9A 5FKSA 4FA4D 5C86A 4A08B 2JKXA 4JHPC 2GNQA 1K32A 3K27A 5A2Qg 3RFHA 3DDUA 2YBAA 5AJAA 1UOOA 3P4FA 1U2VC 5HE1B 2EIBA 4A0BA 5CXCB 1NR0A 5CYKB 3O4GA 4GGCA 3V4PA 4WK0A 5C2WB 2HU5A 5M5VA 3MKQA 2PM9B 3W15A 1TBGA 2AGXA 1GG2B 4A2MA 4X60B 3EWEA 2AGZA 2QXVA 4IRZA 5GXHA 4G1MA 5FKRA 3OTTA 5IC7A 4PSWB 2VDOA 3FGBA 3O4IA 1K3IA 4ES0A 4I79A 1L0QA 3O4JA 4L3HD 4A2LA 4PNKB 5M5TA 2AH0A 2YB8B 3UVMA 5HQGA 5E6RA 3MUOA 1JMXB 2BKLA 1K8KC 5TEEA 3C99A 3RSEC 3IVMA 3AH8B 5IJ7E 4U7AA 2CO0A 3AL8A 3C5MA 5IGOA 3EMHA 4G56B 1MG3A 4PSXB 4Z8LA 4NC4A 4E54A 3C9CA 3JZHA 5AFU3 1H2ZA 5FXYA 1XKSA 4J8BA 2PM7B 4DNUA 2GC4A 4O02A 4R7AB 5FFGA 3PE7A 4AN0A 5I5IA 4NBMA 3ZDZA 3F3FA 2QR5A 4BL0A 1SHYB 3K6SA 2B5LA 4ERZA 2CN2A 4ERQA 4K3JB 4LGNA 3KRWB 3EU7A 2VDMA 2OK4A 3J80g 4A11B 2GC7A 1PBYB 4L1QD 4O9DA 4X63B 3UKUC 2TRCB 4XYIA 1JTDB 1ERJA 3IJ0A 4A0AA 3MZLA 2OIZA 3IUNA 4Z7OA 4J73A 3PXWD 1A0RB 3NIFA 3IUQA 2HJ4A 2I3SA 1GOFA 2G9AA 3N0EA 5FKQA 4A0BB 2EIEA 2HKRA 5TDHB 4G1EA 3T3PA 5HE0B 2H6NA 5K1CC 4AMYA 3L4OD 3NVXA 4NAAA 4O2WA 4D0KA 4AMZA 4GM9A 4GQ1A 2HYEA 3T3MA 4IMMA 4AOWA 3KCIA 4CI8A 5FKTA 2CNXA 3DXMC 3EQ7A 3RFGA 3K71A 4GQ2P 3NIDA 4J87A 1N6DA 4J77A 1GP2B 4ZOVA 5M5UA 3I2NA 1L5GA 2UZYB 3I7KA 2IAAA 2AH1A 4JSNC 1U8CA 4UM8A 3EI1A 4PXWA 5HYNB 4WJKA 4O3UB 1U4CA 2IWFA 4FAND 5GXIA 2YNOA 3V5WB 4CY3A 1M1XA 3MXXA 3AL8B 4E54B 3EQ9A 3SCYA 2UZXB 4O1QD 3SFZA 2XU7A 3IIYA 4UI9R 3FCUA 3EI2A 4CI2A 4CY5A 2J56H 3GFCA 3SMRA 2H9LA 5FLXg 4MK0B 5EMLB 3C75H 1RI6A 3EQ8A 4J78A 3IUMA 1UOPA 3SBRA 4PBZA 1PEVA 1JJUB 2P9SC 4PC0A 4FA9D 1YR2A 2XDWA 4JSVC 5EMJB 5TEFA 4J86A 4U1EI 4ZOXA 4AEZA 3BG0A 2P9IC 3K72A 4A0AB 5HDBA 2VDNA 4YVDA 3OL2A 5H17A 3FCSA 3I7OA 2I3TA 2WQ8A 4E5ZA 5I5JA 5EMMB 3UVLA 5EM2A 2OVQB 1TYQC 2MTAH 3EI4A 5HE2B 4QAMA 1Q47A 5FQDA 3EI3A 4FAVD 4OZUA 5EAMA 3VI3A 4FA1D 4XYHA 2AGLA 3OW8A 2B5MA 1E8NA 4A09A 4QRJA 3IJ1A 4OWRA 2IWKA 2P9NC 2H3XA 1SQJA 4ZN4A 4QL1A 4CC9A 1B9XA 4L9OA 1N6EA 3UR4A 1GXRA 4LG8A 3PSCB 3SHFA 3N0DA 4BH6A 2IUQA 2O9KA 3IKOA 4CI3A 3EI1B 2AQ5A 5CXBA 4HDJA 3DM0A 5EALA 5KDOB 1P22A 2XL3A 3ULEC 4CZXA 4GGDA 4LG9A 1SQ9A 1UOQA 2EBSA 2HKMA 2XE4A 1PI6A 2H13A 3EI2B 4L1MA 4J82A 5THAA 2J57G 1JMZB 3DSMA 1XIPA 5C9ZB 5K19A 5IT9g 4JT6C 5FFOA 3B7FA 3SBQA 4XEIC 3A0FA 3I8EA 4FA5D 3I7HA 2HU7A 3VI4A 2I0TA 3SJLD 4D6VA 1E5TA 3ODTA 5IJ8E 4J79A 2I0SA 2IURA 4J8GA 3OF7A 4Z7QA 2VDRA 5GMKn 3JPXA 2P9PC 3V9FA 4GM3A 5HE3B 4JXMA 3OKYA 1TYEA 3IURA 3SXTD 5I5MA 4IA9A 2Z2PA 1JV2A 3I7PA 4ZOYA 4G55A 1I2MB 4TZ4A 3PXSD 4RE6A 5C92A 2Z2OA 3DWLC 3MUNA 3OL2B 3OKWA 4FWWA 4QQEA 2I0RA 4H5JA 4E5ZB 4D9SA 3ZE0A 5EM2B 3UVKA 3EI4B 3L4MD 3RLMD 2HESX 4GMBA 4ESGA 3EI3B 2VDKA 2VDLA 3I89A 3O4HA 3I7LA 4ZOZA 4PBYA 4A09B 4BP9A 3JZNA 2HJBA 3RN0D 3JROA 2VC2A 4CZYA 3CFSB 3IUJA 4JHNA 4ERYA 2G99A 2PM6B 4JSPC 4KFMB 1MG2A 4FB1D 5CXBB 3JAMg 2Z2NA 3DXKC 2OVPB 3ZE2A 3GD1I 1R5MA 4O3TB 3VH0A 2YNPA 2YNNA 1MDAH 2H6KA 3OKTA 2CO0C 3MVDK 1PGUA 5B4WA 3JRPA 1O6FA 4J0XA 3ZE1A 2P9LC 3CFVA 4UM9A 2QC5A 3SLED 2HXCA 3NIGA 3F3PA 4FHLA 2B4EA 4H5IA 2VDQA
chains in the Genus database with same CATH topology
5M5SA 1UTCA 1C9LA 5M5UA 3GD1I 4G55A 5M5VA 3GC3B 5M5TA 1BPOA 5M61A 5M5RA 2XZGA 1C9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5S A;  1UTC A;  1C9L A;  5M5U A;  3GD1 I;  4G55 A;  5M5V A;  3GC3 B;  5M5T A;  1BPO A;  5M61 A;  5M5R A;  2XZG A;  1C9I A; 
#chains in the Genus database with same CATH topology
 5TF2 A;  3RRM C;  2YMU A;  3CIK B;  3MKS B;  3U4Y A;  2AGW A;  3IJC A;  3BG1 A;  4AN1 A;  3MZK A;  3VGZ A;  3OKY B;  3NVQ A;  4WK4 A;  4EWR A;  5JWZ A;  3IIW A;  4L3G D;  2P9K C;  4GGA A;  5H14 A;  4RE5 A;  3QI0 A;  4BUJ C;  1H2Y A;  5C2V B;  3I8C A;  5M5R A;  3AL9 A;  2P9U C;  3IUL A;  3UKR C;  4BCC A;  4NSX A;  2VDP A;  3IJE A;  4CZV A;  3RN1 D;  1VE6 A;  1JOF A;  1H2W A;  2CN3 A;  4J81 A;  5IGQ A;  1VZ2 A;  5M61 A;  4A08 A;  1O6G A;  3JB9 L;  1FWX A;  4O45 A;  3SN6 B;  4J84 A;  1VE7 A;  3SWS D;  1QFM A;  4MMY A;  1S4U X;  1BPO A;  3AFC A;  2VZ1 A;  4GM8 A;  2H6Q A;  3PVU B;  2VZ3 A;  5H1M A;  3RMZ D;  3SVW D;  5CXC A;  3GRE A;  4QT8 A;  2H47 A;  3V4V A;  4A7J A;  1B9Y A;  2EID A;  2XZG A;  5CYK A;  3SBP A;  3K26 A;  3ZDY A;  3UVN A;  1C9L A;  3EG6 A;  2PM9 A;  2B5N A;  2J55 H;  1GOG A;  2Q7Q A;  3PSL A;  3J81 g;  2OVR B;  1N6F A;  4JD2 C;  4AX4 A;  4GZ8 A;  1QNI A;  4X61 B;  4GQB B;  5M5S A;  3F3G A;  4Y5R D;  2XL2 A;  3UVO A;  2BCJ B;  4K3I D;  2BBK H;  4DNW A;  5E6S A;  4BCD A;  1A12 A;  4Y7R A;  3BWS A;  1UTC A;  4J0W A;  5GSA A;  1QFS A;  3ORV D;  1YFQ A;  3ZDX A;  2OJY A;  4JT5 C;  1OLZ A;  2HU8 A;  5SXM A;  3NVN A;  2XYI A;  1XHM A;  2AGY A;  3E0C A;  3HFQ A;  2H14 A;  4DNV A;  4JSX C;  2CE8 A;  3I7N A;  2PBI B;  3ZWL B;  2EIC A;  3V7D B;  4CY1 A;  4MMX A;  5E6U A;  1GOH A;  4N14 A;  4Z7N A;  2IUP A;  2OK6 A;  4X3E A;  1NEX B;  3PVW B;  4NEN A;  4BP8 A;  2IUV A;  2H9M A;  1C9I A;  2H9P A;  1OMW B;  3PXT D;  1H2X A;  2QZP A;  4CI1 A;  4CY2 A;  3MMY A;  3VA6 A;  1E8M A;  2W18 A;  3JZG A;  4BCB A;  1GOT B;  5AMS A;  4WK2 A;  1VZ3 A;  3QHY B;  5FA5 B;  5EAR A;  1VYH C;  5EMK B;  2H9N A;  3FM0 A;  3KRX B;  2H68 A;  1T2X A;  4MMZ A;  4A11 A;  3FRX A;  3GC3 B;  5EAP A;  2CE9 A;  5FKS A;  4FA4 D;  5C86 A;  4A08 B;  2JKX A;  4JHP C;  2GNQ A;  1K32 A;  3K27 A;  5A2Q g;  3RFH A;  3DDU A;  2YBA A;  5AJA A;  1UOO A;  3P4F A;  1U2V C;  5HE1 B;  2EIB A;  4A0B A;  5CXC B;  1NR0 A;  5CYK B;  3O4G A;  4GGC A;  3V4P A;  4WK0 A;  5C2W B;  2HU5 A;  5M5V A;  3MKQ A;  2PM9 B;  3W15 A;  1TBG A;  2AGX A;  1GG2 B;  4A2M A;  4X60 B;  3EWE A;  2AGZ A;  2QXV A;  4IRZ A;  5GXH A;  4G1M A;  5FKR A;  3OTT A;  5IC7 A;  4PSW B;  2VDO A;  3FGB A;  3O4I A;  1K3I A;  4ES0 A;  4I79 A;  1L0Q A;  3O4J A;  4L3H D;  4A2L A;  4PNK B;  5M5T A;  2AH0 A;  2YB8 B;  3UVM A;  5HQG A;  5E6R A;  3MUO A;  1JMX B;  2BKL A;  1K8K C;  5TEE A;  3C99 A;  3RSE C;  3IVM A;  3AH8 B;  5IJ7 E;  4U7A A;  2CO0 A;  3AL8 A;  3C5M A;  5IGO A;  3EMH A;  4G56 B;  1MG3 A;  4PSX B;  4Z8L A;  4NC4 A;  4E54 A;  3C9C A;  3JZH A;  5AFU 3;  1H2Z A;  5FXY A;  1XKS A;  4J8B A;  2PM7 B;  4DNU A;  2GC4 A;  4O02 A;  4R7A B;  5FFG A;  3PE7 A;  4AN0 A;  5I5I A;  4NBM A;  3ZDZ A;  3F3F A;  2QR5 A;  4BL0 A;  1SHY B;  3K6S A;  2B5L A;  4ERZ A;  2CN2 A;  4ERQ A;  4K3J B;  4LGN A;  3KRW B;  3EU7 A;  2VDM A;  2OK4 A;  3J80 g;  4A11 B;  2GC7 A;  1PBY B;  4L1Q D;  4O9D A;  4X63 B;  3UKU C;  2TRC B;  4XYI A;  1JTD B;  1ERJ A;  3IJ0 A;  4A0A A;  3MZL A;  2OIZ A;  3IUN A;  4Z7O A;  4J73 A;  3PXW D;  1A0R B;  3NIF A;  3IUQ A;  2HJ4 A;  2I3S A;  1GOF A;  2G9A A;  3N0E A;  5FKQ A;  4A0B B;  2EIE A;  2HKR A;  5TDH B;  4G1E A;  3T3P A;  5HE0 B;  2H6N A;  5K1C C;  4AMY A;  3L4O D;  3NVX A;  4NAA A;  4O2W A;  4D0K A;  4AMZ A;  4GM9 A;  4GQ1 A;  2HYE A;  3T3M A;  4IMM A;  4AOW A;  3KCI A;  4CI8 A;  5FKT A;  2CNX A;  3DXM C;  3EQ7 A;  3RFG A;  3K71 A;  4GQ2 P;  3NID A;  4J87 A;  1N6D A;  4J77 A;  1GP2 B;  4ZOV A;  5M5U A;  3I2N A;  1L5G A;  2UZY B;  3I7K A;  2IAA A;  2AH1 A;  4JSN C;  1U8C A;  4UM8 A;  3EI1 A;  4PXW A;  5HYN B;  4WJK A;  4O3U B;  1U4C A;  2IWF A;  4FAN D;  5GXI A;  2YNO A;  3V5W B;  4CY3 A;  1M1X A;  3MXX A;  3AL8 B;  4E54 B;  3EQ9 A;  3SCY A;  2UZX B;  4O1Q D;  3SFZ A;  2XU7 A;  3IIY A;  4UI9 R;  3FCU A;  3EI2 A;  4CI2 A;  4CY5 A;  2J56 H;  3GFC A;  3SMR A;  2H9L A;  5FLX g;  4MK0 B;  5EML B;  3C75 H;  1RI6 A;  3EQ8 A;  4J78 A;  3IUM A;  1UOP A;  3SBR A;  4PBZ A;  1PEV A;  1JJU B;  2P9S C;  4PC0 A;  4FA9 D;  1YR2 A;  2XDW A;  4JSV C;  5EMJ B;  5TEF A;  4J86 A;  4U1E I;  4ZOX A;  4AEZ A;  3BG0 A;  2P9I C;  3K72 A;  4A0A B;  5HDB A;  2VDN A;  4YVD A;  3OL2 A;  5H17 A;  3FCS A;  3I7O A;  2I3T A;  2WQ8 A;  4E5Z A;  5I5J A;  5EMM B;  3UVL A;  5EM2 A;  2OVQ B;  1TYQ C;  2MTA H;  3EI4 A;  5HE2 B;  4QAM A;  1Q47 A;  5FQD A;  3EI3 A;  4FAV D;  4OZU A;  5EAM A;  3VI3 A;  4FA1 D;  4XYH A;  2AGL A;  3OW8 A;  2B5M A;  1E8N A;  4A09 A;  4QRJ A;  3IJ1 A;  4OWR A;  2IWK A;  2P9N C;  2H3X A;  1SQJ A;  4ZN4 A;  4QL1 A;  4CC9 A;  1B9X A;  4L9O A;  1N6E A;  3UR4 A;  1GXR A;  4LG8 A;  3PSC B;  3SHF A;  3N0D A;  4BH6 A;  2IUQ A;  2O9K A;  3IKO A;  4CI3 A;  3EI1 B;  2AQ5 A;  5CXB A;  4HDJ A;  3DM0 A;  5EAL A;  5KDO B;  1P22 A;  2XL3 A;  3ULE C;  4CZX A;  4GGD A;  4LG9 A;  1SQ9 A;  1UOQ A;  2EBS A;  2HKM A;  2XE4 A;  1PI6 A;  2H13 A;  3EI2 B;  4L1M A;  4J82 A;  5THA A;  2J57 G;  1JMZ B;  3DSM A;  1XIP A;  5C9Z B;  5K19 A;  5IT9 g;  4JT6 C;  5FFO A;  3B7F A;  3SBQ A;  4XEI C;  3A0F A;  3I8E A;  4FA5 D;  3I7H A;  2HU7 A;  3VI4 A;  2I0T A;  3SJL D;  4D6V A;  1E5T A;  3ODT A;  5IJ8 E;  4J79 A;  2I0S A;  2IUR A;  4J8G A;  3OF7 A;  4Z7Q A;  2VDR A;  5GMK n;  3JPX A;  2P9P C;  3V9F A;  4GM3 A;  5HE3 B;  4JXM A;  3OKY A;  1TYE A;  3IUR A;  3SXT D;  5I5M A;  4IA9 A;  2Z2P A;  1JV2 A;  3I7P A;  4ZOY A;  4G55 A;  1I2M B;  4TZ4 A;  3PXS D;  4RE6 A;  5C92 A;  2Z2O A;  3DWL C;  3MUN A;  3OL2 B;  3OKW A;  4FWW A;  4QQE A;  2I0R A;  4H5J A;  4E5Z B;  4D9S A;  3ZE0 A;  5EM2 B;  3UVK A;  3EI4 B;  3L4M D;  3RLM D;  2HES X;  4GMB A;  4ESG A;  3EI3 B;  2VDK A;  2VDL A;  3I89 A;  3O4H A;  3I7L A;  4ZOZ A;  4PBY A;  4A09 B;  4BP9 A;  3JZN A;  2HJB A;  3RN0 D;  3JRO A;  2VC2 A;  4CZY A;  3CFS B;  3IUJ A;  4JHN A;  4ERY A;  2G99 A;  2PM6 B;  4JSP C;  4KFM B;  1MG2 A;  4FB1 D;  5CXB B;  3JAM g;  2Z2N A;  3DXK C;  2OVP B;  3ZE2 A;  3GD1 I;  1R5M A;  4O3T B;  3VH0 A;  2YNP A;  2YNN A;  1MDA H;  2H6K A;  3OKT A;  2CO0 C;  3MVD K;  1PGU A;  5B4W A;  3JRP A;  1O6F A;  4J0X A;  3ZE1 A;  2P9L C;  3CFV A;  4UM9 A;  2QC5 A;  3SLE D;  2HXC A;  3NIG A;  3F3P A;  4FHL A;  2B4E A;  4H5I A;  2VDQ A; 
#chains in the Genus database with same CATH homology
 5M5S A;  1UTC A;  1C9L A;  5M5U A;  3GD1 I;  4G55 A;  5M5V A;  3GC3 B;  5M5T A;  1BPO A;  5M61 A;  5M5R A;  2XZG A;  1C9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...