1UTCA

Clathrin terminal domain complexed with tlpwdlwtt
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
352
structure length
352
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN HEAVY CHAIN
publication title Two distinct interaction motifs in amphiphysin bind two independent sites on the clathrin terminal domain beta-propeller.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 86
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1utcA00
3GC3B 2XZGA 5M5VA 5M5UA 4G55A 5M5SA 1C9LA 5M61A 1BPOA 5M5TA 5M5RA 1C9IA 3GD1I 1UTCA
chains in the Genus database with same CATH superfamily
3MKSB 4IA9A 3NIFA 2IUPA 3OL2A 3EI3A 4A2LA 4NENA 4FWWA 4X63B 4E5ZA 3RN0D 3IULA 3IUJA 2EIEA 1B9XA 3E0CA 4J73A 3ZE2A 2BKLA 4J82A 5TF2A 5I5MA 1I2MB 1K3IA 3PXWD 4Y7RA 5TDHB 3O4GA 4GGAA 3V9FA 4E5ZB 4JXMA 4AX4A 1YFQA 1N6DA 3SBQA 4AN1A 5C2VB 4ERQA 2I0SA 2QZPA 5TEEA 3AL8B 3CFSB 5CXBA 2GC7A 2QR5A 4ZOYA 3UVNA 1OLZA 1VE7A 1R5MA 1M1XA 4QL1A 4LG8A 5AMSA 4CC9A 2B5NA 2VC2A 1H2WA 3JZHA 4GMBA 3IJ0A 2GC4A 5TEFA 5HE1B 3ORVD 1GOTB 4MMZA 4JSPC 4WJKA 4A09A 5FFOA 3FRXA 5FFGA 2B4EA 1Q47A 1GOFA 1JMZB 1N6FA 1JJUB 3KRWB 5HE0B 3VGZA 1XKSA 2H9LA 4ERZA 2IURA 3OKTA 1UOQA 1GOHA 2PM7B 4J81A 2H47A 4Z8LA 2IAAA 3SCYA 4K3ID 5FKQA 3ULEC 2B5MA 3J80g 5EM2A 4CI2A 1U2VC 4IRZA 5CXCA 5M5TA 3O4JA 4L1QD 4O45A 2WQ8A 5C2WB 1U4CA 4AMYA 3EI1A 2CNXA 3PXTD 3OF7A 5EM2B 1TBGA 2QXVA 4A2MA 1GXRA 2AGYA 4J79A 1C9IA 3ZDXA 4ESGA 4G1EA 1VZ3A 5KDOB 2XL2A 2CN3A 4NAAA 1L5GA 2HU8A 1YR2A 4BL0A 2OK4A 2IUQA 3SBRA 2I0RA 5FKTA 4G55A 2VDKA 3PVUB 3SWSD 4AOWA 2AGLA 1BPOA 3GFCA 4J78A 2H3XA 5EAMA 4J84A 4ERYA 1VZ2A 4FHLA 4NBMA 3UVOA 3IUMA 1XIPA 4IMMA 3EQ9A 3PSCB 3T3PA 4X60B 1JV2A 4CI3A 3KRXB 2VDNA 2Z2PA 4QAMA 5E6RA 3I7LA 5I5IA 2HXCA 2AQ5A 5K1CC 5A2Qg 4MK0B 3EG6A 3FCSA 4JHPC 1B9YA 4CI1A 1TYEA 1MDAH 1SHYB 4Z7NA 2UZXB 1N6EA 3UR4A 2VZ3A 4FB1D 3SXTD 2H6QA 3K27A 4ZOVA 3F3GA 3SVWD 2TRCB 2VDRA 4A7JA 4E54A 3JRPA 2G9AA 5GMKn 4GM9A 3IURA 3EI4A 2W18A 2OK6A 5M5SA 3PVWB 3N0EA 2Z2NA 5H1MA 3F3FA 3OKWA 3EQ7A 4FA4D 5C86A 4MMYA 4LGNA 4HDJA 1E8NA 1GG2B 3JZNA 3OL2B 3EI3B 4UI9R 4L1MA 5I5JA 1OMWB 4UM9A 4U7AA 3F3PA 2VDQA 2OVQB 2QC5A 4NSXA 5CYKA 4BCDA 3MUNA 1C9LA 3PXSD 5H17A 4Y5RD 3DWLC 2I0TA 5E6UA 4QRJA 1H2ZA 5EMJB 5E6SA 3W15A 1QFSA 4U1EI 5CYKB 5HYNB 4PSWB 4A0AA 4L3HD 5CXBB 4CY5A 5EMLB 3BWSA 4L9OA 3VI4A 4A08A 4Z7OA 3C9CA 4JT6C 4H5JA 3MZLA 4O9DA 3JROA 5AJAA 1E8MA 4X3EA 3IUQA 4WK0A 3V4VA 3U4YA 2XL3A 3ZDZA 3FCUA 2AGWA 4QT8A 4O3TB 2YNNA 1A0RB 3C5MA 4PBYA 4CY1A 5K19A 4FAND 3ZE1A 1JMXB 5IJ8E 1L0QA 4A09B 2HKMA 4JSXC 4BCBA 5IJ7E 4RE6A 3I8CA 4A11A 4ES0A 4D0KA 3DM0A 4JSNC 2PM6B 4DNWA 2H6NA 4KFMB 3UVKA 3SJLD 3OKYA 4ZN4A 1GOGA 4XYIA 5AFU3 5HQGA 3V4PA 4D9SA 1XHMA 4O3UB 2BBKH 4PC0A 4R7AB 3VH0A 5HDBA 2VDPA 2XYIA 5CXCB 5FA5B 4FA9D 4JHNA 3O4HA 2HKRA 1QNIA 3EI2A 3K6SA 2Z2OA 1VYHC 2AGXA 4J87A 4CZXA 3EI1B 3OKYB 4BP8A 3RRMC 4K3JB 3UVMA 3SMRA 2XU7A 3GREA 5EALA 2YB8B 3I7NA 4J8BA 3BG1A 5FQDA 2CN2A 2O9KA 2G99A 4DNVA 2P9IC 2IUVA 1RI6A 2EIDA 3I89A 4JSVC 2YMUA 3PE7A 1ERJA 4JT5C 3I7KA 2J56H 3B7FA 5IT9g 5M61A 4AEZA 3GD1I 4J8GA 3IJ1A 3HFQA 3IJEA 4BP9A 4BCCA 3CFVA 4A0BA 3FM0A 1TYQC 2PM9A 1UTCA 4O2WA 1PEVA 3L4MD 4O1QD 4GM8A 4OZUA 4FA5D 2P9KC 2XDWA 4NC4A 3DSMA 2HESX 2HJ4A 2JKXA 3NVQA 3CIKB 3J81g 1NR0A 2AH1A 4GQ2P 3IIYA 2P9PC 3L4OD 5IGQA 3C99A 2BCJB 5THAA 3C75H 3I7HA 1NEXB 4CI8A 3AFCA 1FWXA 1H2YA 3AL9A 5FLXg 2MTAH 4E54B 2I3SA 1A12A 3QHYB 3AH8B 4CY3A 3SHFA 2IWKA 1PBYB 5FXYA 3JZGA 3EI4B 3SBPA 1T2XA 3IKOA 4WK2A 2P9LC 3MMYA 1H2XA 2EICA 2H14A 4J0WA 3IIWA 5FKRA 5C9ZB 3IJCA 2OVRB 3EU7A 1SQJA 4CY2A 3K72A 4WK4A 2YNOA 4TZ4A 3MZKA 2VDMA 2H9PA 4PBZA 3JPXA 3MXXA 5HE3B 4GQ1A 2OJYA 4I79A 3AL8A 2UZYB 2OIZA 3N0DA 2VDLA 4YVDA 4JD2C 3ODTA 3ZDYA 4CZYA 3NVXA 3OTTA 5SXMA 1P22A 5JWZA 2H6KA 4EWRA 2P9SC 3EWEA 4RE5A 2AH0A 2XZGA 3VA6A 2J55H 4D6VA 1PI6A 2HU7A 5IGOA 5GSAA 3FGBA 2I3TA 4ZOXA 4A0AB 5M5RA 3UKUC 5EARA 3MKQA 2XE4A 3ZWLB 1VE6A 5C92A 1SQ9A 2J57G 3SN6B 5EMKB 3RLMD 4A08B 4GZ8A 5HE2B 1MG2A 3I7PA 3I7OA 4GQBB 2HYEA 3UVLA 3RN1D 4G1MA 3T3MA 3QI0A 1UOPA 4X61B 3RFHA 1K8KC 1E5TA 3P4FA 4J0XA 3RMZD 4BUJC 4QQEA 1O6FA 3IVMA 4A11B 2Q7QA 4AMZA 4CZVA 5M5VA 4GGCA 2GNQA 4FAVD 5B4WA 4ZOZA 5FKSA 3DXKC 3K26A 3ZE0A 4XEIC 5GXHA 1MG3A 4J86A 3OW8A 3SFZA 5IC7A 4H5IA 2CE9A 2H9NA 4BH6A 4PSXB 5GXIA 3DDUA 1UOOA 2EBSA 3RSEC 3DXMC 4O02A 4GGDA 2VDOA 3EI2B 3KCIA 2VZ1A 2YNPA 3RFGA 5EMMB 3MUOA 3NVNA 1K32A 1GP2B 3EMHA 4L3GD 3BG0A 3I8EA 3GC3B 3MVDK 2AGZA 2EIBA 1JTDB 2CO0A 4PNKB 2IWFA 2OVPB 3V7DB 1O6GA 2H13A 1QFMA 2H9MA 3A0FA 5EAPA 3VI3A 4OWRA 4FA1D 3JAMg 4XYHA 1U8CA 2HJBA 2CE8A 2HU5A 3V5WB 4AN0A 3I2NA 4G56B 4J77A 5H14A 1JOFA 1PGUA 4A0BB 2PM9B 2B5LA 3K71A 3IUNA 2YBAA 1S4UX 4PXWA 3UKRC 3PSLA 4N14A 3EQ8A 4GM3A 3JB9L 3SLED 4DNUA 3O4IA 2CO0C 4Z7QA 2PBIB 3NIGA 4UM8A 2P9NC 3NIDA 2P9UC 4MMXA 4LG9A 2H68A 5M5UA
chains in the Genus database with same CATH topology
3GC3B 2XZGA 5M5VA 5M5UA 4G55A 5M5SA 1C9LA 5M61A 1BPOA 5M5TA 5M5RA 1C9IA 3GD1I 1UTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GC3 B;  2XZG A;  5M5V A;  5M5U A;  4G55 A;  5M5S A;  1C9L A;  5M61 A;  1BPO A;  5M5T A;  5M5R A;  1C9I A;  3GD1 I;  1UTC A; 
#chains in the Genus database with same CATH topology
 3MKS B;  4IA9 A;  3NIF A;  2IUP A;  3OL2 A;  3EI3 A;  4A2L A;  4NEN A;  4FWW A;  4X63 B;  4E5Z A;  3RN0 D;  3IUL A;  3IUJ A;  2EIE A;  1B9X A;  3E0C A;  4J73 A;  3ZE2 A;  2BKL A;  4J82 A;  5TF2 A;  5I5M A;  1I2M B;  1K3I A;  3PXW D;  4Y7R A;  5TDH B;  3O4G A;  4GGA A;  3V9F A;  4E5Z B;  4JXM A;  4AX4 A;  1YFQ A;  1N6D A;  3SBQ A;  4AN1 A;  5C2V B;  4ERQ A;  2I0S A;  2QZP A;  5TEE A;  3AL8 B;  3CFS B;  5CXB A;  2GC7 A;  2QR5 A;  4ZOY A;  3UVN A;  1OLZ A;  1VE7 A;  1R5M A;  1M1X A;  4QL1 A;  4LG8 A;  5AMS A;  4CC9 A;  2B5N A;  2VC2 A;  1H2W A;  3JZH A;  4GMB A;  3IJ0 A;  2GC4 A;  5TEF A;  5HE1 B;  3ORV D;  1GOT B;  4MMZ A;  4JSP C;  4WJK A;  4A09 A;  5FFO A;  3FRX A;  5FFG A;  2B4E A;  1Q47 A;  1GOF A;  1JMZ B;  1N6F A;  1JJU B;  3KRW B;  5HE0 B;  3VGZ A;  1XKS A;  2H9L A;  4ERZ A;  2IUR A;  3OKT A;  1UOQ A;  1GOH A;  2PM7 B;  4J81 A;  2H47 A;  4Z8L A;  2IAA A;  3SCY A;  4K3I D;  5FKQ A;  3ULE C;  2B5M A;  3J80 g;  5EM2 A;  4CI2 A;  1U2V C;  4IRZ A;  5CXC A;  5M5T A;  3O4J A;  4L1Q D;  4O45 A;  2WQ8 A;  5C2W B;  1U4C A;  4AMY A;  3EI1 A;  2CNX A;  3PXT D;  3OF7 A;  5EM2 B;  1TBG A;  2QXV A;  4A2M A;  1GXR A;  2AGY A;  4J79 A;  1C9I A;  3ZDX A;  4ESG A;  4G1E A;  1VZ3 A;  5KDO B;  2XL2 A;  2CN3 A;  4NAA A;  1L5G A;  2HU8 A;  1YR2 A;  4BL0 A;  2OK4 A;  2IUQ A;  3SBR A;  2I0R A;  5FKT A;  4G55 A;  2VDK A;  3PVU B;  3SWS D;  4AOW A;  2AGL A;  1BPO A;  3GFC A;  4J78 A;  2H3X A;  5EAM A;  4J84 A;  4ERY A;  1VZ2 A;  4FHL A;  4NBM A;  3UVO A;  3IUM A;  1XIP A;  4IMM A;  3EQ9 A;  3PSC B;  3T3P A;  4X60 B;  1JV2 A;  4CI3 A;  3KRX B;  2VDN A;  2Z2P A;  4QAM A;  5E6R A;  3I7L A;  5I5I A;  2HXC A;  2AQ5 A;  5K1C C;  5A2Q g;  4MK0 B;  3EG6 A;  3FCS A;  4JHP C;  1B9Y A;  4CI1 A;  1TYE A;  1MDA H;  1SHY B;  4Z7N A;  2UZX B;  1N6E A;  3UR4 A;  2VZ3 A;  4FB1 D;  3SXT D;  2H6Q A;  3K27 A;  4ZOV A;  3F3G A;  3SVW D;  2TRC B;  2VDR A;  4A7J A;  4E54 A;  3JRP A;  2G9A A;  5GMK n;  4GM9 A;  3IUR A;  3EI4 A;  2W18 A;  2OK6 A;  5M5S A;  3PVW B;  3N0E A;  2Z2N A;  5H1M A;  3F3F A;  3OKW A;  3EQ7 A;  4FA4 D;  5C86 A;  4MMY A;  4LGN A;  4HDJ A;  1E8N A;  1GG2 B;  3JZN A;  3OL2 B;  3EI3 B;  4UI9 R;  4L1M A;  5I5J A;  1OMW B;  4UM9 A;  4U7A A;  3F3P A;  2VDQ A;  2OVQ B;  2QC5 A;  4NSX A;  5CYK A;  4BCD A;  3MUN A;  1C9L A;  3PXS D;  5H17 A;  4Y5R D;  3DWL C;  2I0T A;  5E6U A;  4QRJ A;  1H2Z A;  5EMJ B;  5E6S A;  3W15 A;  1QFS A;  4U1E I;  5CYK B;  5HYN B;  4PSW B;  4A0A A;  4L3H D;  5CXB B;  4CY5 A;  5EML B;  3BWS A;  4L9O A;  3VI4 A;  4A08 A;  4Z7O A;  3C9C A;  4JT6 C;  4H5J A;  3MZL A;  4O9D A;  3JRO A;  5AJA A;  1E8M A;  4X3E A;  3IUQ A;  4WK0 A;  3V4V A;  3U4Y A;  2XL3 A;  3ZDZ A;  3FCU A;  2AGW A;  4QT8 A;  4O3T B;  2YNN A;  1A0R B;  3C5M A;  4PBY A;  4CY1 A;  5K19 A;  4FAN D;  3ZE1 A;  1JMX B;  5IJ8 E;  1L0Q A;  4A09 B;  2HKM A;  4JSX C;  4BCB A;  5IJ7 E;  4RE6 A;  3I8C A;  4A11 A;  4ES0 A;  4D0K A;  3DM0 A;  4JSN C;  2PM6 B;  4DNW A;  2H6N A;  4KFM B;  3UVK A;  3SJL D;  3OKY A;  4ZN4 A;  1GOG A;  4XYI A;  5AFU 3;  5HQG A;  3V4P A;  4D9S A;  1XHM A;  4O3U B;  2BBK H;  4PC0 A;  4R7A B;  3VH0 A;  5HDB A;  2VDP A;  2XYI A;  5CXC B;  5FA5 B;  4FA9 D;  4JHN A;  3O4H A;  2HKR A;  1QNI A;  3EI2 A;  3K6S A;  2Z2O A;  1VYH C;  2AGX A;  4J87 A;  4CZX A;  3EI1 B;  3OKY B;  4BP8 A;  3RRM C;  4K3J B;  3UVM A;  3SMR A;  2XU7 A;  3GRE A;  5EAL A;  2YB8 B;  3I7N A;  4J8B A;  3BG1 A;  5FQD A;  2CN2 A;  2O9K A;  2G99 A;  4DNV A;  2P9I C;  2IUV A;  1RI6 A;  2EID A;  3I89 A;  4JSV C;  2YMU A;  3PE7 A;  1ERJ A;  4JT5 C;  3I7K A;  2J56 H;  3B7F A;  5IT9 g;  5M61 A;  4AEZ A;  3GD1 I;  4J8G A;  3IJ1 A;  3HFQ A;  3IJE A;  4BP9 A;  4BCC A;  3CFV A;  4A0B A;  3FM0 A;  1TYQ C;  2PM9 A;  1UTC A;  4O2W A;  1PEV A;  3L4M D;  4O1Q D;  4GM8 A;  4OZU A;  4FA5 D;  2P9K C;  2XDW A;  4NC4 A;  3DSM A;  2HES X;  2HJ4 A;  2JKX A;  3NVQ A;  3CIK B;  3J81 g;  1NR0 A;  2AH1 A;  4GQ2 P;  3IIY A;  2P9P C;  3L4O D;  5IGQ A;  3C99 A;  2BCJ B;  5THA A;  3C75 H;  3I7H A;  1NEX B;  4CI8 A;  3AFC A;  1FWX A;  1H2Y A;  3AL9 A;  5FLX g;  2MTA H;  4E54 B;  2I3S A;  1A12 A;  3QHY B;  3AH8 B;  4CY3 A;  3SHF A;  2IWK A;  1PBY B;  5FXY A;  3JZG A;  3EI4 B;  3SBP A;  1T2X A;  3IKO A;  4WK2 A;  2P9L C;  3MMY A;  1H2X A;  2EIC A;  2H14 A;  4J0W A;  3IIW A;  5FKR A;  5C9Z B;  3IJC A;  2OVR B;  3EU7 A;  1SQJ A;  4CY2 A;  3K72 A;  4WK4 A;  2YNO A;  4TZ4 A;  3MZK A;  2VDM A;  2H9P A;  4PBZ A;  3JPX A;  3MXX A;  5HE3 B;  4GQ1 A;  2OJY A;  4I79 A;  3AL8 A;  2UZY B;  2OIZ A;  3N0D A;  2VDL A;  4YVD A;  4JD2 C;  3ODT A;  3ZDY A;  4CZY A;  3NVX A;  3OTT A;  5SXM A;  1P22 A;  5JWZ A;  2H6K A;  4EWR A;  2P9S C;  3EWE A;  4RE5 A;  2AH0 A;  2XZG A;  3VA6 A;  2J55 H;  4D6V A;  1PI6 A;  2HU7 A;  5IGO A;  5GSA A;  3FGB A;  2I3T A;  4ZOX A;  4A0A B;  5M5R A;  3UKU C;  5EAR A;  3MKQ A;  2XE4 A;  3ZWL B;  1VE6 A;  5C92 A;  1SQ9 A;  2J57 G;  3SN6 B;  5EMK B;  3RLM D;  4A08 B;  4GZ8 A;  5HE2 B;  1MG2 A;  3I7P A;  3I7O A;  4GQB B;  2HYE A;  3UVL A;  3RN1 D;  4G1M A;  3T3M A;  3QI0 A;  1UOP A;  4X61 B;  3RFH A;  1K8K C;  1E5T A;  3P4F A;  4J0X A;  3RMZ D;  4BUJ C;  4QQE A;  1O6F A;  3IVM A;  4A11 B;  2Q7Q A;  4AMZ A;  4CZV A;  5M5V A;  4GGC A;  2GNQ A;  4FAV D;  5B4W A;  4ZOZ A;  5FKS A;  3DXK C;  3K26 A;  3ZE0 A;  4XEI C;  5GXH A;  1MG3 A;  4J86 A;  3OW8 A;  3SFZ A;  5IC7 A;  4H5I A;  2CE9 A;  2H9N A;  4BH6 A;  4PSX B;  5GXI A;  3DDU A;  1UOO A;  2EBS A;  3RSE C;  3DXM C;  4O02 A;  4GGD A;  2VDO A;  3EI2 B;  3KCI A;  2VZ1 A;  2YNP A;  3RFG A;  5EMM B;  3MUO A;  3NVN A;  1K32 A;  1GP2 B;  3EMH A;  4L3G D;  3BG0 A;  3I8E A;  3GC3 B;  3MVD K;  2AGZ A;  2EIB A;  1JTD B;  2CO0 A;  4PNK B;  2IWF A;  2OVP B;  3V7D B;  1O6G A;  2H13 A;  1QFM A;  2H9M A;  3A0F A;  5EAP A;  3VI3 A;  4OWR A;  4FA1 D;  3JAM g;  4XYH A;  1U8C A;  2HJB A;  2CE8 A;  2HU5 A;  3V5W B;  4AN0 A;  3I2N A;  4G56 B;  4J77 A;  5H14 A;  1JOF A;  1PGU A;  4A0B B;  2PM9 B;  2B5L A;  3K71 A;  3IUN A;  2YBA A;  1S4U X;  4PXW A;  3UKR C;  3PSL A;  4N14 A;  3EQ8 A;  4GM3 A;  3JB9 L;  3SLE D;  4DNU A;  3O4I A;  2CO0 C;  4Z7Q A;  2PBI B;  3NIG A;  4UM8 A;  2P9N C;  3NID A;  2P9U C;  4MMX A;  4LG9 A;  2H68 A;  5M5U A; 
#chains in the Genus database with same CATH homology
 3GC3 B;  2XZG A;  5M5V A;  5M5U A;  4G55 A;  5M5S A;  1C9L A;  5M61 A;  1BPO A;  5M5T A;  5M5R A;  1C9I A;  3GD1 I;  1UTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...