1UTCA

Clathrin terminal domain complexed with tlpwdlwtt
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
352
structure length
352
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN HEAVY CHAIN
publication title Two distinct interaction motifs in amphiphysin bind two independent sites on the clathrin terminal domain beta-propeller.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 86
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1utcA00
5M5UA 3GD1I 4G55A 5M5TA 5M5VA 5M5RA 2XZGA 5M5SA 1C9LA 3GC3B 1UTCA 1C9IA 5M61A 1BPOA
chains in the Genus database with same CATH superfamily
4BP9A 2J57G 4KFMB 3B7FA 1K8KC 3EI2B 3MZKA 2VDPA 5HYNB 4CY3A 1K32A 5EMKB 4FAND 4J86A 1VZ3A 4Y7RA 4J0WA 3T3PA 3J80g 5IJ8E 3EG6A 3ZE0A 3GD1I 5THAA 2HJBA 3F3FA 4OWRA 5IC7A 1M1XA 5HDBA 3DSMA 5C86A 2P9SC 3JPXA 5EMLB 2IUQA 3IUNA 2BCJB 5AMSA 4LG9A 5TEEA 4A09B 3SCYA 1QFMA 5H1MA 2P9PC 3RFHA 4A2LA 3JZGA 1PBYB 2EIEA 5HE1B 4FA9D 2AQ5A 1QNIA 2VZ1A 3QI0A 5HE3B 4YVDA 1E5TA 2HKRA 2B5NA 4ES0A 2PM9B 1OMWB 4CY2A 4JSPC 2HYEA 3C5MA 4PSWB 5M5SA 3DXKC 4I79A 4MMXA 5FLXg 1BPOA 4A08B 1H2WA 3UVKA 3A0FA 2B5MA 2OIZA 2O9KA 5GXHA 3EU7A 3CFVA 3NVXA 2H47A 2P9UC 2H3XA 4OZUA 3C99A 3ZWLB 4O2WA 4BCBA 3OKWA 2AGLA 3MKSB 3UR4A 5HE0B 3AH8B 4L3GD 4AX4A 2HKMA 5CXBA 2B4EA 1QFSA 1MG3A 3MXXA 1SHYB 5K1CC 4GZ8A 4FWWA 4PBZA 4QQEA 2TRCB 4GQ1A 5EALA 4AEZA 1OLZA 3CFSB 3IIWA 4WJKA 3ZDZA 3SN6B 3V7DB 2YMUA 3GFCA 3FM0A 4PXWA 2AGYA 3I7PA 4DNVA 4J84A 2XL2A 3EWEA 5CXCA 2I0RA 3RLMD 2YBAA 2OK6A 4GQBB 4O9DA 2CE9A 3SBQA 2VZ3A 3IIYA 3O4JA 2P9NC 5AJAA 2IUVA 2HESX 4A11A 3DWLC 3PE7A 2YNOA 5E6UA 3VGZA 4IA9A 4ZOZA 4J82A 3IJ0A 4QRJA 1UTCA 4O45A 3JAMg 3SXTD 3JB9L 4X3EA 1VZ2A 5E6RA 5A2Qg 2HU7A 4J73A 3L4OD 3T3MA 3OL2A 3FCSA 4QL1A 3IURA 2I3SA 4E5ZA 3VA6A 3UVLA 4U1EI 3BG1A 2CNXA 4IRZA 1UOOA 4NAAA 4RE6A 4D0KA 3EI4B 5CYKA 5FKSA 5C92A 3ZE1A 5HE2B 3V4VA 4CZYA 5FKTA 4E54B 3RSEC 1TBGA 5M5UA 2CN3A 4CI1A 3KRXB 4O3TB 5C2WB 3PXWD 3ORVD 4J77A 3O4IA 3UKUC 4UM9A 3OKYA 5EM2B 3PVWB 4IMMA 1UOPA 2OK4A 4N14A 2IWKA 3F3PA 1E8MA 1U4CA 2VC2A 3MKQA 3N0DA 4PBYA 5FFGA 3BG0A 1U8CA 2AGZA 3PSLA 3RFGA 3I7KA 3PXTD 2XZGA 2OVRB 4FAVD 2UZXB 4BH6A 4H5IA 1JJUB 3ZDXA 3U4YA 3ULEC 3AL8A 3KRWB 3F3GA 3SBRA 2UZYB 5FFOA 3EI1B 3IKOA 2YB8B 1B9XA 4ERYA 4J8GA 4K3JB 3PSCB 4A0BA 3I7OA 2H9LA 1TYEA 5B4WA 3I8EA 3L4MD 4Y5RD 4ZOXA 3ZDYA 1FWXA 2G9AA 4QT8A 4JT5C 4J79A 4A0AA 1RI6A 5GSAA 4Z8LA 2XDWA 2PM7B 4JHPC 2CO0A 4BL0A 1SQJA 3NVQA 1YFQA 2HU8A 3O4GA 4AMZA 2AGXA 3I89A 4ESGA 4CI3A 3IJEA 1O6GA 3I2NA 1VE6A 5C9ZB 5M5VA 2OJYA 3PXSD 2Z2PA 3GREA 3UVNA 5JWZA 5I5MA 1A12A 4GM9A 3CIKB 2IURA 3JZNA 5K19A 2I0TA 2MTAH 5IGOA 4CY5A 4BP8A 2YNPA 3P4FA 4ZN4A 3SFZA 5EMMB 3RRMC 2Q7QA 4WK0A 3OKYB 4J87A 4G1MA 5E6SA 3EI3A 3MVDK 4AN0A 4NBMA 2PM6B 3EQ9A 4CZVA 3OTTA 3PVUB 3RMZD 4BCCA 4G55A 3EI2A 2VDOA 1H2YA 4MMYA 2Z2NA 2H9PA 2VDLA 3JROA 3JZHA 4PC0A 3VI3A 3K6SA 4TZ4A 3EQ7A 5EAPA 3VH0A 4AOWA 4BUJC 3SHFA 3UVMA 4X60B 2GC7A 2OVPB 3NIDA 3SBPA 4Z7NA 4FA1D 3J81g 4X61B 4AN1A 2QZPA 4A09A 3FCUA 3W15A 1Q47A 4G56B 4CZXA 2VDNA 2XL3A 3BWSA 2J56H 4AMYA 1L0QA 4LG8A 4ERQA 1JMXB 4RE5A 1MG2A 2PBIB 4LGNA 4DNUA 2PM9A 1P22A 1TYQC 2AH0A 1S4UX 2OVQB 3MUOA 2QC5A 2HXCA 4GGAA 5TDHB 4ERZA 4A08A 3I7NA 4U7AA 3K27A 4XYIA 3NIGA 1PI6A 4ZOYA 5KDOB 2CE8A 3IULA 5CXBB 2AH1A 2EICA 4CI2A 3DM0A 1SQ9A 2H6KA 1K3IA 1E8NA 4L1MA 3ODTA 1PEVA 2J55H 4PNKB 4J8BA 4UM8A 3K26A 2H9NA 3SWSD 2I3TA 3I8CA 3IUJA 2IUPA 4EWRA 2GNQA 5FA5B 2YNNA 4Z7OA 4O1QD 4L9OA 2EBSA 1VE7A 5CXCB 1YR2A 3SLED 1C9IA 4GQ2P 1VYHC 5IGQA 1R5MA 4NSXA 3RN0D 1GOTB 3K72A 3OW8A 5IT9g 1GXRA 4A11B 4O3UB 4JD2C 2EIDA 3V4PA 5EAMA 5I5JA 5GXIA 4GGCA 2Z2OA 5FQDA 2XU7A 5HQGA 3SMRA 1N6FA 4D9SA 4FHLA 4MMZA 4PSXB 2P9KC 2VDQA 4JT6C 3RN1D 1ERJA 3OL2B 5AFU3 1T2XA 1A0RB 5GMKn 4XEIC 4E5ZB 3C75H 4CY1A 4JHNA 1N6DA 1H2XA 5TEFA 3AFCA 3N0EA 1B9YA 4GM3A 1NEXB 4D6VA 1H2ZA 1UOQA 4CC9A 5CYKB 2HU5A 2JKXA 2H6NA 4FA5D 2QXVA 1GOFA 3OF7A 4J0XA 3FGBA 3EI4A 1JMZB 3MUNA 4H5JA 3I7LA 4JSNC 5M5TA 4CI8A 4J78A 3IJCA 5H17A 4E54A 3IJ1A 5I5IA 2B5LA 5FKRA 2CN2A 2P9IC 3EQ8A 4JSVC 4O02A 4X63B 3ZE2A 1NR0A 1GOGA 5FKQA 3UKRC 4WK2A 2I0SA 4UI9R 2VDMA 1L5GA 3NIFA 3QHYB 4QAMA 4GGDA 5EM2A 4NC4A 2XE4A 3IVMA 4A7JA 5EARA 4K3ID 2CO0C 2H6QA 1JV2A 4XYHA 3C9CA 3KCIA 3AL8B 4FB1D 2W18A 3MMYA 4DNWA 4A2MA 2QR5A 3VI4A 1C9LA 2H13A 1N6EA 4G1EA 3O4HA 4A0BB 2IAAA 4JSXC 5H14A 1I2MB 3IUMA 2H68A 3OKTA 4J81A 3EI1A 4L1QD 2VDKA 3DXMC 2XYIA 4A0AB 3K71A 2AGWA 3GC3B 5M61A 4GM8A 3JRPA 4GMBA 3EMHA 5C2VB 3HFQA 3SJLD 1GP2B 1GG2B 4JXMA 3MZLA 4HDJA 4L3HD 3E0CA 1XIPA 2GC4A 2IWFA 1JTDB 2HJ4A 1GOHA 2P9LC 4Z7QA 1PGUA 4R7AB 5M5RA 1XHMA 4NENA 3DDUA 5SXMA 2H14A 2G99A 4ZOVA 3FRXA 5TF2A 4BCDA 3NVNA 3I7HA 1O6FA 3UVOA 5FXYA 2EIBA 1U2VC 2WQ8A 3SVWD 2BKLA 2H9MA 2VDRA 1JOFA 5IJ7E 2BBKH 3EI3B 4MK0B 5EMJB 3V9FA 4FA4D 1XKSA 3IUQA 3AL9A 1MDAH 4WK4A 3V5WB
chains in the Genus database with same CATH topology
5M5UA 3GD1I 4G55A 5M5TA 5M5VA 5M5RA 2XZGA 5M5SA 1C9LA 3GC3B 1UTCA 1C9IA 5M61A 1BPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5U A;  3GD1 I;  4G55 A;  5M5T A;  5M5V A;  5M5R A;  2XZG A;  5M5S A;  1C9L A;  3GC3 B;  1UTC A;  1C9I A;  5M61 A;  1BPO A; 
#chains in the Genus database with same CATH topology
 4BP9 A;  2J57 G;  4KFM B;  3B7F A;  1K8K C;  3EI2 B;  3MZK A;  2VDP A;  5HYN B;  4CY3 A;  1K32 A;  5EMK B;  4FAN D;  4J86 A;  1VZ3 A;  4Y7R A;  4J0W A;  3T3P A;  3J80 g;  5IJ8 E;  3EG6 A;  3ZE0 A;  3GD1 I;  5THA A;  2HJB A;  3F3F A;  4OWR A;  5IC7 A;  1M1X A;  5HDB A;  3DSM A;  5C86 A;  2P9S C;  3JPX A;  5EML B;  2IUQ A;  3IUN A;  2BCJ B;  5AMS A;  4LG9 A;  5TEE A;  4A09 B;  3SCY A;  1QFM A;  5H1M A;  2P9P C;  3RFH A;  4A2L A;  3JZG A;  1PBY B;  2EIE A;  5HE1 B;  4FA9 D;  2AQ5 A;  1QNI A;  2VZ1 A;  3QI0 A;  5HE3 B;  4YVD A;  1E5T A;  2HKR A;  2B5N A;  4ES0 A;  2PM9 B;  1OMW B;  4CY2 A;  4JSP C;  2HYE A;  3C5M A;  4PSW B;  5M5S A;  3DXK C;  4I79 A;  4MMX A;  5FLX g;  1BPO A;  4A08 B;  1H2W A;  3UVK A;  3A0F A;  2B5M A;  2OIZ A;  2O9K A;  5GXH A;  3EU7 A;  3CFV A;  3NVX A;  2H47 A;  2P9U C;  2H3X A;  4OZU A;  3C99 A;  3ZWL B;  4O2W A;  4BCB A;  3OKW A;  2AGL A;  3MKS B;  3UR4 A;  5HE0 B;  3AH8 B;  4L3G D;  4AX4 A;  2HKM A;  5CXB A;  2B4E A;  1QFS A;  1MG3 A;  3MXX A;  1SHY B;  5K1C C;  4GZ8 A;  4FWW A;  4PBZ A;  4QQE A;  2TRC B;  4GQ1 A;  5EAL A;  4AEZ A;  1OLZ A;  3CFS B;  3IIW A;  4WJK A;  3ZDZ A;  3SN6 B;  3V7D B;  2YMU A;  3GFC A;  3FM0 A;  4PXW A;  2AGY A;  3I7P A;  4DNV A;  4J84 A;  2XL2 A;  3EWE A;  5CXC A;  2I0R A;  3RLM D;  2YBA A;  2OK6 A;  4GQB B;  4O9D A;  2CE9 A;  3SBQ A;  2VZ3 A;  3IIY A;  3O4J A;  2P9N C;  5AJA A;  2IUV A;  2HES X;  4A11 A;  3DWL C;  3PE7 A;  2YNO A;  5E6U A;  3VGZ A;  4IA9 A;  4ZOZ A;  4J82 A;  3IJ0 A;  4QRJ A;  1UTC A;  4O45 A;  3JAM g;  3SXT D;  3JB9 L;  4X3E A;  1VZ2 A;  5E6R A;  5A2Q g;  2HU7 A;  4J73 A;  3L4O D;  3T3M A;  3OL2 A;  3FCS A;  4QL1 A;  3IUR A;  2I3S A;  4E5Z A;  3VA6 A;  3UVL A;  4U1E I;  3BG1 A;  2CNX A;  4IRZ A;  1UOO A;  4NAA A;  4RE6 A;  4D0K A;  3EI4 B;  5CYK A;  5FKS A;  5C92 A;  3ZE1 A;  5HE2 B;  3V4V A;  4CZY A;  5FKT A;  4E54 B;  3RSE C;  1TBG A;  5M5U A;  2CN3 A;  4CI1 A;  3KRX B;  4O3T B;  5C2W B;  3PXW D;  3ORV D;  4J77 A;  3O4I A;  3UKU C;  4UM9 A;  3OKY A;  5EM2 B;  3PVW B;  4IMM A;  1UOP A;  2OK4 A;  4N14 A;  2IWK A;  3F3P A;  1E8M A;  1U4C A;  2VC2 A;  3MKQ A;  3N0D A;  4PBY A;  5FFG A;  3BG0 A;  1U8C A;  2AGZ A;  3PSL A;  3RFG A;  3I7K A;  3PXT D;  2XZG A;  2OVR B;  4FAV D;  2UZX B;  4BH6 A;  4H5I A;  1JJU B;  3ZDX A;  3U4Y A;  3ULE C;  3AL8 A;  3KRW B;  3F3G A;  3SBR A;  2UZY B;  5FFO A;  3EI1 B;  3IKO A;  2YB8 B;  1B9X A;  4ERY A;  4J8G A;  4K3J B;  3PSC B;  4A0B A;  3I7O A;  2H9L A;  1TYE A;  5B4W A;  3I8E A;  3L4M D;  4Y5R D;  4ZOX A;  3ZDY A;  1FWX A;  2G9A A;  4QT8 A;  4JT5 C;  4J79 A;  4A0A A;  1RI6 A;  5GSA A;  4Z8L A;  2XDW A;  2PM7 B;  4JHP C;  2CO0 A;  4BL0 A;  1SQJ A;  3NVQ A;  1YFQ A;  2HU8 A;  3O4G A;  4AMZ A;  2AGX A;  3I89 A;  4ESG A;  4CI3 A;  3IJE A;  1O6G A;  3I2N A;  1VE6 A;  5C9Z B;  5M5V A;  2OJY A;  3PXS D;  2Z2P A;  3GRE A;  3UVN A;  5JWZ A;  5I5M A;  1A12 A;  4GM9 A;  3CIK B;  2IUR A;  3JZN A;  5K19 A;  2I0T A;  2MTA H;  5IGO A;  4CY5 A;  4BP8 A;  2YNP A;  3P4F A;  4ZN4 A;  3SFZ A;  5EMM B;  3RRM C;  2Q7Q A;  4WK0 A;  3OKY B;  4J87 A;  4G1M A;  5E6S A;  3EI3 A;  3MVD K;  4AN0 A;  4NBM A;  2PM6 B;  3EQ9 A;  4CZV A;  3OTT A;  3PVU B;  3RMZ D;  4BCC A;  4G55 A;  3EI2 A;  2VDO A;  1H2Y A;  4MMY A;  2Z2N A;  2H9P A;  2VDL A;  3JRO A;  3JZH A;  4PC0 A;  3VI3 A;  3K6S A;  4TZ4 A;  3EQ7 A;  5EAP A;  3VH0 A;  4AOW A;  4BUJ C;  3SHF A;  3UVM A;  4X60 B;  2GC7 A;  2OVP B;  3NID A;  3SBP A;  4Z7N A;  4FA1 D;  3J81 g;  4X61 B;  4AN1 A;  2QZP A;  4A09 A;  3FCU A;  3W15 A;  1Q47 A;  4G56 B;  4CZX A;  2VDN A;  2XL3 A;  3BWS A;  2J56 H;  4AMY A;  1L0Q A;  4LG8 A;  4ERQ A;  1JMX B;  4RE5 A;  1MG2 A;  2PBI B;  4LGN A;  4DNU A;  2PM9 A;  1P22 A;  1TYQ C;  2AH0 A;  1S4U X;  2OVQ B;  3MUO A;  2QC5 A;  2HXC A;  4GGA A;  5TDH B;  4ERZ A;  4A08 A;  3I7N A;  4U7A A;  3K27 A;  4XYI A;  3NIG A;  1PI6 A;  4ZOY A;  5KDO B;  2CE8 A;  3IUL A;  5CXB B;  2AH1 A;  2EIC A;  4CI2 A;  3DM0 A;  1SQ9 A;  2H6K A;  1K3I A;  1E8N A;  4L1M A;  3ODT A;  1PEV A;  2J55 H;  4PNK B;  4J8B A;  4UM8 A;  3K26 A;  2H9N A;  3SWS D;  2I3T A;  3I8C A;  3IUJ A;  2IUP A;  4EWR A;  2GNQ A;  5FA5 B;  2YNN A;  4Z7O A;  4O1Q D;  4L9O A;  2EBS A;  1VE7 A;  5CXC B;  1YR2 A;  3SLE D;  1C9I A;  4GQ2 P;  1VYH C;  5IGQ A;  1R5M A;  4NSX A;  3RN0 D;  1GOT B;  3K72 A;  3OW8 A;  5IT9 g;  1GXR A;  4A11 B;  4O3U B;  4JD2 C;  2EID A;  3V4P A;  5EAM A;  5I5J A;  5GXI A;  4GGC A;  2Z2O A;  5FQD A;  2XU7 A;  5HQG A;  3SMR A;  1N6F A;  4D9S A;  4FHL A;  4MMZ A;  4PSX B;  2P9K C;  2VDQ A;  4JT6 C;  3RN1 D;  1ERJ A;  3OL2 B;  5AFU 3;  1T2X A;  1A0R B;  5GMK n;  4XEI C;  4E5Z B;  3C75 H;  4CY1 A;  4JHN A;  1N6D A;  1H2X A;  5TEF A;  3AFC A;  3N0E A;  1B9Y A;  4GM3 A;  1NEX B;  4D6V A;  1H2Z A;  1UOQ A;  4CC9 A;  5CYK B;  2HU5 A;  2JKX A;  2H6N A;  4FA5 D;  2QXV A;  1GOF A;  3OF7 A;  4J0X A;  3FGB A;  3EI4 A;  1JMZ B;  3MUN A;  4H5J A;  3I7L A;  4JSN C;  5M5T A;  4CI8 A;  4J78 A;  3IJC A;  5H17 A;  4E54 A;  3IJ1 A;  5I5I A;  2B5L A;  5FKR A;  2CN2 A;  2P9I C;  3EQ8 A;  4JSV C;  4O02 A;  4X63 B;  3ZE2 A;  1NR0 A;  1GOG A;  5FKQ A;  3UKR C;  4WK2 A;  2I0S A;  4UI9 R;  2VDM A;  1L5G A;  3NIF A;  3QHY B;  4QAM A;  4GGD A;  5EM2 A;  4NC4 A;  2XE4 A;  3IVM A;  4A7J A;  5EAR A;  4K3I D;  2CO0 C;  2H6Q A;  1JV2 A;  4XYH A;  3C9C A;  3KCI A;  3AL8 B;  4FB1 D;  2W18 A;  3MMY A;  4DNW A;  4A2M A;  2QR5 A;  3VI4 A;  1C9L A;  2H13 A;  1N6E A;  4G1E A;  3O4H A;  4A0B B;  2IAA A;  4JSX C;  5H14 A;  1I2M B;  3IUM A;  2H68 A;  3OKT A;  4J81 A;  3EI1 A;  4L1Q D;  2VDK A;  3DXM C;  2XYI A;  4A0A B;  3K71 A;  2AGW A;  3GC3 B;  5M61 A;  4GM8 A;  3JRP A;  4GMB A;  3EMH A;  5C2V B;  3HFQ A;  3SJL D;  1GP2 B;  1GG2 B;  4JXM A;  3MZL A;  4HDJ A;  4L3H D;  3E0C A;  1XIP A;  2GC4 A;  2IWF A;  1JTD B;  2HJ4 A;  1GOH A;  2P9L C;  4Z7Q A;  1PGU A;  4R7A B;  5M5R A;  1XHM A;  4NEN A;  3DDU A;  5SXM A;  2H14 A;  2G99 A;  4ZOV A;  3FRX A;  5TF2 A;  4BCD A;  3NVN A;  3I7H A;  1O6F A;  3UVO A;  5FXY A;  2EIB A;  1U2V C;  2WQ8 A;  3SVW D;  2BKL A;  2H9M A;  2VDR A;  1JOF A;  5IJ7 E;  2BBK H;  3EI3 B;  4MK0 B;  5EMJ B;  3V9F A;  4FA4 D;  1XKS A;  3IUQ A;  3AL9 A;  1MDA H;  4WK4 A;  3V5W B; 
#chains in the Genus database with same CATH homology
 5M5U A;  3GD1 I;  4G55 A;  5M5T A;  5M5V A;  5M5R A;  2XZG A;  5M5S A;  1C9L A;  3GC3 B;  1UTC A;  1C9I A;  5M61 A;  1BPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...