2I3SA

Bub3 complex with bub1 glebs motif
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
340
structure length
334
Chain Sequence
b'MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell cycle arrest protein
molecule tags Cell cycle
source organism Saccharomyces cerevisiae
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
total genus 79
structure length 334
sequence length 340
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3sA00
4ZOVA 4J0WA 2W18A 2BBKH 2OVQB 4GZ8A 4A08A 1FWXA 2IWFA 4CZXA 4J84A 3UVOA 1JMZB 5GXIA 1MG2A 3EI3A 2MTAH 2PM9A 2PBIB 3RFHA 3F3FA 3EWEA 4A0AA 4O1QD 3OKYB 2CN3A 4E54B 5C2WB 4E5ZB 4Y5RD 3U4YA 4O45A 3IIWA 3UKUC 3RN0D 1B9YA 3JZHA 3PXTD 4CI3A 2AGZA 5I5MA 2AGYA 1PBYB 2CO0C 5C9ZB 2H9PA 4CI8A 4I79A 2P9PC 5TEEA 2P9KC 2Q7QA 4GGCA 4FB1D 4A0BB 1P22A 5H14A 4A11B 3IIYA 2I3TA 1GXRA 3RMZD 3PSCB 3JZNA 3SXTD 4O3TB 4A7JA 4FA4D 4PBYA 2OVPB 1NEXB 3UVNA 5CYKB 2XL2A 5K1CC 4H5JA 3BWSA 2HJ4A 3OKTA 3RFGA 2PM9B 3JRPA 4JSXC 2HKMA 4N14A 2H9LA 4H5IA 3DXMC 3A0FA 2I0TA 2UZXB 3SVWD 1GG2B 4YVDA 4ZN4A 4A2LA 4IMMA 5I5JA 3DM0A 4FHLA 5GMKn 4A08B 3P4FA 3SWSD 1VYHC 3SBQA 5CXCA 3IJCA 4ZOYA 5CYKA 1PI6A 3K27A 4O9DA 4L1QD 2G9AA 3NVNA 5EM2B 4G56B 5EAPA 3N0DA 4CC9A 2CE8A 3V9FA 1PGUA 4ESGA 2H6QA 4QRJA 3E0CA 5TEFA 4E5ZA 4OZUA 4A0AB 2YNPA 4LG8A 4J8GA 3SN6B 4PBZA 4ERYA 2HJBA 3KRXB 3I7NA 2J57G 3NVXA 4J87A 3V5WB 5EARA 3UR4A 3AL9A 3I8EA 1OLZA 4D0KA 2BCJB 5K19A 2B5LA 1TYQC 5JWZA 4X63B 3HFQA 5EMLB 4MK0B 3C5MA 2P9NC 3PVWB 4JT6C 2P9SC 3EI2A 2IUQA 4CZYA 3GFCA 4J0XA 1PEVA 1Q47A 2QXVA 3EMHA 3SHFA 5I5IA 4J86A 1NR0A 2G99A 2HYEA 4X60B 1U4CA 3L4MD 2YMUA 3W15A 2I0SA 2H47A 2B5NA 4ZOZA 4LGNA 4XEIC 5IJ8E 2HXCA 2OIZA 3I7OA 1SHYB 3OL2B 4GQBB 2IWKA 3PXSD 3EI4B 4GMBA 3IKOA 3AL8A 3BG0A 1MDAH 1QNIA 3N0EA 4PSXB 4R7AB 4FA5D 3OW8A 3DWLC 2OJYA 4CI2A 2YBAA 2CE9A 4FA1D 4UI9R 5THAA 4L9OA 5EMKB 3I7KA 2H6NA 4JT5C 2I0RA 3DSMA 2J55H 1JJUB 3V7DB 3SBPA 2YNNA 4A09A 3AL8B 2GNQA 4GM8A 5KDOB 4XYIA 4J8BA 1GP2B 1N6EA 4J81A 3IJ0A 4BUJC 2TRCB 1N6DA 4JD2C 2IUPA 3RSEC 3PSLA 4PSWB 3PVUB 3NVQA 4GM3A 5A2Qg 4BH6A 3JZGA 1ERJA 2HESX 4AOWA 5FKTA 5H17A 1MG3A 4PXWA 3SMRA 1S4UX 1U2VC 4CY1A 3AFCA 1A0RB 2P9UC 4PNKB 2OK6A 3MZKA 5HYNB 1GOTB 4CZVA 3J80g 2XL3A 3ORVD 1YFQA 3I8CA 3JROA 3UVLA 5GSAA 3C9CA 3L4OD 4GQ1A 3CIKB 3SJLD 5FA5B 1JMXB 1OMWB 4GQ2P 4Y7RA 4JXMA 3MKSB 3ODTA 5IC7A 2P9IC 4JSPC 4IA9A 2CN2A 3UVKA 5EALA 3BG1A 3VH0A 4K3JB 5IJ7E 2H6KA 3GREA 4O3UB 4HDJA 3EI4A 3EU7A 3I7HA 2CNXA 3VA6A 3EI1A 4X3EA 5HE1B 4QT8A 4QL1A 5SXMA 5AFU3 3CFVA 4AEZA 1SQ9A 3PXWD 4L3GD 4GM9A 3FGBA 1XKSA 4CI1A 4A2MA 5FKQA 5FKSA 2H13A 2Z2PA 3IJ1A 3PE7A 5HE0B 1XHMA 2EBSA 4JSNC 4EWRA 2O9KA 4Z8LA 3KRWB 4FA9D 1RI6A 2AQ5A 4KFMB 3EI1B 2B4EA 2H9NA 4X61B 5EMMB 5C2VB 4J73A 4ES0A 2H9MA 3MXXA 4CY3A 2Z2OA 1K8KC 2P9LC 3C99A 3C75H 3EG6A 4GGDA 2XYIA 5IGQA 5TDHB 2OK4A 5FXYA 5GXHA 3FM0A 3ZWLB 4NSXA 3UKRC 2I3SA 4A11A 4J82A 5CXCB 4A0BA 2Z2NA 5EAMA 4OWRA 5B4WA 3UVMA 4U1EI 5AMSA 3OL2A 4J79A 5FKRA 3JPXA 3CFSB 3I89A 4L3HD 4PC0A 2AGXA 3SFZA 1JOFA 2YB8B 2HKRA 2IURA 2CO0A 1TBGA 4D6VA 4ERQA 3FRXA 2GC7A 3JB9L 4E54A 2AH0A 4U7AA 3EI2B 2H14A 3MMYA 3SLED 3EI3B 3RLMD 2OVRB 3I7LA 1B9XA 2XU7A 3OKWA 4FWWA 4A09B 2H68A 2AH1A 3F3GA 2YNOA 3RRMC 3OTTA 2B5MA 2AGWA 1R5MA 2GC4A 4LG9A 5CXBB 4ERZA 4TZ4A 2UZYB 3DXKC 3F3PA 1L0QA 5EMJB 5TF2A 3I2NA 5AJAA 5EM2A 4BL0A 3AH8B 2QC5A 5HE2B 4J77A 5HQGA 4CY2A 1SQJA 3B7FA 3MKQA 4FAND 3JAMg 2PM7B 4J78A 2PM6B 4XYHA 2H3XA 3OKYA 4CY5A 3J81g 4QQEA 2IUVA 5IT9g 5HE3B 4GGAA 5FQDA 4ZOXA 2IAAA 3VGZA 3RN1D 1XIPA 5IGOA 4JSVC 3MZLA 4K3ID 3SCYA 5H1MA 2AGLA 5CXBA 1K32A 3I7PA 3K26A 3ULEC 2J56H 3SBRA 5FLXg 1N6FA 4FAVD
chains in the Genus database with same CATH superfamily
4ZOVA 4J0WA 2W18A 5FFGA 4BP9A 2BBKH 2OVQB 4AMYA 4GZ8A 4A08A 1FWXA 2IWFA 4CZXA 4J84A 3UVOA 4D9SA 1JMZB 5GXIA 2VDKA 1MG2A 3EI3A 1H2YA 4BP8A 2MTAH 2PM9A 2PBIB 3RFHA 3GC3B 3F3FA 3EWEA 5M5RA 4A0AA 4O1QD 3OKYB 2CN3A 4E54B 5C2WB 4E5ZB 4G1EA 5E6UA 4WK2A 4Y5RD 3U4YA 4O45A 3IIWA 3UKUC 3RN0D 1B9YA 3JZHA 3PXTD 3IUNA 4CI3A 2AGZA 5I5MA 2AGYA 3ZDXA 4WK4A 1PBYB 2CO0C 5C9ZB 2H9PA 4CI8A 4I79A 2P9PC 5TEEA 2P9KC 2Q7QA 4GGCA 4FB1D 4A0BB 3MUOA 1P22A 5H14A 4A11B 3IIYA 2I3TA 3ZE2A 1GXRA 3RMZD 3PSCB 4AN0A 4G55A 2HU8A 3JZNA 3SXTD 4O3TB 4A7JA 4FA4D 4PBYA 2OVPB 1NEXB 3UVNA 4NC4A 5CYKB 2XL2A 5K1CC 4NENA 3QI0A 4H5JA 3BWSA 4DNWA 1VZ2A 2HJ4A 3O4HA 3OKTA 3V4PA 2VC2A 3RFGA 2PM9B 3JRPA 4JSXC 2HKMA 4N14A 2H9LA 4H5IA 3DXMC 3A0FA 2I0TA 3K6SA 2UZXB 3SVWD 1C9IA 1GG2B 4YVDA 4ZN4A 4A2LA 4IMMA 5I5JA 3DM0A 4FHLA 5GMKn 4A08B 4AX4A 3P4FA 3SWSD 1VYHC 2VZ3A 3SBQA 5CXCA 3IJCA 4ZOYA 5CYKA 1PI6A 4DNUA 3K27A 4O9DA 4L1QD 2G9AA 4UM9A 3FCSA 3NVNA 5EM2B 1C9LA 4G56B 5EAPA 3ZDYA 3N0DA 4CC9A 2CE8A 1E5TA 3V9FA 1PGUA 4ESGA 5M5UA 2H6QA 4QRJA 3IURA 3E0CA 5TEFA 4E5ZA 4OZUA 4MMZA 4A0AB 2YNPA 4LG8A 3OF7A 4J8GA 3SN6B 4PBZA 4ERYA 4RE6A 2HJBA 3KRXB 3I7NA 2J57G 3NVXA 1GOFA 4JHPC 2VDRA 4J87A 4WJKA 3V5WB 3EQ9A 5EARA 2JKXA 3UR4A 3AL9A 3EQ7A 3I8EA 1OLZA 3IUQA 4D0KA 4AMZA 2BCJB 1UOPA 4O2WA 2B5LA 5K19A 1TYQC 3GD1I 5JWZA 4X63B 3HFQA 5EMLB 4MK0B 3C5MA 2P9NC 3PVWB 4JT6C 2P9SC 3EI2A 1M1XA 4MMYA 2EIEA 2IUQA 4CZYA 3GFCA 2HU7A 2XZGA 1K3IA 4J0XA 1PEVA 4JHNA 1Q47A 2QXVA 2VDNA 3EMHA 3SHFA 2XDWA 5I5IA 4J86A 2VZ1A 1NR0A 2G99A 2HYEA 2QZPA 4X60B 1U4CA 3EQ8A 2YMUA 3L4MD 3W15A 1O6FA 2I0SA 2H47A 4Z7NA 2B5NA 4ZOZA 4LGNA 4XEIC 5HDBA 5C86A 5IJ8E 2HXCA 2OIZA 3I7OA 1SHYB 3OL2B 4GQBB 2IWKA 3PXSD 3EI4B 4GMBA 3IKOA 3AL8A 3BG0A 1MDAH 1QNIA 3N0EA 4PSXB 4R7AB 1T2XA 4FA5D 3OW8A 3IUJA 3DWLC 2OJYA 3O4JA 4CI2A 2HU5A 4IRZA 4BCCA 4WK0A 2YBAA 2CE9A 4FA1D 5M5VA 4UI9R 2VDMA 5THAA 3K71A 4L9OA 5EMKB 3I7KA 2H6NA 3NIDA 4JT5C 2I0RA 3IVMA 3DSMA 2J55H 1JJUB 3V7DB 3SBPA 2YNNA 4A09A 3AL8B 2GNQA 4GM8A 5KDOB 2QR5A 4XYIA 4J8BA 1GP2B 1N6EA 3QHYB 4J81A 3IJ0A 4BUJC 2TRCB 1N6DA 4JD2C 2IUPA 3RSEC 3PSLA 4PSWB 3PVUB 4MMXA 3NVQA 4GM3A 5A2Qg 4BH6A 3JZGA 1ERJA 1L5GA 2HESX 4AOWA 5FKTA 5H17A 1MG3A 2EIDA 2VDOA 4G1MA 4PXWA 3SMRA 1S4UX 1U2VC 4CY1A 3AFCA 1A0RB 3VI4A 2P9UC 4PNKB 1H2XA 2VDQA 2OK6A 2BKLA 3MZKA 3ZE1A 5HYNB 1GOTB 4CZVA 3J80g 2XL3A 3ORVD 1YFQA 3I8CA 3JROA 3UVLA 1UOOA 5GSAA 3C9CA 3L4OD 4GQ1A 3CIKB 3T3MA 3SJLD 5FA5B 5C92A 1JMXB 1OMWB 4GQ2P 4Y7RA 4BCBA 4JXMA 3MKSB 4Z7OA 3ODTA 5IC7A 2P9IC 4JSPC 4QAMA 4IA9A 2CN2A 3UVKA 5EALA 3IUMA 3BG1A 3VH0A 4K3JB 5IJ7E 2H6KA 3GREA 4O3UB 3MVDK 4AN1A 4HDJA 3EI4A 3EU7A 3I7HA 2CNXA 3VA6A 1VE6A 3EI1A 5FFOA 3NIGA 1H2ZA 4X3EA 1E8MA 1GOHA 5HE1B 4QT8A 4QL1A 5SXMA 2VDPA 3ZE0A 3CFVA 4AEZA 1SQ9A 5AFU3 2WQ8A 5M5TA 3PXWD 4L3GD 4GM9A 4Z7QA 3FGBA 1XKSA 4CI1A 4A2MA 5FKQA 5FKSA 2H13A 2Z2PA 3IJ1A 3PE7A 5HE0B 1XHMA 2EBSA 4JSNC 4EWRA 2O9KA 4Z8LA 3KRWB 4FA9D 2EICA 5E6SA 5M5SA 1VZ3A 1RI6A 2AQ5A 4KFMB 3DDUA 3EI1B 1YR2A 2B4EA 3VI3A 2H9NA 3K72A 3IJEA 4X61B 5EMMB 5C2VB 3O4GA 4J73A 4ES0A 2H9MA 3MXXA 4CY3A 2Z2OA 1K8KC 2P9LC 3FCUA 3C99A 3C75H 3EG6A 4GGDA 2XYIA 4BCDA 5IGQA 1H2WA 5TDHB 2OK4A 5FXYA 5GXHA 4DNVA 3FM0A 3ZWLB 4NSXA 3UKRC 2I3SA 4A11A 4J82A 5CXCB 4A0BA 2Z2NA 5EAMA 1JV2A 4OWRA 5B4WA 3UVMA 4U1EI 1GOGA 5AMSA 3OL2A 4J79A 5FKRA 4NBMA 3IULA 3JPXA 3CFSB 1QFSA 3I89A 1BPOA 4L3HD 4PC0A 3ZDZA 1TYEA 2AGXA 4NAAA 3SFZA 1JOFA 2YB8B 1UOQA 2HKRA 2IURA 5M61A 2CO0A 1TBGA 4D6VA 4ERQA 3FRXA 2GC7A 3JB9L 4E54A 2AH0A 4U7AA 3EI2B 2H14A 3T3PA 3MMYA 3SLED 3EI3B 3RLMD 2OVRB 3I7LA 2VDLA 1B9XA 2XU7A 3OKWA 4FWWA 4A09B 2H68A 3V4VA 2AH1A 3F3GA 2YNOA 4UM8A 3RRMC 3OTTA 2B5MA 2AGWA 4L1MA 1R5MA 2GC4A 4LG9A 5CXBB 4RE5A 4TZ4A 4ERZA 2UZYB 1UTCA 3DXKC 1L0QA 3F3PA 5EMJB 5TF2A 3I2NA 5AJAA 5EM2A 4BL0A 3AH8B 2QC5A 1A12A 5HE2B 4J77A 5HQGA 4CY2A 1SQJA 3B7FA 3NIFA 3MKQA 4FAND 1I2MB 3JAMg 3MUNA 2PM7B 1JTDB 4J78A 2PM6B 4XYHA 2H3XA 3OKYA 3O4IA 4CY5A 3J81g 4QQEA 2IUVA 5IT9g 5HE3B 4GGAA 5FQDA 4ZOXA 2IAAA 1U8CA 3VGZA 3RN1D 1E8NA 1XIPA 5IGOA 2XE4A 1VE7A 4JSVC 3MZLA 4K3ID 3SCYA 1QFMA 5H1MA 2AGLA 4O02A 5CXBA 1O6GA 3KCIA 1K32A 3I7PA 3K26A 5E6RA 2J56H 3SBRA 3ULEC 1N6FA 4FAVD 5FLXg 2EIBA
chains in the Genus database with same CATH topology
4ZOVA 4J0WA 2W18A 2BBKH 2OVQB 4GZ8A 4A08A 1FWXA 2IWFA 4CZXA 4J84A 3UVOA 1JMZB 5GXIA 1MG2A 3EI3A 2MTAH 2PM9A 2PBIB 3RFHA 3F3FA 3EWEA 4A0AA 4O1QD 3OKYB 2CN3A 4E54B 5C2WB 4E5ZB 4Y5RD 3U4YA 4O45A 3IIWA 3UKUC 3RN0D 1B9YA 3JZHA 3PXTD 4CI3A 2AGZA 5I5MA 2AGYA 1PBYB 2CO0C 5C9ZB 2H9PA 4CI8A 4I79A 2P9PC 5TEEA 2P9KC 2Q7QA 4GGCA 4FB1D 4A0BB 1P22A 5H14A 4A11B 3IIYA 2I3TA 1GXRA 3RMZD 3PSCB 3JZNA 3SXTD 4O3TB 4A7JA 4FA4D 4PBYA 2OVPB 1NEXB 3UVNA 5CYKB 2XL2A 5K1CC 4H5JA 3BWSA 2HJ4A 3OKTA 3RFGA 2PM9B 3JRPA 4JSXC 2HKMA 4N14A 2H9LA 4H5IA 3DXMC 3A0FA 2I0TA 2UZXB 3SVWD 1GG2B 4YVDA 4ZN4A 4A2LA 4IMMA 5I5JA 3DM0A 4FHLA 5GMKn 4A08B 3P4FA 3SWSD 1VYHC 3SBQA 5CXCA 3IJCA 4ZOYA 5CYKA 1PI6A 3K27A 4O9DA 4L1QD 2G9AA 3NVNA 5EM2B 4G56B 5EAPA 3N0DA 4CC9A 2CE8A 3V9FA 1PGUA 4ESGA 2H6QA 4QRJA 3E0CA 5TEFA 4E5ZA 4OZUA 4A0AB 2YNPA 4LG8A 4J8GA 3SN6B 4PBZA 4ERYA 2HJBA 3KRXB 3I7NA 2J57G 3NVXA 4J87A 3V5WB 5EARA 3UR4A 3AL9A 3I8EA 1OLZA 4D0KA 2BCJB 5K19A 2B5LA 1TYQC 5JWZA 4X63B 3HFQA 5EMLB 4MK0B 3C5MA 2P9NC 3PVWB 4JT6C 2P9SC 3EI2A 2IUQA 4CZYA 3GFCA 4J0XA 1PEVA 1Q47A 2QXVA 3EMHA 3SHFA 5I5IA 4J86A 1NR0A 2G99A 2HYEA 4X60B 1U4CA 3L4MD 2YMUA 3W15A 2I0SA 2H47A 2B5NA 4ZOZA 4LGNA 4XEIC 5IJ8E 2HXCA 2OIZA 3I7OA 1SHYB 3OL2B 4GQBB 2IWKA 3PXSD 3EI4B 4GMBA 3IKOA 3AL8A 3BG0A 1MDAH 1QNIA 3N0EA 4PSXB 4R7AB 4FA5D 3OW8A 3DWLC 2OJYA 4CI2A 2YBAA 2CE9A 4FA1D 4UI9R 5THAA 4L9OA 5EMKB 3I7KA 2H6NA 4JT5C 2I0RA 3DSMA 2J55H 1JJUB 3V7DB 3SBPA 2YNNA 4A09A 3AL8B 2GNQA 4GM8A 5KDOB 4XYIA 4J8BA 1GP2B 1N6EA 4J81A 3IJ0A 4BUJC 2TRCB 1N6DA 4JD2C 2IUPA 3RSEC 3PSLA 4PSWB 3PVUB 3NVQA 4GM3A 5A2Qg 4BH6A 3JZGA 1ERJA 2HESX 4AOWA 5FKTA 5H17A 1MG3A 4PXWA 3SMRA 1S4UX 1U2VC 4CY1A 3AFCA 1A0RB 2P9UC 4PNKB 2OK6A 3MZKA 5HYNB 1GOTB 4CZVA 3J80g 2XL3A 3ORVD 1YFQA 3I8CA 3JROA 3UVLA 5GSAA 3C9CA 3L4OD 4GQ1A 3CIKB 3SJLD 5FA5B 1JMXB 1OMWB 4GQ2P 4Y7RA 4JXMA 3MKSB 3ODTA 5IC7A 2P9IC 4JSPC 4IA9A 2CN2A 3UVKA 5EALA 3BG1A 3VH0A 4K3JB 5IJ7E 2H6KA 3GREA 4O3UB 4HDJA 3EI4A 3EU7A 3I7HA 2CNXA 3VA6A 3EI1A 4X3EA 5HE1B 4QT8A 4QL1A 5SXMA 5AFU3 3CFVA 4AEZA 1SQ9A 3PXWD 4L3GD 4GM9A 3FGBA 1XKSA 4CI1A 4A2MA 5FKQA 5FKSA 2H13A 2Z2PA 3IJ1A 3PE7A 5HE0B 1XHMA 2EBSA 4JSNC 4EWRA 2O9KA 4Z8LA 3KRWB 4FA9D 1RI6A 2AQ5A 4KFMB 3EI1B 2B4EA 2H9NA 4X61B 5EMMB 5C2VB 4J73A 4ES0A 2H9MA 3MXXA 4CY3A 2Z2OA 1K8KC 2P9LC 3C99A 3C75H 3EG6A 4GGDA 2XYIA 5IGQA 5TDHB 2OK4A 5FXYA 5GXHA 3FM0A 3ZWLB 4NSXA 3UKRC 2I3SA 4A11A 4J82A 5CXCB 4A0BA 2Z2NA 5EAMA 4OWRA 5B4WA 3UVMA 4U1EI 5AMSA 3OL2A 4J79A 5FKRA 3JPXA 3CFSB 3I89A 4L3HD 4PC0A 2AGXA 3SFZA 1JOFA 2YB8B 2HKRA 2IURA 2CO0A 1TBGA 4D6VA 4ERQA 3FRXA 2GC7A 3JB9L 4E54A 2AH0A 4U7AA 3EI2B 2H14A 3MMYA 3SLED 3EI3B 3RLMD 2OVRB 3I7LA 1B9XA 2XU7A 3OKWA 4FWWA 4A09B 2H68A 2AH1A 3F3GA 2YNOA 3RRMC 3OTTA 2B5MA 2AGWA 1R5MA 2GC4A 4LG9A 5CXBB 4ERZA 4TZ4A 2UZYB 3DXKC 3F3PA 1L0QA 5EMJB 5TF2A 3I2NA 5AJAA 5EM2A 4BL0A 3AH8B 2QC5A 5HE2B 4J77A 5HQGA 4CY2A 1SQJA 3B7FA 3MKQA 4FAND 3JAMg 2PM7B 4J78A 2PM6B 4XYHA 2H3XA 3OKYA 4CY5A 3J81g 4QQEA 2IUVA 5IT9g 5HE3B 4GGAA 5FQDA 4ZOXA 2IAAA 3VGZA 3RN1D 1XIPA 5IGOA 4JSVC 3MZLA 4K3ID 3SCYA 5H1MA 2AGLA 5CXBA 1K32A 3I7PA 3K26A 3ULEC 2J56H 3SBRA 5FLXg 1N6FA 4FAVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOV A;  4J0W A;  2W18 A;  2BBK H;  2OVQ B;  4GZ8 A;  4A08 A;  1FWX A;  2IWF A;  4CZX A;  4J84 A;  3UVO A;  1JMZ B;  5GXI A;  1MG2 A;  3EI3 A;  2MTA H;  2PM9 A;  2PBI B;  3RFH A;  3F3F A;  3EWE A;  4A0A A;  4O1Q D;  3OKY B;  2CN3 A;  4E54 B;  5C2W B;  4E5Z B;  4Y5R D;  3U4Y A;  4O45 A;  3IIW A;  3UKU C;  3RN0 D;  1B9Y A;  3JZH A;  3PXT D;  4CI3 A;  2AGZ A;  5I5M A;  2AGY A;  1PBY B;  2CO0 C;  5C9Z B;  2H9P A;  4CI8 A;  4I79 A;  2P9P C;  5TEE A;  2P9K C;  2Q7Q A;  4GGC A;  4FB1 D;  4A0B B;  1P22 A;  5H14 A;  4A11 B;  3IIY A;  2I3T A;  1GXR A;  3RMZ D;  3PSC B;  3JZN A;  3SXT D;  4O3T B;  4A7J A;  4FA4 D;  4PBY A;  2OVP B;  1NEX B;  3UVN A;  5CYK B;  2XL2 A;  5K1C C;  4H5J A;  3BWS A;  2HJ4 A;  3OKT A;  3RFG A;  2PM9 B;  3JRP A;  4JSX C;  2HKM A;  4N14 A;  2H9L A;  4H5I A;  3DXM C;  3A0F A;  2I0T A;  2UZX B;  3SVW D;  1GG2 B;  4YVD A;  4ZN4 A;  4A2L A;  4IMM A;  5I5J A;  3DM0 A;  4FHL A;  5GMK n;  4A08 B;  3P4F A;  3SWS D;  1VYH C;  3SBQ A;  5CXC A;  3IJC A;  4ZOY A;  5CYK A;  1PI6 A;  3K27 A;  4O9D A;  4L1Q D;  2G9A A;  3NVN A;  5EM2 B;  4G56 B;  5EAP A;  3N0D A;  4CC9 A;  2CE8 A;  3V9F A;  1PGU A;  4ESG A;  2H6Q A;  4QRJ A;  3E0C A;  5TEF A;  4E5Z A;  4OZU A;  4A0A B;  2YNP A;  4LG8 A;  4J8G A;  3SN6 B;  4PBZ A;  4ERY A;  2HJB A;  3KRX B;  3I7N A;  2J57 G;  3NVX A;  4J87 A;  3V5W B;  5EAR A;  3UR4 A;  3AL9 A;  3I8E A;  1OLZ A;  4D0K A;  2BCJ B;  5K19 A;  2B5L A;  1TYQ C;  5JWZ A;  4X63 B;  3HFQ A;  5EML B;  4MK0 B;  3C5M A;  2P9N C;  3PVW B;  4JT6 C;  2P9S C;  3EI2 A;  2IUQ A;  4CZY A;  3GFC A;  4J0X A;  1PEV A;  1Q47 A;  2QXV A;  3EMH A;  3SHF A;  5I5I A;  4J86 A;  1NR0 A;  2G99 A;  2HYE A;  4X60 B;  1U4C A;  3L4M D;  2YMU A;  3W15 A;  2I0S A;  2H47 A;  2B5N A;  4ZOZ A;  4LGN A;  4XEI C;  5IJ8 E;  2HXC A;  2OIZ A;  3I7O A;  1SHY B;  3OL2 B;  4GQB B;  2IWK A;  3PXS D;  3EI4 B;  4GMB A;  3IKO A;  3AL8 A;  3BG0 A;  1MDA H;  1QNI A;  3N0E A;  4PSX B;  4R7A B;  4FA5 D;  3OW8 A;  3DWL C;  2OJY A;  4CI2 A;  2YBA A;  2CE9 A;  4FA1 D;  4UI9 R;  5THA A;  4L9O A;  5EMK B;  3I7K A;  2H6N A;  4JT5 C;  2I0R A;  3DSM A;  2J55 H;  1JJU B;  3V7D B;  3SBP A;  2YNN A;  4A09 A;  3AL8 B;  2GNQ A;  4GM8 A;  5KDO B;  4XYI A;  4J8B A;  1GP2 B;  1N6E A;  4J81 A;  3IJ0 A;  4BUJ C;  2TRC B;  1N6D A;  4JD2 C;  2IUP A;  3RSE C;  3PSL A;  4PSW B;  3PVU B;  3NVQ A;  4GM3 A;  5A2Q g;  4BH6 A;  3JZG A;  1ERJ A;  2HES X;  4AOW A;  5FKT A;  5H17 A;  1MG3 A;  4PXW A;  3SMR A;  1S4U X;  1U2V C;  4CY1 A;  3AFC A;  1A0R B;  2P9U C;  4PNK B;  2OK6 A;  3MZK A;  5HYN B;  1GOT B;  4CZV A;  3J80 g;  2XL3 A;  3ORV D;  1YFQ A;  3I8C A;  3JRO A;  3UVL A;  5GSA A;  3C9C A;  3L4O D;  4GQ1 A;  3CIK B;  3SJL D;  5FA5 B;  1JMX B;  1OMW B;  4GQ2 P;  4Y7R A;  4JXM A;  3MKS B;  3ODT A;  5IC7 A;  2P9I C;  4JSP C;  4IA9 A;  2CN2 A;  3UVK A;  5EAL A;  3BG1 A;  3VH0 A;  4K3J B;  5IJ7 E;  2H6K A;  3GRE A;  4O3U B;  4HDJ A;  3EI4 A;  3EU7 A;  3I7H A;  2CNX A;  3VA6 A;  3EI1 A;  4X3E A;  5HE1 B;  4QT8 A;  4QL1 A;  5SXM A;  5AFU 3;  3CFV A;  4AEZ A;  1SQ9 A;  3PXW D;  4L3G D;  4GM9 A;  3FGB A;  1XKS A;  4CI1 A;  4A2M A;  5FKQ A;  5FKS A;  2H13 A;  2Z2P A;  3IJ1 A;  3PE7 A;  5HE0 B;  1XHM A;  2EBS A;  4JSN C;  4EWR A;  2O9K A;  4Z8L A;  3KRW B;  4FA9 D;  1RI6 A;  2AQ5 A;  4KFM B;  3EI1 B;  2B4E A;  2H9N A;  4X61 B;  5EMM B;  5C2V B;  4J73 A;  4ES0 A;  2H9M A;  3MXX A;  4CY3 A;  2Z2O A;  1K8K C;  2P9L C;  3C99 A;  3C75 H;  3EG6 A;  4GGD A;  2XYI A;  5IGQ A;  5TDH B;  2OK4 A;  5FXY A;  5GXH A;  3FM0 A;  3ZWL B;  4NSX A;  3UKR C;  2I3S A;  4A11 A;  4J82 A;  5CXC B;  4A0B A;  2Z2N A;  5EAM A;  4OWR A;  5B4W A;  3UVM A;  4U1E I;  5AMS A;  3OL2 A;  4J79 A;  5FKR A;  3JPX A;  3CFS B;  3I89 A;  4L3H D;  4PC0 A;  2AGX A;  3SFZ A;  1JOF A;  2YB8 B;  2HKR A;  2IUR A;  2CO0 A;  1TBG A;  4D6V A;  4ERQ A;  3FRX A;  2GC7 A;  3JB9 L;  4E54 A;  2AH0 A;  4U7A A;  3EI2 B;  2H14 A;  3MMY A;  3SLE D;  3EI3 B;  3RLM D;  2OVR B;  3I7L A;  1B9X A;  2XU7 A;  3OKW A;  4FWW A;  4A09 B;  2H68 A;  2AH1 A;  3F3G A;  2YNO A;  3RRM C;  3OTT A;  2B5M A;  2AGW A;  1R5M A;  2GC4 A;  4LG9 A;  5CXB B;  4ERZ A;  4TZ4 A;  2UZY B;  3DXK C;  3F3P A;  1L0Q A;  5EMJ B;  5TF2 A;  3I2N A;  5AJA A;  5EM2 A;  4BL0 A;  3AH8 B;  2QC5 A;  5HE2 B;  4J77 A;  5HQG A;  4CY2 A;  1SQJ A;  3B7F A;  3MKQ A;  4FAN D;  3JAM g;  2PM7 B;  4J78 A;  2PM6 B;  4XYH A;  2H3X A;  3OKY A;  4CY5 A;  3J81 g;  4QQE A;  2IUV A;  5IT9 g;  5HE3 B;  4GGA A;  5FQD A;  4ZOX A;  2IAA A;  3VGZ A;  3RN1 D;  1XIP A;  5IGO A;  4JSV C;  3MZL A;  4K3I D;  3SCY A;  5H1M A;  2AGL A;  5CXB A;  1K32 A;  3I7P A;  3K26 A;  3ULE C;  2J56 H;  3SBR A;  5FLX g;  1N6F A;  4FAV D; 
#chains in the Genus database with same CATH topology
 4ZOV A;  4J0W A;  2W18 A;  5FFG A;  4BP9 A;  2BBK H;  2OVQ B;  4AMY A;  4GZ8 A;  4A08 A;  1FWX A;  2IWF A;  4CZX A;  4J84 A;  3UVO A;  4D9S A;  1JMZ B;  5GXI A;  2VDK A;  1MG2 A;  3EI3 A;  1H2Y A;  4BP8 A;  2MTA H;  2PM9 A;  2PBI B;  3RFH A;  3GC3 B;  3F3F A;  3EWE A;  5M5R A;  4A0A A;  4O1Q D;  3OKY B;  2CN3 A;  4E54 B;  5C2W B;  4E5Z B;  4G1E A;  5E6U A;  4WK2 A;  4Y5R D;  3U4Y A;  4O45 A;  3IIW A;  3UKU C;  3RN0 D;  1B9Y A;  3JZH A;  3PXT D;  3IUN A;  4CI3 A;  2AGZ A;  5I5M A;  2AGY A;  3ZDX A;  4WK4 A;  1PBY B;  2CO0 C;  5C9Z B;  2H9P A;  4CI8 A;  4I79 A;  2P9P C;  5TEE A;  2P9K C;  2Q7Q A;  4GGC A;  4FB1 D;  4A0B B;  3MUO A;  1P22 A;  5H14 A;  4A11 B;  3IIY A;  2I3T A;  3ZE2 A;  1GXR A;  3RMZ D;  3PSC B;  4AN0 A;  4G55 A;  2HU8 A;  3JZN A;  3SXT D;  4O3T B;  4A7J A;  4FA4 D;  4PBY A;  2OVP B;  1NEX B;  3UVN A;  4NC4 A;  5CYK B;  2XL2 A;  5K1C C;  4NEN A;  3QI0 A;  4H5J A;  3BWS A;  4DNW A;  1VZ2 A;  2HJ4 A;  3O4H A;  3OKT A;  3V4P A;  2VC2 A;  3RFG A;  2PM9 B;  3JRP A;  4JSX C;  2HKM A;  4N14 A;  2H9L A;  4H5I A;  3DXM C;  3A0F A;  2I0T A;  3K6S A;  2UZX B;  3SVW D;  1C9I A;  1GG2 B;  4YVD A;  4ZN4 A;  4A2L A;  4IMM A;  5I5J A;  3DM0 A;  4FHL A;  5GMK n;  4A08 B;  4AX4 A;  3P4F A;  3SWS D;  1VYH C;  2VZ3 A;  3SBQ A;  5CXC A;  3IJC A;  4ZOY A;  5CYK A;  1PI6 A;  4DNU A;  3K27 A;  4O9D A;  4L1Q D;  2G9A A;  4UM9 A;  3FCS A;  3NVN A;  5EM2 B;  1C9L A;  4G56 B;  5EAP A;  3ZDY A;  3N0D A;  4CC9 A;  2CE8 A;  1E5T A;  3V9F A;  1PGU A;  4ESG A;  5M5U A;  2H6Q A;  4QRJ A;  3IUR A;  3E0C A;  5TEF A;  4E5Z A;  4OZU A;  4MMZ A;  4A0A B;  2YNP A;  4LG8 A;  3OF7 A;  4J8G A;  3SN6 B;  4PBZ A;  4ERY A;  4RE6 A;  2HJB A;  3KRX B;  3I7N A;  2J57 G;  3NVX A;  1GOF A;  4JHP C;  2VDR A;  4J87 A;  4WJK A;  3V5W B;  3EQ9 A;  5EAR A;  2JKX A;  3UR4 A;  3AL9 A;  3EQ7 A;  3I8E A;  1OLZ A;  3IUQ A;  4D0K A;  4AMZ A;  2BCJ B;  1UOP A;  4O2W A;  2B5L A;  5K19 A;  1TYQ C;  3GD1 I;  5JWZ A;  4X63 B;  3HFQ A;  5EML B;  4MK0 B;  3C5M A;  2P9N C;  3PVW B;  4JT6 C;  2P9S C;  3EI2 A;  1M1X A;  4MMY A;  2EIE A;  2IUQ A;  4CZY A;  3GFC A;  2HU7 A;  2XZG A;  1K3I A;  4J0X A;  1PEV A;  4JHN A;  1Q47 A;  2QXV A;  2VDN A;  3EMH A;  3SHF A;  2XDW A;  5I5I A;  4J86 A;  2VZ1 A;  1NR0 A;  2G99 A;  2HYE A;  2QZP A;  4X60 B;  1U4C A;  3EQ8 A;  2YMU A;  3L4M D;  3W15 A;  1O6F A;  2I0S A;  2H47 A;  4Z7N A;  2B5N A;  4ZOZ A;  4LGN A;  4XEI C;  5HDB A;  5C86 A;  5IJ8 E;  2HXC A;  2OIZ A;  3I7O A;  1SHY B;  3OL2 B;  4GQB B;  2IWK A;  3PXS D;  3EI4 B;  4GMB A;  3IKO A;  3AL8 A;  3BG0 A;  1MDA H;  1QNI A;  3N0E A;  4PSX B;  4R7A B;  1T2X A;  4FA5 D;  3OW8 A;  3IUJ A;  3DWL C;  2OJY A;  3O4J A;  4CI2 A;  2HU5 A;  4IRZ A;  4BCC A;  4WK0 A;  2YBA A;  2CE9 A;  4FA1 D;  5M5V A;  4UI9 R;  2VDM A;  5THA A;  3K71 A;  4L9O A;  5EMK B;  3I7K A;  2H6N A;  3NID A;  4JT5 C;  2I0R A;  3IVM A;  3DSM A;  2J55 H;  1JJU B;  3V7D B;  3SBP A;  2YNN A;  4A09 A;  3AL8 B;  2GNQ A;  4GM8 A;  5KDO B;  2QR5 A;  4XYI A;  4J8B A;  1GP2 B;  1N6E A;  3QHY B;  4J81 A;  3IJ0 A;  4BUJ C;  2TRC B;  1N6D A;  4JD2 C;  2IUP A;  3RSE C;  3PSL A;  4PSW B;  3PVU B;  4MMX A;  3NVQ A;  4GM3 A;  5A2Q g;  4BH6 A;  3JZG A;  1ERJ A;  1L5G A;  2HES X;  4AOW A;  5FKT A;  5H17 A;  1MG3 A;  2EID A;  2VDO A;  4G1M A;  4PXW A;  3SMR A;  1S4U X;  1U2V C;  4CY1 A;  3AFC A;  1A0R B;  3VI4 A;  2P9U C;  4PNK B;  1H2X A;  2VDQ A;  2OK6 A;  2BKL A;  3MZK A;  3ZE1 A;  5HYN B;  1GOT B;  4CZV A;  3J80 g;  2XL3 A;  3ORV D;  1YFQ A;  3I8C A;  3JRO A;  3UVL A;  1UOO A;  5GSA A;  3C9C A;  3L4O D;  4GQ1 A;  3CIK B;  3T3M A;  3SJL D;  5FA5 B;  5C92 A;  1JMX B;  1OMW B;  4GQ2 P;  4Y7R A;  4BCB A;  4JXM A;  3MKS B;  4Z7O A;  3ODT A;  5IC7 A;  2P9I C;  4JSP C;  4QAM A;  4IA9 A;  2CN2 A;  3UVK A;  5EAL A;  3IUM A;  3BG1 A;  3VH0 A;  4K3J B;  5IJ7 E;  2H6K A;  3GRE A;  4O3U B;  3MVD K;  4AN1 A;  4HDJ A;  3EI4 A;  3EU7 A;  3I7H A;  2CNX A;  3VA6 A;  1VE6 A;  3EI1 A;  5FFO A;  3NIG A;  1H2Z A;  4X3E A;  1E8M A;  1GOH A;  5HE1 B;  4QT8 A;  4QL1 A;  5SXM A;  2VDP A;  3ZE0 A;  3CFV A;  4AEZ A;  1SQ9 A;  5AFU 3;  2WQ8 A;  5M5T A;  3PXW D;  4L3G D;  4GM9 A;  4Z7Q A;  3FGB A;  1XKS A;  4CI1 A;  4A2M A;  5FKQ A;  5FKS A;  2H13 A;  2Z2P A;  3IJ1 A;  3PE7 A;  5HE0 B;  1XHM A;  2EBS A;  4JSN C;  4EWR A;  2O9K A;  4Z8L A;  3KRW B;  4FA9 D;  2EIC A;  5E6S A;  5M5S A;  1VZ3 A;  1RI6 A;  2AQ5 A;  4KFM B;  3DDU A;  3EI1 B;  1YR2 A;  2B4E A;  3VI3 A;  2H9N A;  3K72 A;  3IJE A;  4X61 B;  5EMM B;  5C2V B;  3O4G A;  4J73 A;  4ES0 A;  2H9M A;  3MXX A;  4CY3 A;  2Z2O A;  1K8K C;  2P9L C;  3FCU A;  3C99 A;  3C75 H;  3EG6 A;  4GGD A;  2XYI A;  4BCD A;  5IGQ A;  1H2W A;  5TDH B;  2OK4 A;  5FXY A;  5GXH A;  4DNV A;  3FM0 A;  3ZWL B;  4NSX A;  3UKR C;  2I3S A;  4A11 A;  4J82 A;  5CXC B;  4A0B A;  2Z2N A;  5EAM A;  1JV2 A;  4OWR A;  5B4W A;  3UVM A;  4U1E I;  1GOG A;  5AMS A;  3OL2 A;  4J79 A;  5FKR A;  4NBM A;  3IUL A;  3JPX A;  3CFS B;  1QFS A;  3I89 A;  1BPO A;  4L3H D;  4PC0 A;  3ZDZ A;  1TYE A;  2AGX A;  4NAA A;  3SFZ A;  1JOF A;  2YB8 B;  1UOQ A;  2HKR A;  2IUR A;  5M61 A;  2CO0 A;  1TBG A;  4D6V A;  4ERQ A;  3FRX A;  2GC7 A;  3JB9 L;  4E54 A;  2AH0 A;  4U7A A;  3EI2 B;  2H14 A;  3T3P A;  3MMY A;  3SLE D;  3EI3 B;  3RLM D;  2OVR B;  3I7L A;  2VDL A;  1B9X A;  2XU7 A;  3OKW A;  4FWW A;  4A09 B;  2H68 A;  3V4V A;  2AH1 A;  3F3G A;  2YNO A;  4UM8 A;  3RRM C;  3OTT A;  2B5M A;  2AGW A;  4L1M A;  1R5M A;  2GC4 A;  4LG9 A;  5CXB B;  4RE5 A;  4TZ4 A;  4ERZ A;  2UZY B;  1UTC A;  3DXK C;  1L0Q A;  3F3P A;  5EMJ B;  5TF2 A;  3I2N A;  5AJA A;  5EM2 A;  4BL0 A;  3AH8 B;  2QC5 A;  1A12 A;  5HE2 B;  4J77 A;  5HQG A;  4CY2 A;  1SQJ A;  3B7F A;  3NIF A;  3MKQ A;  4FAN D;  1I2M B;  3JAM g;  3MUN A;  2PM7 B;  1JTD B;  4J78 A;  2PM6 B;  4XYH A;  2H3X A;  3OKY A;  3O4I A;  4CY5 A;  3J81 g;  4QQE A;  2IUV A;  5IT9 g;  5HE3 B;  4GGA A;  5FQD A;  4ZOX A;  2IAA A;  1U8C A;  3VGZ A;  3RN1 D;  1E8N A;  1XIP A;  5IGO A;  2XE4 A;  1VE7 A;  4JSV C;  3MZL A;  4K3I D;  3SCY A;  1QFM A;  5H1M A;  2AGL A;  4O02 A;  5CXB A;  1O6G A;  3KCI A;  1K32 A;  3I7P A;  3K26 A;  5E6R A;  2J56 H;  3SBR A;  3ULE C;  1N6F A;  4FAV D;  5FLX g;  2EIB A; 
#chains in the Genus database with same CATH homology
 4ZOV A;  4J0W A;  2W18 A;  2BBK H;  2OVQ B;  4GZ8 A;  4A08 A;  1FWX A;  2IWF A;  4CZX A;  4J84 A;  3UVO A;  1JMZ B;  5GXI A;  1MG2 A;  3EI3 A;  2MTA H;  2PM9 A;  2PBI B;  3RFH A;  3F3F A;  3EWE A;  4A0A A;  4O1Q D;  3OKY B;  2CN3 A;  4E54 B;  5C2W B;  4E5Z B;  4Y5R D;  3U4Y A;  4O45 A;  3IIW A;  3UKU C;  3RN0 D;  1B9Y A;  3JZH A;  3PXT D;  4CI3 A;  2AGZ A;  5I5M A;  2AGY A;  1PBY B;  2CO0 C;  5C9Z B;  2H9P A;  4CI8 A;  4I79 A;  2P9P C;  5TEE A;  2P9K C;  2Q7Q A;  4GGC A;  4FB1 D;  4A0B B;  1P22 A;  5H14 A;  4A11 B;  3IIY A;  2I3T A;  1GXR A;  3RMZ D;  3PSC B;  3JZN A;  3SXT D;  4O3T B;  4A7J A;  4FA4 D;  4PBY A;  2OVP B;  1NEX B;  3UVN A;  5CYK B;  2XL2 A;  5K1C C;  4H5J A;  3BWS A;  2HJ4 A;  3OKT A;  3RFG A;  2PM9 B;  3JRP A;  4JSX C;  2HKM A;  4N14 A;  2H9L A;  4H5I A;  3DXM C;  3A0F A;  2I0T A;  2UZX B;  3SVW D;  1GG2 B;  4YVD A;  4ZN4 A;  4A2L A;  4IMM A;  5I5J A;  3DM0 A;  4FHL A;  5GMK n;  4A08 B;  3P4F A;  3SWS D;  1VYH C;  3SBQ A;  5CXC A;  3IJC A;  4ZOY A;  5CYK A;  1PI6 A;  3K27 A;  4O9D A;  4L1Q D;  2G9A A;  3NVN A;  5EM2 B;  4G56 B;  5EAP A;  3N0D A;  4CC9 A;  2CE8 A;  3V9F A;  1PGU A;  4ESG A;  2H6Q A;  4QRJ A;  3E0C A;  5TEF A;  4E5Z A;  4OZU A;  4A0A B;  2YNP A;  4LG8 A;  4J8G A;  3SN6 B;  4PBZ A;  4ERY A;  2HJB A;  3KRX B;  3I7N A;  2J57 G;  3NVX A;  4J87 A;  3V5W B;  5EAR A;  3UR4 A;  3AL9 A;  3I8E A;  1OLZ A;  4D0K A;  2BCJ B;  5K19 A;  2B5L A;  1TYQ C;  5JWZ A;  4X63 B;  3HFQ A;  5EML B;  4MK0 B;  3C5M A;  2P9N C;  3PVW B;  4JT6 C;  2P9S C;  3EI2 A;  2IUQ A;  4CZY A;  3GFC A;  4J0X A;  1PEV A;  1Q47 A;  2QXV A;  3EMH A;  3SHF A;  5I5I A;  4J86 A;  1NR0 A;  2G99 A;  2HYE A;  4X60 B;  1U4C A;  3L4M D;  2YMU A;  3W15 A;  2I0S A;  2H47 A;  2B5N A;  4ZOZ A;  4LGN A;  4XEI C;  5IJ8 E;  2HXC A;  2OIZ A;  3I7O A;  1SHY B;  3OL2 B;  4GQB B;  2IWK A;  3PXS D;  3EI4 B;  4GMB A;  3IKO A;  3AL8 A;  3BG0 A;  1MDA H;  1QNI A;  3N0E A;  4PSX B;  4R7A B;  4FA5 D;  3OW8 A;  3DWL C;  2OJY A;  4CI2 A;  2YBA A;  2CE9 A;  4FA1 D;  4UI9 R;  5THA A;  4L9O A;  5EMK B;  3I7K A;  2H6N A;  4JT5 C;  2I0R A;  3DSM A;  2J55 H;  1JJU B;  3V7D B;  3SBP A;  2YNN A;  4A09 A;  3AL8 B;  2GNQ A;  4GM8 A;  5KDO B;  4XYI A;  4J8B A;  1GP2 B;  1N6E A;  4J81 A;  3IJ0 A;  4BUJ C;  2TRC B;  1N6D A;  4JD2 C;  2IUP A;  3RSE C;  3PSL A;  4PSW B;  3PVU B;  3NVQ A;  4GM3 A;  5A2Q g;  4BH6 A;  3JZG A;  1ERJ A;  2HES X;  4AOW A;  5FKT A;  5H17 A;  1MG3 A;  4PXW A;  3SMR A;  1S4U X;  1U2V C;  4CY1 A;  3AFC A;  1A0R B;  2P9U C;  4PNK B;  2OK6 A;  3MZK A;  5HYN B;  1GOT B;  4CZV A;  3J80 g;  2XL3 A;  3ORV D;  1YFQ A;  3I8C A;  3JRO A;  3UVL A;  5GSA A;  3C9C A;  3L4O D;  4GQ1 A;  3CIK B;  3SJL D;  5FA5 B;  1JMX B;  1OMW B;  4GQ2 P;  4Y7R A;  4JXM A;  3MKS B;  3ODT A;  5IC7 A;  2P9I C;  4JSP C;  4IA9 A;  2CN2 A;  3UVK A;  5EAL A;  3BG1 A;  3VH0 A;  4K3J B;  5IJ7 E;  2H6K A;  3GRE A;  4O3U B;  4HDJ A;  3EI4 A;  3EU7 A;  3I7H A;  2CNX A;  3VA6 A;  3EI1 A;  4X3E A;  5HE1 B;  4QT8 A;  4QL1 A;  5SXM A;  5AFU 3;  3CFV A;  4AEZ A;  1SQ9 A;  3PXW D;  4L3G D;  4GM9 A;  3FGB A;  1XKS A;  4CI1 A;  4A2M A;  5FKQ A;  5FKS A;  2H13 A;  2Z2P A;  3IJ1 A;  3PE7 A;  5HE0 B;  1XHM A;  2EBS A;  4JSN C;  4EWR A;  2O9K A;  4Z8L A;  3KRW B;  4FA9 D;  1RI6 A;  2AQ5 A;  4KFM B;  3EI1 B;  2B4E A;  2H9N A;  4X61 B;  5EMM B;  5C2V B;  4J73 A;  4ES0 A;  2H9M A;  3MXX A;  4CY3 A;  2Z2O A;  1K8K C;  2P9L C;  3C99 A;  3C75 H;  3EG6 A;  4GGD A;  2XYI A;  5IGQ A;  5TDH B;  2OK4 A;  5FXY A;  5GXH A;  3FM0 A;  3ZWL B;  4NSX A;  3UKR C;  2I3S A;  4A11 A;  4J82 A;  5CXC B;  4A0B A;  2Z2N A;  5EAM A;  4OWR A;  5B4W A;  3UVM A;  4U1E I;  5AMS A;  3OL2 A;  4J79 A;  5FKR A;  3JPX A;  3CFS B;  3I89 A;  4L3H D;  4PC0 A;  2AGX A;  3SFZ A;  1JOF A;  2YB8 B;  2HKR A;  2IUR A;  2CO0 A;  1TBG A;  4D6V A;  4ERQ A;  3FRX A;  2GC7 A;  3JB9 L;  4E54 A;  2AH0 A;  4U7A A;  3EI2 B;  2H14 A;  3MMY A;  3SLE D;  3EI3 B;  3RLM D;  2OVR B;  3I7L A;  1B9X A;  2XU7 A;  3OKW A;  4FWW A;  4A09 B;  2H68 A;  2AH1 A;  3F3G A;  2YNO A;  3RRM C;  3OTT A;  2B5M A;  2AGW A;  1R5M A;  2GC4 A;  4LG9 A;  5CXB B;  4ERZ A;  4TZ4 A;  2UZY B;  3DXK C;  3F3P A;  1L0Q A;  5EMJ B;  5TF2 A;  3I2N A;  5AJA A;  5EM2 A;  4BL0 A;  3AH8 B;  2QC5 A;  5HE2 B;  4J77 A;  5HQG A;  4CY2 A;  1SQJ A;  3B7F A;  3MKQ A;  4FAN D;  3JAM g;  2PM7 B;  4J78 A;  2PM6 B;  4XYH A;  2H3X A;  3OKY A;  4CY5 A;  3J81 g;  4QQE A;  2IUV A;  5IT9 g;  5HE3 B;  4GGA A;  5FQD A;  4ZOX A;  2IAA A;  3VGZ A;  3RN1 D;  1XIP A;  5IGO A;  4JSV C;  3MZL A;  4K3I D;  3SCY A;  5H1M A;  2AGL A;  5CXB A;  1K32 A;  3I7P A;  3K26 A;  3ULE C;  2J56 H;  3SBR A;  5FLX g;  1N6F A;  4FAV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...