1UTCA

Clathrin terminal domain complexed with tlpwdlwtt
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
352
structure length
352
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct interaction motifs in amphiphysin bind two independent sites on the clathrin terminal domain beta-propeller.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
molecule keywords CLATHRIN HEAVY CHAIN
total genus 86
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1utcA00
1C9LA 3GC3B 4G55A 5M5TA 5M5VA 1C9IA 5M5SA 5M5UA 3GD1I 1BPOA 5M5RA 2XZGA 1UTCA 5M61A
chains in the Genus database with same CATH superfamily
1H2YA 4HDJA 1K8KC 4L9OA 3C99A 1JV2A 1QFMA 2P9KC 3UVNA 3O4JA 1GOFA 3AL8A 2G9AA 2PM9B 3L4MD 4FAND 4A08A 4NENA 3I7LA 1N6DA 2AGLA 3JPXA 5HE1B 1GP2B 3MKSB 1VYHC 5A2Qg 4BCDA 3AL9A 4A0AA 3N0DA 3OL2B 4FA4D 4DNUA 3SMRA 4LG8A 4BCBA 1FWXA 3VI4A 4Z7QA 3JZGA 1OLZA 5CXBB 3KCIA 3DWLC 5FXYA 2IAAA 4RE6A 5EARA 3OW8A 1A12A 1MG2A 2UZXB 3EI4B 4J77A 4UI9R 2AH1A 3UVMA 4PBYA 3BG0A 5M5SA 2H3XA 4J84A 1H2ZA 2G99A 3CFVA 5EMLB 2VDPA 2VDQA 3V5WB 1SHYB 4FB1D 3IJ1A 1BPOA 4ZOXA 5IJ7E 2I0RA 2PM7B 5EMJB 2AGZA 3SXTD 3I8EA 4AMZA 4O3TB 4KFMB 4CZVA 4K3JB 2IWFA 1VE6A 2B4EA 2OIZA 2PM9A 4ZOZA 1B9XA 2GC4A 2YB8B 3FCUA 3VGZA 4X3EA 3SBRA 3B7FA 2HESX 2W18A 3VA6A 3PE7A 4GGCA 2H9LA 5E6UA 3QHYB 5CXCB 2BBKH 4K3ID 2P9SC 1UTCA 3SBQA 3K72A 4A08B 2QXVA 2CO0C 3IUNA 4ERQA 2P9UC 2CE8A 2PBIB 5C9ZB 3EMHA 1PI6A 3JRPA 5TF2A 1N6FA 3OKYA 3P4FA 3RMZD 5HE0B 2J57G 2PM6B 3AL8B 2IUVA 4J78A 4WK4A 1VE7A 4QT8A 2XDWA 5CXBA 3SHFA 5FFOA 3IJ0A 4L1MA 3EI2B 1H2XA 1C9IA 1JTDB 3V7DB 3ZDZA 4IA9A 5E6RA 2OJYA 3QI0A 3J81g 5FKQA 2HU5A 2EICA 4CY1A 2AGYA 2HJBA 3PSCB 4ES0A 5B4WA 3I7NA 3AH8B 4GMBA 2QR5A 4DNVA 4FAVD 2UZYB 3KRWB 4Y7RA 1L0QA 4O3UB 3PSLA 3EU7A 4GQBB 3UVOA 4NC4A 4A11B 3IUQA 2XYIA 5CYKA 4PC0A 4CC9A 5EMMB 4A09A 3KRXB 2J56H 3A0FA 4X63B 3ZE2A 2GNQA 3EQ7A 4G1EA 4JSPC 5H1MA 4ZN4A 5IT9g 4J8BA 5EAPA 4NBMA 3IUJA 4J73A 2VDLA 4J79A 4A11A 2HU7A 2H9NA 2P9LC 5HYNB 3AFCA 3RFHA 3OKYB 3K26A 4GQ2P 4H5JA 2B5NA 4WK2A 1E8NA 3JAMg 5FQDA 1E5TA 4IRZA 3EG6A 4O1QD 4GGDA 4FA9D 5H14A 4AMYA 2CNXA 3CIKB 3MUOA 4JSNC 5CXCA 3EI4A 3UKUC 1PGUA 4J0XA 3EI2A 3V4VA 2HKRA 2AH0A 4L3HD 4BL0A 2BCJB 5M5TA 4JSXC 5I5JA 2OVQB 2EIBA 2AGWA 3ZWLB 5E6SA 4R7AB 3UVKA 2HKMA 4GM3A 4H5IA 4GGAA 4U1EI 3GREA 5AFU3 5EM2A 4XYIA 2I0SA 4D6VA 1OMWB 2H68A 4WJKA 2BKLA 5EALA 4G56B 1SQ9A 4Y5RD 2XZGA 4MMYA 4I79A 5FKRA 1PBYB 3MKQA 2YNNA 4ZOYA 4YVDA 2H47A 2IUQA 4O2WA 4J81A 3OL2A 4CI2A 3ULEC 4IMMA 2XL2A 5THAA 3EI1B 3ORVD 1NEXB 5IGQA 2H9PA 3FGBA 2H13A 4X60B 2H6KA 4QAMA 4A0AB 3SBPA 3I2NA 3C9CA 3IJCA 2YNPA 1U2VC 2P9IC 4AX4A 2YBAA 4WK0A 5C2VB 4GQ1A 3K6SA 3UVLA 3PXSD 1TYEA 4JHNA 3FM0A 4AN1A 3C75H 1GXRA 3SVWD 5FKSA 4A2LA 3MZLA 3IULA 2VDMA 5AJAA 4G1MA 3O4HA 4ESGA 3V9FA 4OZUA 5TDHB 3ZDXA 1XHMA 3ODTA 1UOQA 1S4UX 5GSAA 3NVNA 4JD2C 5C2WB 3PXTD 3IKOA 5M5VA 3DXKC 1H2WA 4GM8A 4FA1D 4Z7NA 5M5UA 3SFZA 4FA5D 2VDNA 2EIEA 4A7JA 4CZXA 3PXWD 1QFSA 3EWEA 2OVPB 1JMXB 2OK6A 3GFCA 1MG3A 1NR0A 5C92A 1TYQC 2TRCB 2H6NA 3RSEC 2CN3A 4GM9A 1K32A 3OKTA 2B5MA 2CO0A 3PVWB 4FWWA 2Z2PA 2P9PC 3I7PA 4A0BA 3GC3B 4LG9A 5HE2B 3GD1I 4QL1A 3I7KA 3MVDK 1I2MB 5GXIA 4AOWA 1VZ2A 1T2XA 3JB9L 4OWRA 4J8GA 3SLED 2H6QA 5GMKn 1JOFA 2Q7QA 5FLXg 3OKWA 3VH0A 3MUNA 4MMZA 3O4IA 4L1QD 2CN2A 1U4CA 4J86A 2IURA 3IVMA 4GZ8A 1ERJA 4PNKB 5FA5B 5FFGA 3UKRC 3VI3A 4D9SA 2HXCA 4XYHA 4E54A 5I5MA 3PVUB 3IURA 2B5LA 5HE3B 5IJ8E 4CY3A 2MTAH 3MMYA 4ERZA 2OK4A 2O9KA 2Z2OA 3K27A 4JT5C 4CZYA 4JHPC 4QQEA 4PSXB 4QRJA 3IIWA 4CI8A 2YNOA 1A0RB 5IGOA 4A0BB 4UM9A 1MDAH 3I89A 4TZ4A 5K19A 3DDUA 2P9NC 1YFQA 1O6GA 4BCCA 1GOHA 1U8CA 3DM0A 3RRMC 1E8MA 3L4OD 3C5MA 3HFQA 1QNIA 1C9LA 2VDKA 5C86A 1YR2A 4EWRA 2GC7A 1UOOA 3I7HA 1P22A 4FHLA 4X61B 3I8CA 2QZPA 1UOPA 3JZHA 2CE9A 4Z8LA 4CY5A 3IIYA 5IC7A 3I7OA 2WQ8A 1M1XA 4AN0A 3FRXA 2VZ1A 3OF7A 4E5ZA 4CI3A 4E5ZB 2HYEA 3ZE1A 3J80g 5EM2B 1XIPA 2H14A 3NIDA 3O4GA 1N6EA 3NVXA 4LGNA 4D0KA 4J87A 3NIGA 2VZ3A 2AGXA 5EMKB 4Z7OA 1L5GA 4N14A 3T3PA 4ERYA 4MK0B 4E54B 3V4PA 5HQGA 1GOGA 3EI3B 4JT6C 3E0CA 3RFGA 2OVRB 4PBZA 3RLMD 4XEIC 2XE4A 2AQ5A 5EAMA 3SJLD 3EQ9A 5M5RA 3EI1A 3SWSD 4CY2A 4ZOVA 4BUJC 3ZDYA 3N0EA 1GOTB 2VDRA 2I0TA 3T3MA 3DXMC 2IUPA 4A09B 5JWZA 5KDOB 3BWSA 4PSWB 3ZE0A 3JROA 2I3TA 2VDOA 4MMXA 4O45A 3BG1A 3F3FA 3K71A 4PXWA 3UR4A 5K1CC 5I5IA 1PEVA 3IUMA 3RN1D 3RN0D 5TEFA 1TBGA 2EBSA 5SXMA 4UM8A 2H9MA 4NAAA 4BP9A 4L3GD 1K3IA 2JKXA 2VC2A 5FKTA 3CFSB 4G55A 2HJ4A 3IJEA 3SCYA 5TEEA 2Z2NA 4BH6A 2XL3A 3MZKA 1RI6A 1JJUB 4J0WA 3W15A 2EIDA 1Q47A 3MXXA 1XKSA 4BP8A 3EQ8A 2HU8A 2I3SA 3NVQA 4O9DA 4NSXA 5M61A 4A2MA 1B9YA 5CYKB 3U4YA 2IWKA 3FCSA 3DSMA 1O6FA 3F3PA 1R5MA 2XU7A 3SN6B 2QC5A 2YMUA 3EI3A 4DNWA 4JSVC 5AMSA 2J55H 1VZ3A 3F3GA 4J82A 5HDBA 4AEZA 4O02A 4U7AA 5GXHA 5H17A 1SQJA 3JZNA 4CI1A 3NIFA 4RE5A 1JMZB 4JXMA 1GG2B 3OTTA
chains in the Genus database with same CATH topology
1C9LA 3GC3B 4G55A 5M5TA 5M5VA 1C9IA 5M5SA 5M5UA 3GD1I 1BPOA 5M5RA 2XZGA 1UTCA 5M61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9L A;  3GC3 B;  4G55 A;  5M5T A;  5M5V A;  1C9I A;  5M5S A;  5M5U A;  3GD1 I;  1BPO A;  5M5R A;  2XZG A;  1UTC A;  5M61 A; 
#chains in the Genus database with same CATH topology
 1H2Y A;  4HDJ A;  1K8K C;  4L9O A;  3C99 A;  1JV2 A;  1QFM A;  2P9K C;  3UVN A;  3O4J A;  1GOF A;  3AL8 A;  2G9A A;  2PM9 B;  3L4M D;  4FAN D;  4A08 A;  4NEN A;  3I7L A;  1N6D A;  2AGL A;  3JPX A;  5HE1 B;  1GP2 B;  3MKS B;  1VYH C;  5A2Q g;  4BCD A;  3AL9 A;  4A0A A;  3N0D A;  3OL2 B;  4FA4 D;  4DNU A;  3SMR A;  4LG8 A;  4BCB A;  1FWX A;  3VI4 A;  4Z7Q A;  3JZG A;  1OLZ A;  5CXB B;  3KCI A;  3DWL C;  5FXY A;  2IAA A;  4RE6 A;  5EAR A;  3OW8 A;  1A12 A;  1MG2 A;  2UZX B;  3EI4 B;  4J77 A;  4UI9 R;  2AH1 A;  3UVM A;  4PBY A;  3BG0 A;  5M5S A;  2H3X A;  4J84 A;  1H2Z A;  2G99 A;  3CFV A;  5EML B;  2VDP A;  2VDQ A;  3V5W B;  1SHY B;  4FB1 D;  3IJ1 A;  1BPO A;  4ZOX A;  5IJ7 E;  2I0R A;  2PM7 B;  5EMJ B;  2AGZ A;  3SXT D;  3I8E A;  4AMZ A;  4O3T B;  4KFM B;  4CZV A;  4K3J B;  2IWF A;  1VE6 A;  2B4E A;  2OIZ A;  2PM9 A;  4ZOZ A;  1B9X A;  2GC4 A;  2YB8 B;  3FCU A;  3VGZ A;  4X3E A;  3SBR A;  3B7F A;  2HES X;  2W18 A;  3VA6 A;  3PE7 A;  4GGC A;  2H9L A;  5E6U A;  3QHY B;  5CXC B;  2BBK H;  4K3I D;  2P9S C;  1UTC A;  3SBQ A;  3K72 A;  4A08 B;  2QXV A;  2CO0 C;  3IUN A;  4ERQ A;  2P9U C;  2CE8 A;  2PBI B;  5C9Z B;  3EMH A;  1PI6 A;  3JRP A;  5TF2 A;  1N6F A;  3OKY A;  3P4F A;  3RMZ D;  5HE0 B;  2J57 G;  2PM6 B;  3AL8 B;  2IUV A;  4J78 A;  4WK4 A;  1VE7 A;  4QT8 A;  2XDW A;  5CXB A;  3SHF A;  5FFO A;  3IJ0 A;  4L1M A;  3EI2 B;  1H2X A;  1C9I A;  1JTD B;  3V7D B;  3ZDZ A;  4IA9 A;  5E6R A;  2OJY A;  3QI0 A;  3J81 g;  5FKQ A;  2HU5 A;  2EIC A;  4CY1 A;  2AGY A;  2HJB A;  3PSC B;  4ES0 A;  5B4W A;  3I7N A;  3AH8 B;  4GMB A;  2QR5 A;  4DNV A;  4FAV D;  2UZY B;  3KRW B;  4Y7R A;  1L0Q A;  4O3U B;  3PSL A;  3EU7 A;  4GQB B;  3UVO A;  4NC4 A;  4A11 B;  3IUQ A;  2XYI A;  5CYK A;  4PC0 A;  4CC9 A;  5EMM B;  4A09 A;  3KRX B;  2J56 H;  3A0F A;  4X63 B;  3ZE2 A;  2GNQ A;  3EQ7 A;  4G1E A;  4JSP C;  5H1M A;  4ZN4 A;  5IT9 g;  4J8B A;  5EAP A;  4NBM A;  3IUJ A;  4J73 A;  2VDL A;  4J79 A;  4A11 A;  2HU7 A;  2H9N A;  2P9L C;  5HYN B;  3AFC A;  3RFH A;  3OKY B;  3K26 A;  4GQ2 P;  4H5J A;  2B5N A;  4WK2 A;  1E8N A;  3JAM g;  5FQD A;  1E5T A;  4IRZ A;  3EG6 A;  4O1Q D;  4GGD A;  4FA9 D;  5H14 A;  4AMY A;  2CNX A;  3CIK B;  3MUO A;  4JSN C;  5CXC A;  3EI4 A;  3UKU C;  1PGU A;  4J0X A;  3EI2 A;  3V4V A;  2HKR A;  2AH0 A;  4L3H D;  4BL0 A;  2BCJ B;  5M5T A;  4JSX C;  5I5J A;  2OVQ B;  2EIB A;  2AGW A;  3ZWL B;  5E6S A;  4R7A B;  3UVK A;  2HKM A;  4GM3 A;  4H5I A;  4GGA A;  4U1E I;  3GRE A;  5AFU 3;  5EM2 A;  4XYI A;  2I0S A;  4D6V A;  1OMW B;  2H68 A;  4WJK A;  2BKL A;  5EAL A;  4G56 B;  1SQ9 A;  4Y5R D;  2XZG A;  4MMY A;  4I79 A;  5FKR A;  1PBY B;  3MKQ A;  2YNN A;  4ZOY A;  4YVD A;  2H47 A;  2IUQ A;  4O2W A;  4J81 A;  3OL2 A;  4CI2 A;  3ULE C;  4IMM A;  2XL2 A;  5THA A;  3EI1 B;  3ORV D;  1NEX B;  5IGQ A;  2H9P A;  3FGB A;  2H13 A;  4X60 B;  2H6K A;  4QAM A;  4A0A B;  3SBP A;  3I2N A;  3C9C A;  3IJC A;  2YNP A;  1U2V C;  2P9I C;  4AX4 A;  2YBA A;  4WK0 A;  5C2V B;  4GQ1 A;  3K6S A;  3UVL A;  3PXS D;  1TYE A;  4JHN A;  3FM0 A;  4AN1 A;  3C75 H;  1GXR A;  3SVW D;  5FKS A;  4A2L A;  3MZL A;  3IUL A;  2VDM A;  5AJA A;  4G1M A;  3O4H A;  4ESG A;  3V9F A;  4OZU A;  5TDH B;  3ZDX A;  1XHM A;  3ODT A;  1UOQ A;  1S4U X;  5GSA A;  3NVN A;  4JD2 C;  5C2W B;  3PXT D;  3IKO A;  5M5V A;  3DXK C;  1H2W A;  4GM8 A;  4FA1 D;  4Z7N A;  5M5U A;  3SFZ A;  4FA5 D;  2VDN A;  2EIE A;  4A7J A;  4CZX A;  3PXW D;  1QFS A;  3EWE A;  2OVP B;  1JMX B;  2OK6 A;  3GFC A;  1MG3 A;  1NR0 A;  5C92 A;  1TYQ C;  2TRC B;  2H6N A;  3RSE C;  2CN3 A;  4GM9 A;  1K32 A;  3OKT A;  2B5M A;  2CO0 A;  3PVW B;  4FWW A;  2Z2P A;  2P9P C;  3I7P A;  4A0B A;  3GC3 B;  4LG9 A;  5HE2 B;  3GD1 I;  4QL1 A;  3I7K A;  3MVD K;  1I2M B;  5GXI A;  4AOW A;  1VZ2 A;  1T2X A;  3JB9 L;  4OWR A;  4J8G A;  3SLE D;  2H6Q A;  5GMK n;  1JOF A;  2Q7Q A;  5FLX g;  3OKW A;  3VH0 A;  3MUN A;  4MMZ A;  3O4I A;  4L1Q D;  2CN2 A;  1U4C A;  4J86 A;  2IUR A;  3IVM A;  4GZ8 A;  1ERJ A;  4PNK B;  5FA5 B;  5FFG A;  3UKR C;  3VI3 A;  4D9S A;  2HXC A;  4XYH A;  4E54 A;  5I5M A;  3PVU B;  3IUR A;  2B5L A;  5HE3 B;  5IJ8 E;  4CY3 A;  2MTA H;  3MMY A;  4ERZ A;  2OK4 A;  2O9K A;  2Z2O A;  3K27 A;  4JT5 C;  4CZY A;  4JHP C;  4QQE A;  4PSX B;  4QRJ A;  3IIW A;  4CI8 A;  2YNO A;  1A0R B;  5IGO A;  4A0B B;  4UM9 A;  1MDA H;  3I89 A;  4TZ4 A;  5K19 A;  3DDU A;  2P9N C;  1YFQ A;  1O6G A;  4BCC A;  1GOH A;  1U8C A;  3DM0 A;  3RRM C;  1E8M A;  3L4O D;  3C5M A;  3HFQ A;  1QNI A;  1C9L A;  2VDK A;  5C86 A;  1YR2 A;  4EWR A;  2GC7 A;  1UOO A;  3I7H A;  1P22 A;  4FHL A;  4X61 B;  3I8C A;  2QZP A;  1UOP A;  3JZH A;  2CE9 A;  4Z8L A;  4CY5 A;  3IIY A;  5IC7 A;  3I7O A;  2WQ8 A;  1M1X A;  4AN0 A;  3FRX A;  2VZ1 A;  3OF7 A;  4E5Z A;  4CI3 A;  4E5Z B;  2HYE A;  3ZE1 A;  3J80 g;  5EM2 B;  1XIP A;  2H14 A;  3NID A;  3O4G A;  1N6E A;  3NVX A;  4LGN A;  4D0K A;  4J87 A;  3NIG A;  2VZ3 A;  2AGX A;  5EMK B;  4Z7O A;  1L5G A;  4N14 A;  3T3P A;  4ERY A;  4MK0 B;  4E54 B;  3V4P A;  5HQG A;  1GOG A;  3EI3 B;  4JT6 C;  3E0C A;  3RFG A;  2OVR B;  4PBZ A;  3RLM D;  4XEI C;  2XE4 A;  2AQ5 A;  5EAM A;  3SJL D;  3EQ9 A;  5M5R A;  3EI1 A;  3SWS D;  4CY2 A;  4ZOV A;  4BUJ C;  3ZDY A;  3N0E A;  1GOT B;  2VDR A;  2I0T A;  3T3M A;  3DXM C;  2IUP A;  4A09 B;  5JWZ A;  5KDO B;  3BWS A;  4PSW B;  3ZE0 A;  3JRO A;  2I3T A;  2VDO A;  4MMX A;  4O45 A;  3BG1 A;  3F3F A;  3K71 A;  4PXW A;  3UR4 A;  5K1C C;  5I5I A;  1PEV A;  3IUM A;  3RN1 D;  3RN0 D;  5TEF A;  1TBG A;  2EBS A;  5SXM A;  4UM8 A;  2H9M A;  4NAA A;  4BP9 A;  4L3G D;  1K3I A;  2JKX A;  2VC2 A;  5FKT A;  3CFS B;  4G55 A;  2HJ4 A;  3IJE A;  3SCY A;  5TEE A;  2Z2N A;  4BH6 A;  2XL3 A;  3MZK A;  1RI6 A;  1JJU B;  4J0W A;  3W15 A;  2EID A;  1Q47 A;  3MXX A;  1XKS A;  4BP8 A;  3EQ8 A;  2HU8 A;  2I3S A;  3NVQ A;  4O9D A;  4NSX A;  5M61 A;  4A2M A;  1B9Y A;  5CYK B;  3U4Y A;  2IWK A;  3FCS A;  3DSM A;  1O6F A;  3F3P A;  1R5M A;  2XU7 A;  3SN6 B;  2QC5 A;  2YMU A;  3EI3 A;  4DNW A;  4JSV C;  5AMS A;  2J55 H;  1VZ3 A;  3F3G A;  4J82 A;  5HDB A;  4AEZ A;  4O02 A;  4U7A A;  5GXH A;  5H17 A;  1SQJ A;  3JZN A;  4CI1 A;  3NIF A;  4RE5 A;  1JMZ B;  4JXM A;  1GG2 B;  3OTT A; 
#chains in the Genus database with same CATH homology
 1C9L A;  3GC3 B;  4G55 A;  5M5T A;  5M5V A;  1C9I A;  5M5S A;  5M5U A;  3GD1 I;  1BPO A;  5M5R A;  2XZG A;  1UTC A;  5M61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...