1UTCA

Clathrin terminal domain complexed with tlpwdlwtt
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
352
structure length
352
Chain Sequence
b'ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN HEAVY CHAIN
publication title Two distinct interaction motifs in amphiphysin bind two independent sites on the clathrin terminal domain beta-propeller.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 86
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1utcA00
3GD1I 5M5UA 5M5TA 3GC3B 5M5SA 1C9LA 1BPOA 4G55A 2XZGA 1UTCA 1C9IA 5M61A 5M5RA 5M5VA
chains in the Genus database with same CATH superfamily
5CXBA 2Z2NA 5CXBB 3UKRC 4GM3A 5C92A 3ZE1A 2OK6A 3AFCA 3K27A 1GOHA 4ESGA 4UM9A 1T2XA 5B4WA 3MVDK 5FKRA 3DSMA 4H5JA 2CE8A 2PBIB 4D9SA 2VDLA 3PSCB 2I0RA 1PBYB 1S4UX 1GOFA 2OVQB 2TRCB 3EG6A 3O4GA 3IIWA 3JPXA 3K6SA 4PSWB 3RN1D 5EM2B 3F3PA 4CY2A 3I8CA 2QC5A 5M5UA 4NAAA 3JB9L 5FLXg 2CO0C 5THAA 2VDKA 4FHLA 3U4YA 3UR4A 3SN6B 5FKSA 1H2ZA 2XL2A 1TYEA 3B7FA 4BH6A 4GM8A 2H14A 2IUPA 4U7AA 1SQJA 2GNQA 2OJYA 2VZ1A 3FM0A 3MUOA 4D0KA 3KCIA 3EMHA 4AN1A 4A2LA 5FFGA 3NIFA 4ERQA 4L3HD 4IA9A 4AMZA 5CYKA 1A12A 4RE5A 2H9LA 1H2YA 4Z7NA 3SMRA 2EIBA 2IAAA 4FA4D 5HE1B 2B5LA 5AMSA 3PVWB 4CZXA 2HU8A 1FWXA 4J86A 4BP8A 4BL0A 4MMYA 2XZGA 1SQ9A 4UI9R 3ZE2A 3ORVD 5FKQA 2AGZA 2HU5A 4NC4A 5FKTA 2H9NA 3OKWA 3SBQA 3SHFA 5HE3B 4Y5RD 3IUQA 4ES0A 5IJ7E 3IJ1A 4QAMA 2HKMA 3I7NA 2VZ3A 5H17A 3UVKA 3O4IA 3O4JA 1GG2B 4KFMB 3K72A 5E6RA 2H47A 2P9NC 3OKTA 3IKOA 2XU7A 4ZN4A 4QT8A 1XHMA 2H3XA 4WK2A 5K1CC 3VA6A 3IULA 1E8NA 1GP2B 4GQ1A 4L3GD 4X60B 4OZUA 2VDMA 3PXTD 4LG9A 3SLED 5EMMB 2PM9B 5E6SA 1GOGA 3K71A 2AGLA 3VI4A 3UVOA 3C99A 2PM6B 4XEIC 2EICA 2VDNA 3BG0A 5FA5B 2AGXA 4RE6A 4JSPC 3V4VA 3IUNA 4G55A 1N6EA 4A0AB 1E8MA 3L4MD 3SFZA 3OW8A 5IGOA 2I3TA 4AN0A 4A0BB 1OLZA 4ERZA 1PGUA 2YNNA 4E54A 1QFSA 4GGAA 2EIDA 1VZ2A 2IWFA 4BCBA 2HJBA 5EMKB 4CY3A 4MK0B 4ZOYA 4Y7RA 3A0FA 4GM9A 2P9UC 3SWSD 3PXSD 2YNOA 4LG8A 2AGYA 3C5MA 3CIKB 4J0WA 3OL2B 2WQ8A 3J81g 3SBRA 1U4CA 4GGDA 3L4OD 3JAMg 3I89A 3C75H 1C9LA 4JXMA 5HE0B 3ODTA 4E5ZB 5EM2A 4E5ZA 5EAMA 4QQEA 3O4HA 3NVXA 2HXCA 4UM8A 1MG2A 3AL8A 3AL8B 4CZVA 2HJ4A 3DXMC 3J80g 3RN0D 1M1XA 3EI4B 2H6KA 1B9XA 1H2WA 1XIPA 5GMKn 2P9KC 3RLMD 1B9YA 2OVRB 4JSVC 4PNKB 3I7KA 1L5GA 4O2WA 2XL3A 3UVLA 3ZDZA 1XKSA 5M5SA 3FGBA 2HYEA 3I2NA 1P22A 3PXWD 3GFCA 5TEFA 4CY5A 1VYHC 2Q7QA 5IJ8E 1UOPA 4J87A 1K8KC 1RI6A 4GQ2P 5HE2B 2EBSA 4JHPC 4X63B 3EWEA 4A09B 5IC7A 4A08B 2H68A 3EI1B 1YR2A 4DNWA 4CI1A 2BKLA 5TDHB 4O45A 3IUJA 3UVNA 3SJLD 2P9PC 4WK0A 2VC2A 2O9KA 1PEVA 4J78A 5K19A 2I0TA 1K3IA 4BCDA 5JWZA 3AH8B 2W18A 2B5NA 5E6UA 3IJCA 3RRMC 5HYNB 3ZDYA 3F3GA 4R7AB 2CE9A 4H5IA 4A7JA 5AFU3 1C9IA 4Z8LA 5M5RA 1JJUB 4PXWA 1VZ3A 4IRZA 4U1EI 2IUVA 1OMWB 2BBKH 3P4FA 3KRXB 4FA5D 3ZWLB 4NBMA 4QL1A 2AGWA 2PM9A 3GREA 4FAVD 4HDJA 3MKSB 2P9IC 3N0EA 2JKXA 1O6FA 2QR5A 3V4PA 4A11A 4A11B 1NR0A 4CC9A 1JMZB 1MDAH 3EI3A 3EI3B 3PE7A 1YFQA 3CFSB 1QNIA 5HDBA 3CFVA 5H14A 1I2MB 2QXVA 5I5JA 4G56B 4EWRA 2CNXA 2AH0A 3I7LA 5FFOA 4CZYA 4A0AA 2XE4A 4J81A 5GXHA 5CXCA 5CXCB 4MMXA 4AX4A 3QI0A 4JHNA 3JRPA 5EARA 5IT9g 5AJAA 3SCYA 4A0BA 1GXRA 3VH0A 4TZ4A 4DNVA 3E0CA 4K3JB 4YVDA 3UVMA 3VI3A 3NIDA 2H13A 4PBZA 4O9DA 2YBAA 2AH1A 5A2Qg 4DNUA 4QRJA 5EMJB 1H2XA 1E5TA 2G9AA 2OVPB 4O3UB 2XDWA 4CI3A 3IJEA 3K26A 4JSXC 2H9PA 1O6GA 3IUMA 3EQ8A 1UOOA 2Z2OA 2IURA 3OL2A 3I7HA 4FAND 3PVUB 5I5IA 3I7OA 3DM0A 4ZOZA 2QZPA 3JZHA 3V5WB 4X3EA 4GZ8A 5H1MA 1A0RB 5HQGA 2HESX 2J56H 2YMUA 4FA1D 4PSXB 4D6VA 3IIYA 5C86A 2VDQA 4AOWA 5I5MA 2IWKA 1GOTB 5GXIA 1TBGA 2MTAH 4L1MA 3T3MA 3VGZA 4XYIA 2B5MA 3C9CA 2Z2PA 2HU7A 3EI4A 2IUQA 3F3FA 4PC0A 4LGNA 3ZDXA 4ERYA 3N0DA 3NIGA 4O02A 5M61A 2CN2A 3OF7A 4G1EA 1L0QA 5C2WB 3MUNA 4GMBA 2B4EA 4I79A 2GC4A 2J55H 3UKUC 4CI8A 2XYIA 3FCUA 3I7PA 1TYQC 4J8BA 3MXXA 3JZNA 1N6DA 1UOQA 2OK4A 2EIEA 4O1QD 3EU7A 4J0XA 1ERJA 4Z7QA 5C9ZB 5SXMA 5M5VA 1VE6A 3RMZD 3MKQA 3EQ7A 4JD2C 4A09A 2CO0A 2VDRA 3JZGA 5C2VB 4A08A 3KRWB 3EI1A 4MMZA 5KDOB 2YB8B 4GGCA 4L1QD 2H6QA 3GD1I 5FXYA 5FQDA 3FCSA 3SXTD 4OWRA 5CYKB 3BG1A 5IGQA 1QFMA 3T3PA 3DDUA 3NVNA 4BUJC 2YNPA 3GC3B 3IVMA 1JOFA 1Q47A 1VE7A 4J77A 2BCJB 4K3ID 3OTTA 4JT5C 1U2VC 4X61B 4ZOXA 3EQ9A 3IJ0A 4IMMA 4FA9D 5TEEA 1PI6A 4N14A 2H6NA 1R5MA 3JROA 2VDPA 3OKYA 3OKYB 3W15A 3MMYA 4G1MA 3MZLA 4Z7OA 2I3SA 4AEZA 5M5TA 3PSLA 1SHYB 2GC7A 4PBYA 3MZKA 2H9MA 3RFGA 1NEXB 1N6FA 4ZOVA 3AL9A 4GQBB 4FWWA 4CY1A 4J8GA 4XYHA 2P9LC 3ULEC 4J84A 3EI2A 5EAPA 4WJKA 1K32A 4L9OA 4WK4A 3EI2B 3ZE0A 3V9FA 4J73A 4JT6C 3HFQA 2OIZA 5EMLB 2J57G 3I8EA 1JMXB 1U8CA 4CI2A 1JTDB 2AQ5A 4AMYA 3RSEC 4J79A 4BP9A 5GSAA 2UZXB 2PM7B 5EALA 3SVWD 2HKRA 3DWLC 1UTCA 3RFHA 4NSXA 1BPOA 2I0SA 1JV2A 4BCCA 2G99A 2P9SC 2VDOA 3NVQA 4O3TB 5TF2A 4JSNC 4A2MA 4FB1D 3V7DB 1MG3A 3BWSA 2CN3A 3IURA 4J82A 3FRXA 4NENA 3SBPA 4E54B 3DXKC 3QHYB 2UZYB
chains in the Genus database with same CATH topology
3GD1I 5M5UA 5M5TA 3GC3B 5M5SA 1C9LA 1BPOA 4G55A 2XZGA 1UTCA 1C9IA 5M61A 5M5RA 5M5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD1 I;  5M5U A;  5M5T A;  3GC3 B;  5M5S A;  1C9L A;  1BPO A;  4G55 A;  2XZG A;  1UTC A;  1C9I A;  5M61 A;  5M5R A;  5M5V A; 
#chains in the Genus database with same CATH topology
 5CXB A;  2Z2N A;  5CXB B;  3UKR C;  4GM3 A;  5C92 A;  3ZE1 A;  2OK6 A;  3AFC A;  3K27 A;  1GOH A;  4ESG A;  4UM9 A;  1T2X A;  5B4W A;  3MVD K;  5FKR A;  3DSM A;  4H5J A;  2CE8 A;  2PBI B;  4D9S A;  2VDL A;  3PSC B;  2I0R A;  1PBY B;  1S4U X;  1GOF A;  2OVQ B;  2TRC B;  3EG6 A;  3O4G A;  3IIW A;  3JPX A;  3K6S A;  4PSW B;  3RN1 D;  5EM2 B;  3F3P A;  4CY2 A;  3I8C A;  2QC5 A;  5M5U A;  4NAA A;  3JB9 L;  5FLX g;  2CO0 C;  5THA A;  2VDK A;  4FHL A;  3U4Y A;  3UR4 A;  3SN6 B;  5FKS A;  1H2Z A;  2XL2 A;  1TYE A;  3B7F A;  4BH6 A;  4GM8 A;  2H14 A;  2IUP A;  4U7A A;  1SQJ A;  2GNQ A;  2OJY A;  2VZ1 A;  3FM0 A;  3MUO A;  4D0K A;  3KCI A;  3EMH A;  4AN1 A;  4A2L A;  5FFG A;  3NIF A;  4ERQ A;  4L3H D;  4IA9 A;  4AMZ A;  5CYK A;  1A12 A;  4RE5 A;  2H9L A;  1H2Y A;  4Z7N A;  3SMR A;  2EIB A;  2IAA A;  4FA4 D;  5HE1 B;  2B5L A;  5AMS A;  3PVW B;  4CZX A;  2HU8 A;  1FWX A;  4J86 A;  4BP8 A;  4BL0 A;  4MMY A;  2XZG A;  1SQ9 A;  4UI9 R;  3ZE2 A;  3ORV D;  5FKQ A;  2AGZ A;  2HU5 A;  4NC4 A;  5FKT A;  2H9N A;  3OKW A;  3SBQ A;  3SHF A;  5HE3 B;  4Y5R D;  3IUQ A;  4ES0 A;  5IJ7 E;  3IJ1 A;  4QAM A;  2HKM A;  3I7N A;  2VZ3 A;  5H17 A;  3UVK A;  3O4I A;  3O4J A;  1GG2 B;  4KFM B;  3K72 A;  5E6R A;  2H47 A;  2P9N C;  3OKT A;  3IKO A;  2XU7 A;  4ZN4 A;  4QT8 A;  1XHM A;  2H3X A;  4WK2 A;  5K1C C;  3VA6 A;  3IUL A;  1E8N A;  1GP2 B;  4GQ1 A;  4L3G D;  4X60 B;  4OZU A;  2VDM A;  3PXT D;  4LG9 A;  3SLE D;  5EMM B;  2PM9 B;  5E6S A;  1GOG A;  3K71 A;  2AGL A;  3VI4 A;  3UVO A;  3C99 A;  2PM6 B;  4XEI C;  2EIC A;  2VDN A;  3BG0 A;  5FA5 B;  2AGX A;  4RE6 A;  4JSP C;  3V4V A;  3IUN A;  4G55 A;  1N6E A;  4A0A B;  1E8M A;  3L4M D;  3SFZ A;  3OW8 A;  5IGO A;  2I3T A;  4AN0 A;  4A0B B;  1OLZ A;  4ERZ A;  1PGU A;  2YNN A;  4E54 A;  1QFS A;  4GGA A;  2EID A;  1VZ2 A;  2IWF A;  4BCB A;  2HJB A;  5EMK B;  4CY3 A;  4MK0 B;  4ZOY A;  4Y7R A;  3A0F A;  4GM9 A;  2P9U C;  3SWS D;  3PXS D;  2YNO A;  4LG8 A;  2AGY A;  3C5M A;  3CIK B;  4J0W A;  3OL2 B;  2WQ8 A;  3J81 g;  3SBR A;  1U4C A;  4GGD A;  3L4O D;  3JAM g;  3I89 A;  3C75 H;  1C9L A;  4JXM A;  5HE0 B;  3ODT A;  4E5Z B;  5EM2 A;  4E5Z A;  5EAM A;  4QQE A;  3O4H A;  3NVX A;  2HXC A;  4UM8 A;  1MG2 A;  3AL8 A;  3AL8 B;  4CZV A;  2HJ4 A;  3DXM C;  3J80 g;  3RN0 D;  1M1X A;  3EI4 B;  2H6K A;  1B9X A;  1H2W A;  1XIP A;  5GMK n;  2P9K C;  3RLM D;  1B9Y A;  2OVR B;  4JSV C;  4PNK B;  3I7K A;  1L5G A;  4O2W A;  2XL3 A;  3UVL A;  3ZDZ A;  1XKS A;  5M5S A;  3FGB A;  2HYE A;  3I2N A;  1P22 A;  3PXW D;  3GFC A;  5TEF A;  4CY5 A;  1VYH C;  2Q7Q A;  5IJ8 E;  1UOP A;  4J87 A;  1K8K C;  1RI6 A;  4GQ2 P;  5HE2 B;  2EBS A;  4JHP C;  4X63 B;  3EWE A;  4A09 B;  5IC7 A;  4A08 B;  2H68 A;  3EI1 B;  1YR2 A;  4DNW A;  4CI1 A;  2BKL A;  5TDH B;  4O45 A;  3IUJ A;  3UVN A;  3SJL D;  2P9P C;  4WK0 A;  2VC2 A;  2O9K A;  1PEV A;  4J78 A;  5K19 A;  2I0T A;  1K3I A;  4BCD A;  5JWZ A;  3AH8 B;  2W18 A;  2B5N A;  5E6U A;  3IJC A;  3RRM C;  5HYN B;  3ZDY A;  3F3G A;  4R7A B;  2CE9 A;  4H5I A;  4A7J A;  5AFU 3;  1C9I A;  4Z8L A;  5M5R A;  1JJU B;  4PXW A;  1VZ3 A;  4IRZ A;  4U1E I;  2IUV A;  1OMW B;  2BBK H;  3P4F A;  3KRX B;  4FA5 D;  3ZWL B;  4NBM A;  4QL1 A;  2AGW A;  2PM9 A;  3GRE A;  4FAV D;  4HDJ A;  3MKS B;  2P9I C;  3N0E A;  2JKX A;  1O6F A;  2QR5 A;  3V4P A;  4A11 A;  4A11 B;  1NR0 A;  4CC9 A;  1JMZ B;  1MDA H;  3EI3 A;  3EI3 B;  3PE7 A;  1YFQ A;  3CFS B;  1QNI A;  5HDB A;  3CFV A;  5H14 A;  1I2M B;  2QXV A;  5I5J A;  4G56 B;  4EWR A;  2CNX A;  2AH0 A;  3I7L A;  5FFO A;  4CZY A;  4A0A A;  2XE4 A;  4J81 A;  5GXH A;  5CXC A;  5CXC B;  4MMX A;  4AX4 A;  3QI0 A;  4JHN A;  3JRP A;  5EAR A;  5IT9 g;  5AJA A;  3SCY A;  4A0B A;  1GXR A;  3VH0 A;  4TZ4 A;  4DNV A;  3E0C A;  4K3J B;  4YVD A;  3UVM A;  3VI3 A;  3NID A;  2H13 A;  4PBZ A;  4O9D A;  2YBA A;  2AH1 A;  5A2Q g;  4DNU A;  4QRJ A;  5EMJ B;  1H2X A;  1E5T A;  2G9A A;  2OVP B;  4O3U B;  2XDW A;  4CI3 A;  3IJE A;  3K26 A;  4JSX C;  2H9P A;  1O6G A;  3IUM A;  3EQ8 A;  1UOO A;  2Z2O A;  2IUR A;  3OL2 A;  3I7H A;  4FAN D;  3PVU B;  5I5I A;  3I7O A;  3DM0 A;  4ZOZ A;  2QZP A;  3JZH A;  3V5W B;  4X3E A;  4GZ8 A;  5H1M A;  1A0R B;  5HQG A;  2HES X;  2J56 H;  2YMU A;  4FA1 D;  4PSX B;  4D6V A;  3IIY A;  5C86 A;  2VDQ A;  4AOW A;  5I5M A;  2IWK A;  1GOT B;  5GXI A;  1TBG A;  2MTA H;  4L1M A;  3T3M A;  3VGZ A;  4XYI A;  2B5M A;  3C9C A;  2Z2P A;  2HU7 A;  3EI4 A;  2IUQ A;  3F3F A;  4PC0 A;  4LGN A;  3ZDX A;  4ERY A;  3N0D A;  3NIG A;  4O02 A;  5M61 A;  2CN2 A;  3OF7 A;  4G1E A;  1L0Q A;  5C2W B;  3MUN A;  4GMB A;  2B4E A;  4I79 A;  2GC4 A;  2J55 H;  3UKU C;  4CI8 A;  2XYI A;  3FCU A;  3I7P A;  1TYQ C;  4J8B A;  3MXX A;  3JZN A;  1N6D A;  1UOQ A;  2OK4 A;  2EIE A;  4O1Q D;  3EU7 A;  4J0X A;  1ERJ A;  4Z7Q A;  5C9Z B;  5SXM A;  5M5V A;  1VE6 A;  3RMZ D;  3MKQ A;  3EQ7 A;  4JD2 C;  4A09 A;  2CO0 A;  2VDR A;  3JZG A;  5C2V B;  4A08 A;  3KRW B;  3EI1 A;  4MMZ A;  5KDO B;  2YB8 B;  4GGC A;  4L1Q D;  2H6Q A;  3GD1 I;  5FXY A;  5FQD A;  3FCS A;  3SXT D;  4OWR A;  5CYK B;  3BG1 A;  5IGQ A;  1QFM A;  3T3P A;  3DDU A;  3NVN A;  4BUJ C;  2YNP A;  3GC3 B;  3IVM A;  1JOF A;  1Q47 A;  1VE7 A;  4J77 A;  2BCJ B;  4K3I D;  3OTT A;  4JT5 C;  1U2V C;  4X61 B;  4ZOX A;  3EQ9 A;  3IJ0 A;  4IMM A;  4FA9 D;  5TEE A;  1PI6 A;  4N14 A;  2H6N A;  1R5M A;  3JRO A;  2VDP A;  3OKY A;  3OKY B;  3W15 A;  3MMY A;  4G1M A;  3MZL A;  4Z7O A;  2I3S A;  4AEZ A;  5M5T A;  3PSL A;  1SHY B;  2GC7 A;  4PBY A;  3MZK A;  2H9M A;  3RFG A;  1NEX B;  1N6F A;  4ZOV A;  3AL9 A;  4GQB B;  4FWW A;  4CY1 A;  4J8G A;  4XYH A;  2P9L C;  3ULE C;  4J84 A;  3EI2 A;  5EAP A;  4WJK A;  1K32 A;  4L9O A;  4WK4 A;  3EI2 B;  3ZE0 A;  3V9F A;  4J73 A;  4JT6 C;  3HFQ A;  2OIZ A;  5EML B;  2J57 G;  3I8E A;  1JMX B;  1U8C A;  4CI2 A;  1JTD B;  2AQ5 A;  4AMY A;  3RSE C;  4J79 A;  4BP9 A;  5GSA A;  2UZX B;  2PM7 B;  5EAL A;  3SVW D;  2HKR A;  3DWL C;  1UTC A;  3RFH A;  4NSX A;  1BPO A;  2I0S A;  1JV2 A;  4BCC A;  2G99 A;  2P9S C;  2VDO A;  3NVQ A;  4O3T B;  5TF2 A;  4JSN C;  4A2M A;  4FB1 D;  3V7D B;  1MG3 A;  3BWS A;  2CN3 A;  3IUR A;  4J82 A;  3FRX A;  4NEN A;  3SBP A;  4E54 B;  3DXK C;  3QHY B;  2UZY B; 
#chains in the Genus database with same CATH homology
 3GD1 I;  5M5U A;  5M5T A;  3GC3 B;  5M5S A;  1C9L A;  1BPO A;  4G55 A;  2XZG A;  1UTC A;  1C9I A;  5M61 A;  5M5R A;  5M5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...