2I3SA

Bub3 complex with bub1 glebs motif
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
340
structure length
334
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell cycle arrest protein
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 334
sequence length 340
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3sA00
3RFHA 4X61B 5GMKn 5CYKB 3GFCA 3DM0A 5IGOA 4ZOXA 3RN0D 4GQBB 5CYKA 3N0DA 2I3SA 4CY2A 5C2VB 3EU7A 1GOTB 3JZHA 4O9DA 2QC5A 4A09A 2PM6B 3SLED 4GZ8A 4E54B 2H9LA 4U7AA 3EI1B 3PE7A 3F3PA 4QQEA 5C9ZB 4E54A 2H6QA 4H5IA 4FAVD 3CIKB 1JOFA 3BWSA 4PXWA 3VGZA 3AL9A 2AH1A 5TEFA 2YMUA 2Q7QA 2H13A 5TEEA 1XIPA 2Z2NA 2IUPA 4FA4D 3CFSB 2OK6A 2OK4A 2CE9A 3FM0A 3FGBA 5EMLB 2OJYA 5EARA 3IKOA 1NR0A 3ODTA 3OKTA 3L4OD 4O1QD 4E5ZA 5EMKB 5CXBA 2H3XA 3I7PA 3RRMC 5HE1B 5H14A 3IIWA 4ES0A 2CO0A 3OKYA 2EBSA 4BH6A 3V5WB 4JXMA 1K32A 4A0BB 3RSEC 4A0AB 1S4UX 2AGXA 1N6EA 5EAPA 3ULEC 3EMHA 5I5IA 3MKSB 5H1MA 3SCYA 5B4WA 2B4EA 3I7KA 2QXVA 5TDHB 2OVQB 3NVQA 1OLZA 4ERQA 4CI8A 3K26A 3SHFA 1SHYB 3PSCB 1B9YA 3PXWD 2PM9A 1TYQC 4N14A 4OWRA 3I7NA 2AGWA 3L4MD 2TRCB 4A2LA 3RN1D 3RFGA 3PXSD 3I7HA 2XL2A 2GNQA 5EAMA 1JMZB 3EG6A 4JSXC 4ERYA 5I5JA 1K8KC 5AMSA 1A0RB 3E0CA 1PI6A 2J57G 2YNOA 4X63B 5EALA 1SQ9A 4J77A 3AL8A 4J79A 1YFQA 4JT6C 5CXCB 2IUVA 3NVXA 1GXRA 2P9PC 3UKUC 3KRXB 4J8BA 2P9IC 5AFU3 4FA1D 4K3ID 4U1EI 3SMRA 3EI2A 4FA5D 2CN2A 4FA9D 2CO0C 4A2MA 2CE8A 4CI3A 2H9NA 3I7OA 5HQGA 2HESX 2P9LC 1JMXB 4ZOYA 3EI3A 4BUJC 4OZUA 4FB1D 2B5LA 4L3HD 4A09B 4EWRA 2H68A 3UR4A 5EM2A 2J56H 1XKSA 4QL1A 2P9KC 3J81g 5FLXg 5HE2B 2OIZA 4HDJA 2H9MA 5IGQA 2Z2PA 5FXYA 1R5MA 3EI4B 2YBAA 3ZWLB 2HKMA 4J78A 4JD2C 2AQ5A 2XYIA 5I5MA 3EI4A 4GMBA 3EWEA 1PEVA 5A2Qg 3BG0A 3SN6B 1MG3A 4LG9A 1ERJA 3IJ0A 4QT8A 2IWKA 1XHMA 1MDAH 5KDOB 3JZGA 4O3UB 5IJ7E 2PM7B 2MTAH 4J86A 4GGDA 5EMJB 4JSVC 4E5ZB 5FKSA 4KFMB 5CXBB 3SWSD 3SXTD 3SBRA 1B9XA 3OKYB 3JROA 5SXMA 3JRPA 2YNPA 4J82A 1SQJA 3FRXA 4J87A 4IMMA 4G56B 3I89A 3VH0A 4LG8A 5HYNB 5IT9g 3IJCA 3RMZD 4IA9A 4JSPC 4XYIA 3GREA 3UVOA 4I79A 2BBKH 3W15A 5AJAA 4CC9A 2PM9B 4J0WA 3N0EA 2P9NC 1PGUA 3UVKA 1U4CA 4GM8A 4PC0A 1N6DA 2B5MA 3F3GA 4BL0A 3PXTD 4A08B 4J81A 2AH0A 2HYEA 4J8GA 4A08A 1FWXA 3AL8B 3A0FA 2HXCA 4UI9R 1OMWB 4ERZA 3B7FA 3JZNA 4FHLA 1L0QA 2H6NA 1VYHC 2H47A 2XL3A 3MXXA 3DSMA 3UKRC 2XU7A 5GXIA 3EI2B 3BG1A 4XEIC 4A7JA 5IJ8E 3SJLD 2J55H 5JWZA 3P4FA 5C2WB 4PBZA 4O45A 3EI3B 3AFCA 4PNKB 1MG2A 3C9CA 5FKRA 2B5NA 3NVNA 5EM2B 3F3FA 2PBIB 2G99A 3OTTA 3JB9L 4ESGA 3C75H 1N6FA 1TBGA 4FWWA 4CI2A 3MMYA 4K3JB 4PSXB 5FKQA 2I0TA 2UZYB 3DWLC 4NSXA 3RLMD 4ZOVA 3MZLA 4D6VA 4J84A 2HJ4A 3PVUB 4YVDA 5TF2A 1NEXB 3MKQA 3I7LA 4AEZA 3JAMg 5GXHA 2G9AA 4GQ1A 3SBPA 2UZXB 3IJ1A 3ORVD 3JPXA 5EMMB 3J80g 3UVNA 4PSWB 5FQDA 2OVPB 3U4YA 3V7DB 3KRWB 4TZ4A 2H14A 3EI1A 4J73A 3OW8A 4H5JA 3UVLA 4X3EA 2I0SA 4PBYA 2P9UC 2W18A 3I8CA 4CZXA 4CZYA 2O9KA 2P9SC 4AOWA 4GGAA 2IWFA 4GQ2P 4LGNA 4CI1A 4MK0B 1JJUB 1QNIA 3DXKC 4L9OA 4ZOZA 4FAND 3DXMC 5FKTA 4A11B 4L1QD 4R7AB 5HE3B 3IIYA 5THAA 4JSNC 4A11A 2AGYA 2YNNA 4Y7RA 4CY3A 4D0KA 3UVMA 3K27A 4A0BA 5HE0B 1RI6A 2HKRA 4A0AA 5K1CC 1PBYB 4Y5RD 3AH8B 2I0RA 2IURA 2CNXA 2YB8B 3VA6A 3PSLA 3C5MA 2AGLA 2Z2OA 2CN3A 2H6KA 3CFVA 2AGZA 5GSAA 1Q47A 4XYHA 3HFQA 4CY5A 2GC4A 4GM3A 5IC7A 3I8EA 4J0XA 2I3TA 4CZVA 4X60B 1U2VC 2IUQA 4ZN4A 4GGCA 4L3GD 3OL2B 3OKWA 3V9FA 2BCJB 5FA5B 1GG2B 3I2NA 2HJBA 3OL2A 2H9PA 4CY1A 1GP2B 4Z8LA 3C99A 3SVWD 5CXCA 2OVRB 3PVWB 5K19A 4O3TB 5H17A 4QRJA 3SFZA 1P22A 2IAAA 2GC7A 4GM9A 4JT5C 3MZKA 3SBQA
chains in the Genus database with same CATH superfamily
5E6SA 3RFHA 3V4PA 4X61B 5GMKn 5CYKB 3GFCA 4IRZA 3DM0A 2EIEA 5IGOA 4ZOXA 3RN0D 4GQBB 3VI4A 5CYKA 3N0DA 5M5UA 2I3SA 4CY2A 4QAMA 5C2VB 3EU7A 1U8CA 1GOTB 3JZHA 4O9DA 3O4JA 2QC5A 3ZDYA 3K6SA 4A09A 2PM6B 4RE5A 3SLED 4GZ8A 4E54B 2H9LA 4U7AA 3EI1B 3PE7A 1TYEA 3F3PA 4QQEA 5M5RA 5C9ZB 4E54A 2H6QA 4H5IA 4MMXA 4FAVD 3CIKB 1JOFA 3BWSA 4PXWA 3VGZA 3AL9A 2AH1A 4NBMA 4BCDA 5TEFA 2YMUA 2Q7QA 2H13A 5TEEA 1XIPA 2Z2NA 4WK0A 2IUPA 4FA4D 3CFSB 1UOOA 2OK6A 2OK4A 2VDOA 2CE9A 3FM0A 3FGBA 5EMLB 3NIFA 2OJYA 5EARA 3IKOA 1NR0A 3ODTA 3OKTA 3L4OD 4O1QD 4E5ZA 5EMKB 5CXBA 2H3XA 4AMYA 3EQ9A 3I7PA 3RRMC 5HE1B 3MVDK 5H14A 3IIWA 4ES0A 2CO0A 3OKYA 2EBSA 2VDMA 4BH6A 3V5WB 4JXMA 1K32A 5E6UA 4A0BB 3RSEC 4A0AB 1S4UX 2AGXA 1N6EA 5EAPA 3ULEC 3EMHA 5I5IA 3MKSB 2QZPA 5H1MA 3SCYA 5B4WA 2B4EA 1I2MB 1VZ3A 3I7KA 2QXVA 5TDHB 1GOHA 2OVQB 3NVQA 1OLZA 4ERQA 4CI8A 3K26A 3SHFA 1SHYB 3PSCB 1JTDB 1B9YA 1UTCA 3PXWD 2PM9A 1K3IA 4Z7QA 1TYQC 4N14A 4OWRA 3I7NA 2AGWA 2XZGA 3L4MD 2TRCB 4A2LA 3RN1D 3RFGA 4BCCA 3PXSD 3I7HA 2XL2A 2GNQA 5EAMA 1JMZB 3EG6A 4JSXC 4ERYA 5I5JA 1K8KC 5AMSA 1A0RB 3E0CA 1PI6A 2J57G 1L5GA 2YNOA 4X63B 5HDBA 5EALA 1SQ9A 4J77A 3FCSA 3AL8A 4J79A 1YFQA 4JT6C 5CXCB 2IUVA 1BPOA 3NVXA 1GXRA 4AN0A 2VDKA 2P9PC 3UKUC 4JHNA 3KRXB 2XE4A 4J8BA 1E5TA 2BKLA 2P9IC 5AFU3 4FA1D 4K3ID 4U1EI 3SMRA 3EI2A 4FA5D 2CN2A 4FA9D 2CO0C 4A2MA 2CE8A 4CI3A 2H9NA 3I7OA 4DNVA 5HQGA 2EICA 3GC3B 4RE6A 2HESX 2P9LC 1JMXB 4ZOYA 1E8MA 3EI3A 4BUJC 4OZUA 4FB1D 2B5LA 2VZ1A 5C92A 4L3HD 4A09B 4EWRA 2H68A 3UR4A 3NIDA 5EM2A 1O6GA 2J56H 1XKSA 4QL1A 2P9KC 3J81g 5FLXg 1UOPA 4L1MA 5HE2B 2OIZA 4HDJA 4O02A 2H9MA 5IGQA 2Z2PA 5FXYA 1R5MA 3EI4B 2YBAA 3ZWLB 2HKMA 3IVMA 4J78A 4JD2C 2AQ5A 2XYIA 5I5MA 3EI4A 4GMBA 4WJKA 4BP9A 3EWEA 1PEVA 5A2Qg 2EIBA 3T3PA 3BG0A 3SN6B 1MG3A 4WK2A 2HU7A 4LG9A 1ERJA 3QI0A 1A12A 3IJ0A 4QT8A 1GOGA 2IWKA 1XHMA 2WQ8A 1MDAH 5KDOB 3OF7A 3JZGA 4O3UB 5IJ7E 2PM7B 2VDNA 2MTAH 4J86A 2VZ3A 4GGDA 4UM9A 5EMJB 4JSVC 4E5ZB 5FKSA 4KFMB 5CXBB 2VC2A 3SWSD 3SXTD 3SBRA 3ZE0A 1B9XA 3OKYB 3JROA 4AN1A 2HU8A 3FCUA 2VDLA 5SXMA 3JRPA 2YNPA 5M5TA 4J82A 1SQJA 1VZ2A 3FRXA 4J87A 4IMMA 4G56B 4G55A 3O4IA 3I89A 3VH0A 4LG8A 5HYNB 3IUQA 4BCBA 5IT9g 1VE7A 1UOQA 3IJCA 1C9LA 3ZE1A 3QHYB 1C9IA 3IUMA 4IA9A 3RMZD 4JSPC 4AMZA 4XYIA 3O4GA 3GREA 3UVOA 4I79A 2BBKH 3W15A 4G1MA 5AJAA 4CC9A 2PM9B 4MMZA 4J0WA 3N0EA 2P9NC 1PGUA 3UVKA 1U4CA 1YR2A 4GM8A 4PC0A 2VDRA 1N6DA 2B5MA 3F3GA 4BL0A 3IULA 3PXTD 4A08B 4BP8A 4J81A 2AH0A 2HYEA 5M5VA 1QFMA 4J8GA 1T2XA 4A08A 3GD1I 1FWXA 3AL8B 3DDUA 3A0FA 2HXCA 4UI9R 1OMWB 4ERZA 3B7FA 3JZNA 4FHLA 2VDQA 1L0QA 2H6NA 1VYHC 2H47A 3IJEA 2XL3A 3VI3A 4AX4A 3MXXA 3DSMA 3O4HA 3UKRC 5C86A 2XU7A 5GXIA 3EI2B 3BG1A 4XEIC 4O2WA 4A7JA 5IJ8E 3SJLD 2J55H 5JWZA 3P4FA 5C2WB 1M1XA 4PBZA 4D9SA 2JKXA 3NIGA 3ZE2A 4O45A 3EI3B 3AFCA 4PNKB 1MG2A 3C9CA 5FKRA 2B5NA 3NVNA 4DNUA 5EM2B 3F3FA 2PBIB 2G99A 3OTTA 3JB9L 4ESGA 3C75H 5E6RA 1N6FA 1TBGA 4FWWA 4CI2A 3MMYA 4K3JB 4PSXB 5FKQA 2I0TA 2UZYB 4Z7NA 1H2WA 4WK4A 3DWLC 4NSXA 3RLMD 4ZOVA 3MZLA 1H2XA 4J84A 4D6VA 2HJ4A 3PVUB 4YVDA 3MUNA 5TF2A 1QFSA 1NEXB 5M5SA 3MKQA 3I7LA 4AEZA 3JAMg 5GXHA 2G9AA 4GQ1A 3SBPA 3IUJA 3V4VA 2UZXB 3IJ1A 3ORVD 3JPXA 5EMMB 3J80g 3UVNA 3EQ7A 1E8NA 3KCIA 5FFGA 4PSWB 5FQDA 2OVPB 3U4YA 3MUOA 3V7DB 3KRWB 4TZ4A 4NAAA 2H14A 5FFOA 3EI1A 4J73A 3OW8A 4H5JA 3UVLA 3ZDXA 1O6FA 4X3EA 2I0SA 4PBYA 2P9UC 2W18A 2EIDA 2VDPA 3I8CA 4CZXA 4CZYA 2O9KA 2P9SC 4AOWA 3K72A 4GGAA 2IWFA 4GQ2P 4LGNA 1VE6A 4CI1A 4MK0B 1JJUB 1QNIA 3DXKC 1H2YA 4L9OA 4ZOZA 4FAND 3DXMC 5FKTA 4A11B 4L1QD 3IURA 3IUNA 4R7AB 5HE3B 3IIYA 5THAA 4JSNC 4A11A 2AGYA 4Z7OA 4NC4A 2YNNA 4Y7RA 4CY3A 4D0KA 4UM8A 3UVMA 3K27A 4A0BA 5HE0B 1RI6A 2HKRA 4A0AA 5K1CC 1PBYB 4Y5RD 3AH8B 2I0RA 3ZDZA 2IURA 2CNXA 2YB8B 3VA6A 3PSLA 3C5MA 4DNWA 2AGLA 1JV2A 2Z2OA 4JHPC 2CN3A 2H6KA 3CFVA 2AGZA 5GSAA 1Q47A 3EQ8A 4XYHA 3HFQA 2HU5A 5M61A 4CY5A 2GC4A 4GM3A 5IC7A 3I8EA 4J0XA 2I3TA 4CZVA 4X60B 1U2VC 2IUQA 4ZN4A 4GGCA 4MMYA 4L3GD 1H2ZA 3OL2B 3OKWA 3V9FA 2BCJB 5FA5B 1GG2B 3I2NA 2HJBA 3OL2A 2H9PA 4CY1A 1GP2B 3T3MA 4Z8LA 3C99A 3SVWD 2XDWA 5CXCA 2OVRB 3PVWB 3K71A 5K19A 4O3TB 5H17A 4NENA 4QRJA 3SFZA 1P22A 1GOFA 2IAAA 2GC7A 4GM9A 4G1EA 4JT5C 3MZKA 3SBQA 2QR5A
chains in the Genus database with same CATH topology
3RFHA 4X61B 5GMKn 5CYKB 3GFCA 3DM0A 5IGOA 4ZOXA 3RN0D 4GQBB 5CYKA 3N0DA 2I3SA 4CY2A 5C2VB 3EU7A 1GOTB 3JZHA 4O9DA 2QC5A 4A09A 2PM6B 3SLED 4GZ8A 4E54B 2H9LA 4U7AA 3EI1B 3PE7A 3F3PA 4QQEA 5C9ZB 4E54A 2H6QA 4H5IA 4FAVD 3CIKB 1JOFA 3BWSA 4PXWA 3VGZA 3AL9A 2AH1A 5TEFA 2YMUA 2Q7QA 2H13A 5TEEA 1XIPA 2Z2NA 2IUPA 4FA4D 3CFSB 2OK6A 2OK4A 2CE9A 3FM0A 3FGBA 5EMLB 2OJYA 5EARA 3IKOA 1NR0A 3ODTA 3OKTA 3L4OD 4O1QD 4E5ZA 5EMKB 5CXBA 2H3XA 3I7PA 3RRMC 5HE1B 5H14A 3IIWA 4ES0A 2CO0A 3OKYA 2EBSA 4BH6A 3V5WB 4JXMA 1K32A 4A0BB 3RSEC 4A0AB 1S4UX 2AGXA 1N6EA 5EAPA 3ULEC 3EMHA 5I5IA 3MKSB 5H1MA 3SCYA 5B4WA 2B4EA 3I7KA 2QXVA 5TDHB 2OVQB 3NVQA 1OLZA 4ERQA 4CI8A 3K26A 3SHFA 1SHYB 3PSCB 1B9YA 3PXWD 2PM9A 1TYQC 4N14A 4OWRA 3I7NA 2AGWA 3L4MD 2TRCB 4A2LA 3RN1D 3RFGA 3PXSD 3I7HA 2XL2A 2GNQA 5EAMA 1JMZB 3EG6A 4JSXC 4ERYA 5I5JA 1K8KC 5AMSA 1A0RB 3E0CA 1PI6A 2J57G 2YNOA 4X63B 5EALA 1SQ9A 4J77A 3AL8A 4J79A 1YFQA 4JT6C 5CXCB 2IUVA 3NVXA 1GXRA 2P9PC 3UKUC 3KRXB 4J8BA 2P9IC 5AFU3 4FA1D 4K3ID 4U1EI 3SMRA 3EI2A 4FA5D 2CN2A 4FA9D 2CO0C 4A2MA 2CE8A 4CI3A 2H9NA 3I7OA 5HQGA 2HESX 2P9LC 1JMXB 4ZOYA 3EI3A 4BUJC 4OZUA 4FB1D 2B5LA 4L3HD 4A09B 4EWRA 2H68A 3UR4A 5EM2A 2J56H 1XKSA 4QL1A 2P9KC 3J81g 5FLXg 5HE2B 2OIZA 4HDJA 2H9MA 5IGQA 2Z2PA 5FXYA 1R5MA 3EI4B 2YBAA 3ZWLB 2HKMA 4J78A 4JD2C 2AQ5A 2XYIA 5I5MA 3EI4A 4GMBA 3EWEA 1PEVA 5A2Qg 3BG0A 3SN6B 1MG3A 4LG9A 1ERJA 3IJ0A 4QT8A 2IWKA 1XHMA 1MDAH 5KDOB 3JZGA 4O3UB 5IJ7E 2PM7B 2MTAH 4J86A 4GGDA 5EMJB 4JSVC 4E5ZB 5FKSA 4KFMB 5CXBB 3SWSD 3SXTD 3SBRA 1B9XA 3OKYB 3JROA 5SXMA 3JRPA 2YNPA 4J82A 1SQJA 3FRXA 4J87A 4IMMA 4G56B 3I89A 3VH0A 4LG8A 5HYNB 5IT9g 3IJCA 3RMZD 4IA9A 4JSPC 4XYIA 3GREA 3UVOA 4I79A 2BBKH 3W15A 5AJAA 4CC9A 2PM9B 4J0WA 3N0EA 2P9NC 1PGUA 3UVKA 1U4CA 4GM8A 4PC0A 1N6DA 2B5MA 3F3GA 4BL0A 3PXTD 4A08B 4J81A 2AH0A 2HYEA 4J8GA 4A08A 1FWXA 3AL8B 3A0FA 2HXCA 4UI9R 1OMWB 4ERZA 3B7FA 3JZNA 4FHLA 1L0QA 2H6NA 1VYHC 2H47A 2XL3A 3MXXA 3DSMA 3UKRC 2XU7A 5GXIA 3EI2B 3BG1A 4XEIC 4A7JA 5IJ8E 3SJLD 2J55H 5JWZA 3P4FA 5C2WB 4PBZA 4O45A 3EI3B 3AFCA 4PNKB 1MG2A 3C9CA 5FKRA 2B5NA 3NVNA 5EM2B 3F3FA 2PBIB 2G99A 3OTTA 3JB9L 4ESGA 3C75H 1N6FA 1TBGA 4FWWA 4CI2A 3MMYA 4K3JB 4PSXB 5FKQA 2I0TA 2UZYB 3DWLC 4NSXA 3RLMD 4ZOVA 3MZLA 4D6VA 4J84A 2HJ4A 3PVUB 4YVDA 5TF2A 1NEXB 3MKQA 3I7LA 4AEZA 3JAMg 5GXHA 2G9AA 4GQ1A 3SBPA 2UZXB 3IJ1A 3ORVD 3JPXA 5EMMB 3J80g 3UVNA 4PSWB 5FQDA 2OVPB 3U4YA 3V7DB 3KRWB 4TZ4A 2H14A 3EI1A 4J73A 3OW8A 4H5JA 3UVLA 4X3EA 2I0SA 4PBYA 2P9UC 2W18A 3I8CA 4CZXA 4CZYA 2O9KA 2P9SC 4AOWA 4GGAA 2IWFA 4GQ2P 4LGNA 4CI1A 4MK0B 1JJUB 1QNIA 3DXKC 4L9OA 4ZOZA 4FAND 3DXMC 5FKTA 4A11B 4L1QD 4R7AB 5HE3B 3IIYA 5THAA 4JSNC 4A11A 2AGYA 2YNNA 4Y7RA 4CY3A 4D0KA 3UVMA 3K27A 4A0BA 5HE0B 1RI6A 2HKRA 4A0AA 5K1CC 1PBYB 4Y5RD 3AH8B 2I0RA 2IURA 2CNXA 2YB8B 3VA6A 3PSLA 3C5MA 2AGLA 2Z2OA 2CN3A 2H6KA 3CFVA 2AGZA 5GSAA 1Q47A 4XYHA 3HFQA 4CY5A 2GC4A 4GM3A 5IC7A 3I8EA 4J0XA 2I3TA 4CZVA 4X60B 1U2VC 2IUQA 4ZN4A 4GGCA 4L3GD 3OL2B 3OKWA 3V9FA 2BCJB 5FA5B 1GG2B 3I2NA 2HJBA 3OL2A 2H9PA 4CY1A 1GP2B 4Z8LA 3C99A 3SVWD 5CXCA 2OVRB 3PVWB 5K19A 4O3TB 5H17A 4QRJA 3SFZA 1P22A 2IAAA 2GC7A 4GM9A 4JT5C 3MZKA 3SBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFH A;  4X61 B;  5GMK n;  5CYK B;  3GFC A;  3DM0 A;  5IGO A;  4ZOX A;  3RN0 D;  4GQB B;  5CYK A;  3N0D A;  2I3S A;  4CY2 A;  5C2V B;  3EU7 A;  1GOT B;  3JZH A;  4O9D A;  2QC5 A;  4A09 A;  2PM6 B;  3SLE D;  4GZ8 A;  4E54 B;  2H9L A;  4U7A A;  3EI1 B;  3PE7 A;  3F3P A;  4QQE A;  5C9Z B;  4E54 A;  2H6Q A;  4H5I A;  4FAV D;  3CIK B;  1JOF A;  3BWS A;  4PXW A;  3VGZ A;  3AL9 A;  2AH1 A;  5TEF A;  2YMU A;  2Q7Q A;  2H13 A;  5TEE A;  1XIP A;  2Z2N A;  2IUP A;  4FA4 D;  3CFS B;  2OK6 A;  2OK4 A;  2CE9 A;  3FM0 A;  3FGB A;  5EML B;  2OJY A;  5EAR A;  3IKO A;  1NR0 A;  3ODT A;  3OKT A;  3L4O D;  4O1Q D;  4E5Z A;  5EMK B;  5CXB A;  2H3X A;  3I7P A;  3RRM C;  5HE1 B;  5H14 A;  3IIW A;  4ES0 A;  2CO0 A;  3OKY A;  2EBS A;  4BH6 A;  3V5W B;  4JXM A;  1K32 A;  4A0B B;  3RSE C;  4A0A B;  1S4U X;  2AGX A;  1N6E A;  5EAP A;  3ULE C;  3EMH A;  5I5I A;  3MKS B;  5H1M A;  3SCY A;  5B4W A;  2B4E A;  3I7K A;  2QXV A;  5TDH B;  2OVQ B;  3NVQ A;  1OLZ A;  4ERQ A;  4CI8 A;  3K26 A;  3SHF A;  1SHY B;  3PSC B;  1B9Y A;  3PXW D;  2PM9 A;  1TYQ C;  4N14 A;  4OWR A;  3I7N A;  2AGW A;  3L4M D;  2TRC B;  4A2L A;  3RN1 D;  3RFG A;  3PXS D;  3I7H A;  2XL2 A;  2GNQ A;  5EAM A;  1JMZ B;  3EG6 A;  4JSX C;  4ERY A;  5I5J A;  1K8K C;  5AMS A;  1A0R B;  3E0C A;  1PI6 A;  2J57 G;  2YNO A;  4X63 B;  5EAL A;  1SQ9 A;  4J77 A;  3AL8 A;  4J79 A;  1YFQ A;  4JT6 C;  5CXC B;  2IUV A;  3NVX A;  1GXR A;  2P9P C;  3UKU C;  3KRX B;  4J8B A;  2P9I C;  5AFU 3;  4FA1 D;  4K3I D;  4U1E I;  3SMR A;  3EI2 A;  4FA5 D;  2CN2 A;  4FA9 D;  2CO0 C;  4A2M A;  2CE8 A;  4CI3 A;  2H9N A;  3I7O A;  5HQG A;  2HES X;  2P9L C;  1JMX B;  4ZOY A;  3EI3 A;  4BUJ C;  4OZU A;  4FB1 D;  2B5L A;  4L3H D;  4A09 B;  4EWR A;  2H68 A;  3UR4 A;  5EM2 A;  2J56 H;  1XKS A;  4QL1 A;  2P9K C;  3J81 g;  5FLX g;  5HE2 B;  2OIZ A;  4HDJ A;  2H9M A;  5IGQ A;  2Z2P A;  5FXY A;  1R5M A;  3EI4 B;  2YBA A;  3ZWL B;  2HKM A;  4J78 A;  4JD2 C;  2AQ5 A;  2XYI A;  5I5M A;  3EI4 A;  4GMB A;  3EWE A;  1PEV A;  5A2Q g;  3BG0 A;  3SN6 B;  1MG3 A;  4LG9 A;  1ERJ A;  3IJ0 A;  4QT8 A;  2IWK A;  1XHM A;  1MDA H;  5KDO B;  3JZG A;  4O3U B;  5IJ7 E;  2PM7 B;  2MTA H;  4J86 A;  4GGD A;  5EMJ B;  4JSV C;  4E5Z B;  5FKS A;  4KFM B;  5CXB B;  3SWS D;  3SXT D;  3SBR A;  1B9X A;  3OKY B;  3JRO A;  5SXM A;  3JRP A;  2YNP A;  4J82 A;  1SQJ A;  3FRX A;  4J87 A;  4IMM A;  4G56 B;  3I89 A;  3VH0 A;  4LG8 A;  5HYN B;  5IT9 g;  3IJC A;  3RMZ D;  4IA9 A;  4JSP C;  4XYI A;  3GRE A;  3UVO A;  4I79 A;  2BBK H;  3W15 A;  5AJA A;  4CC9 A;  2PM9 B;  4J0W A;  3N0E A;  2P9N C;  1PGU A;  3UVK A;  1U4C A;  4GM8 A;  4PC0 A;  1N6D A;  2B5M A;  3F3G A;  4BL0 A;  3PXT D;  4A08 B;  4J81 A;  2AH0 A;  2HYE A;  4J8G A;  4A08 A;  1FWX A;  3AL8 B;  3A0F A;  2HXC A;  4UI9 R;  1OMW B;  4ERZ A;  3B7F A;  3JZN A;  4FHL A;  1L0Q A;  2H6N A;  1VYH C;  2H47 A;  2XL3 A;  3MXX A;  3DSM A;  3UKR C;  2XU7 A;  5GXI A;  3EI2 B;  3BG1 A;  4XEI C;  4A7J A;  5IJ8 E;  3SJL D;  2J55 H;  5JWZ A;  3P4F A;  5C2W B;  4PBZ A;  4O45 A;  3EI3 B;  3AFC A;  4PNK B;  1MG2 A;  3C9C A;  5FKR A;  2B5N A;  3NVN A;  5EM2 B;  3F3F A;  2PBI B;  2G99 A;  3OTT A;  3JB9 L;  4ESG A;  3C75 H;  1N6F A;  1TBG A;  4FWW A;  4CI2 A;  3MMY A;  4K3J B;  4PSX B;  5FKQ A;  2I0T A;  2UZY B;  3DWL C;  4NSX A;  3RLM D;  4ZOV A;  3MZL A;  4D6V A;  4J84 A;  2HJ4 A;  3PVU B;  4YVD A;  5TF2 A;  1NEX B;  3MKQ A;  3I7L A;  4AEZ A;  3JAM g;  5GXH A;  2G9A A;  4GQ1 A;  3SBP A;  2UZX B;  3IJ1 A;  3ORV D;  3JPX A;  5EMM B;  3J80 g;  3UVN A;  4PSW B;  5FQD A;  2OVP B;  3U4Y A;  3V7D B;  3KRW B;  4TZ4 A;  2H14 A;  3EI1 A;  4J73 A;  3OW8 A;  4H5J A;  3UVL A;  4X3E A;  2I0S A;  4PBY A;  2P9U C;  2W18 A;  3I8C A;  4CZX A;  4CZY A;  2O9K A;  2P9S C;  4AOW A;  4GGA A;  2IWF A;  4GQ2 P;  4LGN A;  4CI1 A;  4MK0 B;  1JJU B;  1QNI A;  3DXK C;  4L9O A;  4ZOZ A;  4FAN D;  3DXM C;  5FKT A;  4A11 B;  4L1Q D;  4R7A B;  5HE3 B;  3IIY A;  5THA A;  4JSN C;  4A11 A;  2AGY A;  2YNN A;  4Y7R A;  4CY3 A;  4D0K A;  3UVM A;  3K27 A;  4A0B A;  5HE0 B;  1RI6 A;  2HKR A;  4A0A A;  5K1C C;  1PBY B;  4Y5R D;  3AH8 B;  2I0R A;  2IUR A;  2CNX A;  2YB8 B;  3VA6 A;  3PSL A;  3C5M A;  2AGL A;  2Z2O A;  2CN3 A;  2H6K A;  3CFV A;  2AGZ A;  5GSA A;  1Q47 A;  4XYH A;  3HFQ A;  4CY5 A;  2GC4 A;  4GM3 A;  5IC7 A;  3I8E A;  4J0X A;  2I3T A;  4CZV A;  4X60 B;  1U2V C;  2IUQ A;  4ZN4 A;  4GGC A;  4L3G D;  3OL2 B;  3OKW A;  3V9F A;  2BCJ B;  5FA5 B;  1GG2 B;  3I2N A;  2HJB A;  3OL2 A;  2H9P A;  4CY1 A;  1GP2 B;  4Z8L A;  3C99 A;  3SVW D;  5CXC A;  2OVR B;  3PVW B;  5K19 A;  4O3T B;  5H17 A;  4QRJ A;  3SFZ A;  1P22 A;  2IAA A;  2GC7 A;  4GM9 A;  4JT5 C;  3MZK A;  3SBQ A; 
#chains in the Genus database with same CATH topology
 5E6S A;  3RFH A;  3V4P A;  4X61 B;  5GMK n;  5CYK B;  3GFC A;  4IRZ A;  3DM0 A;  2EIE A;  5IGO A;  4ZOX A;  3RN0 D;  4GQB B;  3VI4 A;  5CYK A;  3N0D A;  5M5U A;  2I3S A;  4CY2 A;  4QAM A;  5C2V B;  3EU7 A;  1U8C A;  1GOT B;  3JZH A;  4O9D A;  3O4J A;  2QC5 A;  3ZDY A;  3K6S A;  4A09 A;  2PM6 B;  4RE5 A;  3SLE D;  4GZ8 A;  4E54 B;  2H9L A;  4U7A A;  3EI1 B;  3PE7 A;  1TYE A;  3F3P A;  4QQE A;  5M5R A;  5C9Z B;  4E54 A;  2H6Q A;  4H5I A;  4MMX A;  4FAV D;  3CIK B;  1JOF A;  3BWS A;  4PXW A;  3VGZ A;  3AL9 A;  2AH1 A;  4NBM A;  4BCD A;  5TEF A;  2YMU A;  2Q7Q A;  2H13 A;  5TEE A;  1XIP A;  2Z2N A;  4WK0 A;  2IUP A;  4FA4 D;  3CFS B;  1UOO A;  2OK6 A;  2OK4 A;  2VDO A;  2CE9 A;  3FM0 A;  3FGB A;  5EML B;  3NIF A;  2OJY A;  5EAR A;  3IKO A;  1NR0 A;  3ODT A;  3OKT A;  3L4O D;  4O1Q D;  4E5Z A;  5EMK B;  5CXB A;  2H3X A;  4AMY A;  3EQ9 A;  3I7P A;  3RRM C;  5HE1 B;  3MVD K;  5H14 A;  3IIW A;  4ES0 A;  2CO0 A;  3OKY A;  2EBS A;  2VDM A;  4BH6 A;  3V5W B;  4JXM A;  1K32 A;  5E6U A;  4A0B B;  3RSE C;  4A0A B;  1S4U X;  2AGX A;  1N6E A;  5EAP A;  3ULE C;  3EMH A;  5I5I A;  3MKS B;  2QZP A;  5H1M A;  3SCY A;  5B4W A;  2B4E A;  1I2M B;  1VZ3 A;  3I7K A;  2QXV A;  5TDH B;  1GOH A;  2OVQ B;  3NVQ A;  1OLZ A;  4ERQ A;  4CI8 A;  3K26 A;  3SHF A;  1SHY B;  3PSC B;  1JTD B;  1B9Y A;  1UTC A;  3PXW D;  2PM9 A;  1K3I A;  4Z7Q A;  1TYQ C;  4N14 A;  4OWR A;  3I7N A;  2AGW A;  2XZG A;  3L4M D;  2TRC B;  4A2L A;  3RN1 D;  3RFG A;  4BCC A;  3PXS D;  3I7H A;  2XL2 A;  2GNQ A;  5EAM A;  1JMZ B;  3EG6 A;  4JSX C;  4ERY A;  5I5J A;  1K8K C;  5AMS A;  1A0R B;  3E0C A;  1PI6 A;  2J57 G;  1L5G A;  2YNO A;  4X63 B;  5HDB A;  5EAL A;  1SQ9 A;  4J77 A;  3FCS A;  3AL8 A;  4J79 A;  1YFQ A;  4JT6 C;  5CXC B;  2IUV A;  1BPO A;  3NVX A;  1GXR A;  4AN0 A;  2VDK A;  2P9P C;  3UKU C;  4JHN A;  3KRX B;  2XE4 A;  4J8B A;  1E5T A;  2BKL A;  2P9I C;  5AFU 3;  4FA1 D;  4K3I D;  4U1E I;  3SMR A;  3EI2 A;  4FA5 D;  2CN2 A;  4FA9 D;  2CO0 C;  4A2M A;  2CE8 A;  4CI3 A;  2H9N A;  3I7O A;  4DNV A;  5HQG A;  2EIC A;  3GC3 B;  4RE6 A;  2HES X;  2P9L C;  1JMX B;  4ZOY A;  1E8M A;  3EI3 A;  4BUJ C;  4OZU A;  4FB1 D;  2B5L A;  2VZ1 A;  5C92 A;  4L3H D;  4A09 B;  4EWR A;  2H68 A;  3UR4 A;  3NID A;  5EM2 A;  1O6G A;  2J56 H;  1XKS A;  4QL1 A;  2P9K C;  3J81 g;  5FLX g;  1UOP A;  4L1M A;  5HE2 B;  2OIZ A;  4HDJ A;  4O02 A;  2H9M A;  5IGQ A;  2Z2P A;  5FXY A;  1R5M A;  3EI4 B;  2YBA A;  3ZWL B;  2HKM A;  3IVM A;  4J78 A;  4JD2 C;  2AQ5 A;  2XYI A;  5I5M A;  3EI4 A;  4GMB A;  4WJK A;  4BP9 A;  3EWE A;  1PEV A;  5A2Q g;  2EIB A;  3T3P A;  3BG0 A;  3SN6 B;  1MG3 A;  4WK2 A;  2HU7 A;  4LG9 A;  1ERJ A;  3QI0 A;  1A12 A;  3IJ0 A;  4QT8 A;  1GOG A;  2IWK A;  1XHM A;  2WQ8 A;  1MDA H;  5KDO B;  3OF7 A;  3JZG A;  4O3U B;  5IJ7 E;  2PM7 B;  2VDN A;  2MTA H;  4J86 A;  2VZ3 A;  4GGD A;  4UM9 A;  5EMJ B;  4JSV C;  4E5Z B;  5FKS A;  4KFM B;  5CXB B;  2VC2 A;  3SWS D;  3SXT D;  3SBR A;  3ZE0 A;  1B9X A;  3OKY B;  3JRO A;  4AN1 A;  2HU8 A;  3FCU A;  2VDL A;  5SXM A;  3JRP A;  2YNP A;  5M5T A;  4J82 A;  1SQJ A;  1VZ2 A;  3FRX A;  4J87 A;  4IMM A;  4G56 B;  4G55 A;  3O4I A;  3I89 A;  3VH0 A;  4LG8 A;  5HYN B;  3IUQ A;  4BCB A;  5IT9 g;  1VE7 A;  1UOQ A;  3IJC A;  1C9L A;  3ZE1 A;  3QHY B;  1C9I A;  3IUM A;  4IA9 A;  3RMZ D;  4JSP C;  4AMZ A;  4XYI A;  3O4G A;  3GRE A;  3UVO A;  4I79 A;  2BBK H;  3W15 A;  4G1M A;  5AJA A;  4CC9 A;  2PM9 B;  4MMZ A;  4J0W A;  3N0E A;  2P9N C;  1PGU A;  3UVK A;  1U4C A;  1YR2 A;  4GM8 A;  4PC0 A;  2VDR A;  1N6D A;  2B5M A;  3F3G A;  4BL0 A;  3IUL A;  3PXT D;  4A08 B;  4BP8 A;  4J81 A;  2AH0 A;  2HYE A;  5M5V A;  1QFM A;  4J8G A;  1T2X A;  4A08 A;  3GD1 I;  1FWX A;  3AL8 B;  3DDU A;  3A0F A;  2HXC A;  4UI9 R;  1OMW B;  4ERZ A;  3B7F A;  3JZN A;  4FHL A;  2VDQ A;  1L0Q A;  2H6N A;  1VYH C;  2H47 A;  3IJE A;  2XL3 A;  3VI3 A;  4AX4 A;  3MXX A;  3DSM A;  3O4H A;  3UKR C;  5C86 A;  2XU7 A;  5GXI A;  3EI2 B;  3BG1 A;  4XEI C;  4O2W A;  4A7J A;  5IJ8 E;  3SJL D;  2J55 H;  5JWZ A;  3P4F A;  5C2W B;  1M1X A;  4PBZ A;  4D9S A;  2JKX A;  3NIG A;  3ZE2 A;  4O45 A;  3EI3 B;  3AFC A;  4PNK B;  1MG2 A;  3C9C A;  5FKR A;  2B5N A;  3NVN A;  4DNU A;  5EM2 B;  3F3F A;  2PBI B;  2G99 A;  3OTT A;  3JB9 L;  4ESG A;  3C75 H;  5E6R A;  1N6F A;  1TBG A;  4FWW A;  4CI2 A;  3MMY A;  4K3J B;  4PSX B;  5FKQ A;  2I0T A;  2UZY B;  4Z7N A;  1H2W A;  4WK4 A;  3DWL C;  4NSX A;  3RLM D;  4ZOV A;  3MZL A;  1H2X A;  4J84 A;  4D6V A;  2HJ4 A;  3PVU B;  4YVD A;  3MUN A;  5TF2 A;  1QFS A;  1NEX B;  5M5S A;  3MKQ A;  3I7L A;  4AEZ A;  3JAM g;  5GXH A;  2G9A A;  4GQ1 A;  3SBP A;  3IUJ A;  3V4V A;  2UZX B;  3IJ1 A;  3ORV D;  3JPX A;  5EMM B;  3J80 g;  3UVN A;  3EQ7 A;  1E8N A;  3KCI A;  5FFG A;  4PSW B;  5FQD A;  2OVP B;  3U4Y A;  3MUO A;  3V7D B;  3KRW B;  4TZ4 A;  4NAA A;  2H14 A;  5FFO A;  3EI1 A;  4J73 A;  3OW8 A;  4H5J A;  3UVL A;  3ZDX A;  1O6F A;  4X3E A;  2I0S A;  4PBY A;  2P9U C;  2W18 A;  2EID A;  2VDP A;  3I8C A;  4CZX A;  4CZY A;  2O9K A;  2P9S C;  4AOW A;  3K72 A;  4GGA A;  2IWF A;  4GQ2 P;  4LGN A;  1VE6 A;  4CI1 A;  4MK0 B;  1JJU B;  1QNI A;  3DXK C;  1H2Y A;  4L9O A;  4ZOZ A;  4FAN D;  3DXM C;  5FKT A;  4A11 B;  4L1Q D;  3IUR A;  3IUN A;  4R7A B;  5HE3 B;  3IIY A;  5THA A;  4JSN C;  4A11 A;  2AGY A;  4Z7O A;  4NC4 A;  2YNN A;  4Y7R A;  4CY3 A;  4D0K A;  4UM8 A;  3UVM A;  3K27 A;  4A0B A;  5HE0 B;  1RI6 A;  2HKR A;  4A0A A;  5K1C C;  1PBY B;  4Y5R D;  3AH8 B;  2I0R A;  3ZDZ A;  2IUR A;  2CNX A;  2YB8 B;  3VA6 A;  3PSL A;  3C5M A;  4DNW A;  2AGL A;  1JV2 A;  2Z2O A;  4JHP C;  2CN3 A;  2H6K A;  3CFV A;  2AGZ A;  5GSA A;  1Q47 A;  3EQ8 A;  4XYH A;  3HFQ A;  2HU5 A;  5M61 A;  4CY5 A;  2GC4 A;  4GM3 A;  5IC7 A;  3I8E A;  4J0X A;  2I3T A;  4CZV A;  4X60 B;  1U2V C;  2IUQ A;  4ZN4 A;  4GGC A;  4MMY A;  4L3G D;  1H2Z A;  3OL2 B;  3OKW A;  3V9F A;  2BCJ B;  5FA5 B;  1GG2 B;  3I2N A;  2HJB A;  3OL2 A;  2H9P A;  4CY1 A;  1GP2 B;  3T3M A;  4Z8L A;  3C99 A;  3SVW D;  2XDW A;  5CXC A;  2OVR B;  3PVW B;  3K71 A;  5K19 A;  4O3T B;  5H17 A;  4NEN A;  4QRJ A;  3SFZ A;  1P22 A;  1GOF A;  2IAA A;  2GC7 A;  4GM9 A;  4G1E A;  4JT5 C;  3MZK A;  3SBQ A;  2QR5 A; 
#chains in the Genus database with same CATH homology
 3RFH A;  4X61 B;  5GMK n;  5CYK B;  3GFC A;  3DM0 A;  5IGO A;  4ZOX A;  3RN0 D;  4GQB B;  5CYK A;  3N0D A;  2I3S A;  4CY2 A;  5C2V B;  3EU7 A;  1GOT B;  3JZH A;  4O9D A;  2QC5 A;  4A09 A;  2PM6 B;  3SLE D;  4GZ8 A;  4E54 B;  2H9L A;  4U7A A;  3EI1 B;  3PE7 A;  3F3P A;  4QQE A;  5C9Z B;  4E54 A;  2H6Q A;  4H5I A;  4FAV D;  3CIK B;  1JOF A;  3BWS A;  4PXW A;  3VGZ A;  3AL9 A;  2AH1 A;  5TEF A;  2YMU A;  2Q7Q A;  2H13 A;  5TEE A;  1XIP A;  2Z2N A;  2IUP A;  4FA4 D;  3CFS B;  2OK6 A;  2OK4 A;  2CE9 A;  3FM0 A;  3FGB A;  5EML B;  2OJY A;  5EAR A;  3IKO A;  1NR0 A;  3ODT A;  3OKT A;  3L4O D;  4O1Q D;  4E5Z A;  5EMK B;  5CXB A;  2H3X A;  3I7P A;  3RRM C;  5HE1 B;  5H14 A;  3IIW A;  4ES0 A;  2CO0 A;  3OKY A;  2EBS A;  4BH6 A;  3V5W B;  4JXM A;  1K32 A;  4A0B B;  3RSE C;  4A0A B;  1S4U X;  2AGX A;  1N6E A;  5EAP A;  3ULE C;  3EMH A;  5I5I A;  3MKS B;  5H1M A;  3SCY A;  5B4W A;  2B4E A;  3I7K A;  2QXV A;  5TDH B;  2OVQ B;  3NVQ A;  1OLZ A;  4ERQ A;  4CI8 A;  3K26 A;  3SHF A;  1SHY B;  3PSC B;  1B9Y A;  3PXW D;  2PM9 A;  1TYQ C;  4N14 A;  4OWR A;  3I7N A;  2AGW A;  3L4M D;  2TRC B;  4A2L A;  3RN1 D;  3RFG A;  3PXS D;  3I7H A;  2XL2 A;  2GNQ A;  5EAM A;  1JMZ B;  3EG6 A;  4JSX C;  4ERY A;  5I5J A;  1K8K C;  5AMS A;  1A0R B;  3E0C A;  1PI6 A;  2J57 G;  2YNO A;  4X63 B;  5EAL A;  1SQ9 A;  4J77 A;  3AL8 A;  4J79 A;  1YFQ A;  4JT6 C;  5CXC B;  2IUV A;  3NVX A;  1GXR A;  2P9P C;  3UKU C;  3KRX B;  4J8B A;  2P9I C;  5AFU 3;  4FA1 D;  4K3I D;  4U1E I;  3SMR A;  3EI2 A;  4FA5 D;  2CN2 A;  4FA9 D;  2CO0 C;  4A2M A;  2CE8 A;  4CI3 A;  2H9N A;  3I7O A;  5HQG A;  2HES X;  2P9L C;  1JMX B;  4ZOY A;  3EI3 A;  4BUJ C;  4OZU A;  4FB1 D;  2B5L A;  4L3H D;  4A09 B;  4EWR A;  2H68 A;  3UR4 A;  5EM2 A;  2J56 H;  1XKS A;  4QL1 A;  2P9K C;  3J81 g;  5FLX g;  5HE2 B;  2OIZ A;  4HDJ A;  2H9M A;  5IGQ A;  2Z2P A;  5FXY A;  1R5M A;  3EI4 B;  2YBA A;  3ZWL B;  2HKM A;  4J78 A;  4JD2 C;  2AQ5 A;  2XYI A;  5I5M A;  3EI4 A;  4GMB A;  3EWE A;  1PEV A;  5A2Q g;  3BG0 A;  3SN6 B;  1MG3 A;  4LG9 A;  1ERJ A;  3IJ0 A;  4QT8 A;  2IWK A;  1XHM A;  1MDA H;  5KDO B;  3JZG A;  4O3U B;  5IJ7 E;  2PM7 B;  2MTA H;  4J86 A;  4GGD A;  5EMJ B;  4JSV C;  4E5Z B;  5FKS A;  4KFM B;  5CXB B;  3SWS D;  3SXT D;  3SBR A;  1B9X A;  3OKY B;  3JRO A;  5SXM A;  3JRP A;  2YNP A;  4J82 A;  1SQJ A;  3FRX A;  4J87 A;  4IMM A;  4G56 B;  3I89 A;  3VH0 A;  4LG8 A;  5HYN B;  5IT9 g;  3IJC A;  3RMZ D;  4IA9 A;  4JSP C;  4XYI A;  3GRE A;  3UVO A;  4I79 A;  2BBK H;  3W15 A;  5AJA A;  4CC9 A;  2PM9 B;  4J0W A;  3N0E A;  2P9N C;  1PGU A;  3UVK A;  1U4C A;  4GM8 A;  4PC0 A;  1N6D A;  2B5M A;  3F3G A;  4BL0 A;  3PXT D;  4A08 B;  4J81 A;  2AH0 A;  2HYE A;  4J8G A;  4A08 A;  1FWX A;  3AL8 B;  3A0F A;  2HXC A;  4UI9 R;  1OMW B;  4ERZ A;  3B7F A;  3JZN A;  4FHL A;  1L0Q A;  2H6N A;  1VYH C;  2H47 A;  2XL3 A;  3MXX A;  3DSM A;  3UKR C;  2XU7 A;  5GXI A;  3EI2 B;  3BG1 A;  4XEI C;  4A7J A;  5IJ8 E;  3SJL D;  2J55 H;  5JWZ A;  3P4F A;  5C2W B;  4PBZ A;  4O45 A;  3EI3 B;  3AFC A;  4PNK B;  1MG2 A;  3C9C A;  5FKR A;  2B5N A;  3NVN A;  5EM2 B;  3F3F A;  2PBI B;  2G99 A;  3OTT A;  3JB9 L;  4ESG A;  3C75 H;  1N6F A;  1TBG A;  4FWW A;  4CI2 A;  3MMY A;  4K3J B;  4PSX B;  5FKQ A;  2I0T A;  2UZY B;  3DWL C;  4NSX A;  3RLM D;  4ZOV A;  3MZL A;  4D6V A;  4J84 A;  2HJ4 A;  3PVU B;  4YVD A;  5TF2 A;  1NEX B;  3MKQ A;  3I7L A;  4AEZ A;  3JAM g;  5GXH A;  2G9A A;  4GQ1 A;  3SBP A;  2UZX B;  3IJ1 A;  3ORV D;  3JPX A;  5EMM B;  3J80 g;  3UVN A;  4PSW B;  5FQD A;  2OVP B;  3U4Y A;  3V7D B;  3KRW B;  4TZ4 A;  2H14 A;  3EI1 A;  4J73 A;  3OW8 A;  4H5J A;  3UVL A;  4X3E A;  2I0S A;  4PBY A;  2P9U C;  2W18 A;  3I8C A;  4CZX A;  4CZY A;  2O9K A;  2P9S C;  4AOW A;  4GGA A;  2IWF A;  4GQ2 P;  4LGN A;  4CI1 A;  4MK0 B;  1JJU B;  1QNI A;  3DXK C;  4L9O A;  4ZOZ A;  4FAN D;  3DXM C;  5FKT A;  4A11 B;  4L1Q D;  4R7A B;  5HE3 B;  3IIY A;  5THA A;  4JSN C;  4A11 A;  2AGY A;  2YNN A;  4Y7R A;  4CY3 A;  4D0K A;  3UVM A;  3K27 A;  4A0B A;  5HE0 B;  1RI6 A;  2HKR A;  4A0A A;  5K1C C;  1PBY B;  4Y5R D;  3AH8 B;  2I0R A;  2IUR A;  2CNX A;  2YB8 B;  3VA6 A;  3PSL A;  3C5M A;  2AGL A;  2Z2O A;  2CN3 A;  2H6K A;  3CFV A;  2AGZ A;  5GSA A;  1Q47 A;  4XYH A;  3HFQ A;  4CY5 A;  2GC4 A;  4GM3 A;  5IC7 A;  3I8E A;  4J0X A;  2I3T A;  4CZV A;  4X60 B;  1U2V C;  2IUQ A;  4ZN4 A;  4GGC A;  4L3G D;  3OL2 B;  3OKW A;  3V9F A;  2BCJ B;  5FA5 B;  1GG2 B;  3I2N A;  2HJB A;  3OL2 A;  2H9P A;  4CY1 A;  1GP2 B;  4Z8L A;  3C99 A;  3SVW D;  5CXC A;  2OVR B;  3PVW B;  5K19 A;  4O3T B;  5H17 A;  4QRJ A;  3SFZ A;  1P22 A;  2IAA A;  2GC7 A;  4GM9 A;  4JT5 C;  3MZK A;  3SBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...