2I3TA

Bub3 complex with mad3 (bubr1) glebs motif
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
340
structure length
334
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Cell cycle arrest protein
total genus 81
structure length 334
sequence length 340
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3tA00
3MKSB 2GC7A 5THAA 1PBYB 2OVRB 1A0RB 4H5IA 4O45A 5FKQA 2OK6A 4CY5A 4A0AA 3K26A 3GREA 3E0CA 4PC0A 4PSWB 4ZOZA 5IC7A 3SMRA 2IAAA 3K27A 4QL1A 2AGWA 4R7AB 5GSAA 3EI2B 3OW8A 4J0WA 3I7KA 4QT8A 4GGAA 5FKSA 1S4UX 4UI9R 1YFQA 2AGYA 3OL2A 5CXBB 3DWLC 2B4EA 1N6FA 3NVXA 5C2WB 3RN1D 3DSMA 3F3FA 4L9OA 1NR0A 4J86A 2I0TA 2CN3A 2I3SA 2AH1A 2MTAH 2CE8A 4X63B 3DXKC 1MG2A 3EI1B 2GNQA 4J78A 4CZXA 4E54A 2Z2PA 3KRXB 1OMWB 3J80g 4J79A 5FXYA 4J77A 2H14A 3MXXA 4QRJA 5EM2A 2UZXB 4JSNC 4N14A 4GM3A 4CY2A 4E5ZB 3DXMC 2O9KA 3FGBA 3PXSD 4FA1D 4L3HD 4IA9A 4BL0A 1R5MA 1PGUA 3RFHA 3RN0D 4GM8A 4Z8LA 5IT9g 4CI8A 1PI6A 2H68A 2BCJB 5GXHA 1FWXA 3P4FA 2AQ5A 3SCYA 3PXWD 2H6QA 2J57G 4D6VA 4JT6C 3L4OD 5HYNB 4A7JA 5I5IA 4NSXA 2PM7B 4L3GD 3AL8B 2P9SC 2BBKH 1B9YA 5EAMA 4ZOVA 3MZLA 1N6EA 5JWZA 4A0AB 4FHLA 3BG0A 4Y7RA 5EARA 4GZ8A 4X61B 2TRCB 2H3XA 2J55H 3EG6A 4A11B 5AFU3 2P9NC 1QNIA 4O3TB 3RFGA 5IGQA 4BUJC 4XYHA 2OIZA 3JPXA 4OWRA 4CI1A 5IJ7E 2HXCA 4PSXB 4GQBB 4A0BB 2P9KC 2IUQA 4ZN4A 2AGXA 3AL8A 2XL2A 3I7NA 3EI2A 3MKQA 3V7DB 3I7OA 1SQ9A 2YNPA 2H6NA 5CXCB 1XKSA 5H17A 3OTTA 3ZWLB 3JZNA 3AH8B 3JROA 5CYKA 4A08A 2AGZA 4JD2C 5EMLB 3JRPA 4JSXC 3VGZA 5HE0B 4K3JB 4JT5C 3I7LA 4IMMA 5K1CC 2CN2A 2PBIB 4A08B 2OJYA 3JZGA 1U4CA 3OKYB 3J81g 3AL9A 2Z2OA 2CO0A 2I0RA 2H6KA 5B4WA 1L0QA 4J8BA 3SWSD 5GMKn 4X60B 3SFZA 3I8EA 3PSLA 4O9DA 5EMJB 3C5MA 3MMYA 2H13A 5FKTA 3RMZD 5EALA 3ULEC 4QQEA 2OVQB 3KRWB 3VH0A 4FB1D 4FA5D 4JSVC 2YBAA 3OKTA 2IUPA 4ERYA 3BG1A 3RSEC 2GC4A 4XEIC 4A2MA 3UR4A 1K32A 1JOFA 2H9MA 4ZOXA 5C2VB 3V9FA 4A09A 5HE2B 1TYQC 2H47A 3PVWB 4CI3A 5EM2B 4L1QD 1XIPA 3UVOA 3JAMg 2Q7QA 1XHMA 1SHYB 5AJAA 5TDHB 5CXCA 3JZHA 4FA4D 3A0FA 3PE7A 1Q47A 2P9IC 4CY1A 4KFMB 2P9LC 3F3GA 3NVQA 4HDJA 4GGDA 3SBRA 2XU7A 2OK4A 3B7FA 4K3ID 2EBSA 5EMKB 4A2LA 2H9LA 3EI3B 3UVKA 4ESGA 3EWEA 5FLXg 4GGCA 3EI1A 1MDAH 3SHFA 4ES0A 1JMXB 2QXVA 4E54B 5KDOB 2IURA 2AGLA 4PBYA 5TF2A 2B5NA 3C75H 3IJCA 3I89A 4TZ4A 2IUVA 1MG3A 1JJUB 5GXIA 4J73A 5IJ8E 3UVNA 3SN6B 3AFCA 1B9XA 4D0KA 3ODTA 5HQGA 3I7HA 4PBZA 4J82A 2IWFA 4G56B 4J87A 4AEZA 3IIYA 3I8CA 5CYKB 2I3TA 3SLED 4FAVD 5K19A 1VYHC 4J84A 1OLZA 3SBQA 1P22A 3EI3A 2CNXA 5FKRA 1SQJA 3C9CA 3MZKA 1GG2B 2P9PC 3JB9L 3CFVA 2W18A 3HFQA 3PSCB 4GMBA 4AOWA 2PM9A 3NVNA 3SJLD 4A09B 2IWKA 3ORVD 5SXMA 2XL3A 2G99A 2CO0C 3RRMC 4A11A 3IKOA 4LG9A 3EI4A 3GFCA 4U1EI 4OZUA 3BWSA 4J8GA 5FQDA 4Y5RD 4PXWA 5I5JA 4JSPC 1JMZB 3UKRC 4CC9A 3U4YA 5TEFA 4CZVA 1PEVA 2HJBA 2H9PA 4JXMA 4LG8A 3OL2B 5EAPA 1K8KC 4EWRA 4FA9D 4A0BA 4FAND 3EU7A 1RI6A 5HE3B 1NEXB 3VA6A 3PVUB 3UVMA 3SVWD 3F3PA 2HJ4A 4BH6A 2Z2NA 5TEEA 3V5WB 4FWWA 4ERZA 5FA5B 5CXBA 2HKMA 3CIKB 4J0XA 3IIWA 2OVPB 2I0SA 2G9AA 1GXRA 3EMHA 4O3UB 2H9NA 3SBPA 4U7AA 5A2Qg 2YNNA 3FRXA 3I7PA 3L4MD 4O1QD 3N0EA 2B5LA 4CZYA 4ZOYA 3IJ1A 4ERQA 4J81A 5I5MA 3RLMD 3SXTD 4MK0B 3W15A 2CE9A 2YNOA 3UKUC 1U2VC 2AH0A 2HKRA 2PM6B 3OKWA 4H5JA 5AMSA 5IGOA 2QC5A 2J56H 4GM9A 3I2NA 5EMMB 4I79A 1N6DA 5HE1B 2YMUA 2HESX 4YVDA 3EI4B 4PNKB 5H14A 4E5ZA 1TBGA 4LGNA 3CFSB 4GQ1A 2B5MA 4X3EA 4GQ2P 1GOTB 3FM0A 4CI2A 2YB8B 3OKYA 1GP2B 2UZYB 2XYIA 3DM0A 4CY3A 3UVLA 4XYIA 3N0DA 3IJ0A 3PXTD 5H1MA 3C99A 2HYEA 2PM9B 5C9ZB 1ERJA 2P9UC
chains in the Genus database with same CATH superfamily
1UOQA 3MKSB 2GC7A 5THAA 1PBYB 2OVRB 2VDQA 5M5TA 1A0RB 2VDNA 4G1MA 4H5IA 4O45A 5FKQA 2OK6A 4CY5A 4A0AA 1UTCA 3K26A 3GREA 3E0CA 4PC0A 4PSWB 4ZOZA 5IC7A 3SMRA 2IAAA 3K27A 4QL1A 2AGWA 4R7AB 5GSAA 3EI2B 3OW8A 4J0WA 3I7KA 4QT8A 4GGAA 5FKSA 1S4UX 4MMYA 4UI9R 1YFQA 3MUNA 2AGYA 3OL2A 5CXBB 3DWLC 2B4EA 1N6FA 3NVXA 5C2WB 4JHPC 3DSMA 3RN1D 3F3FA 4L9OA 4WK2A 1NR0A 4J86A 5M5VA 2I0TA 4MMZA 2CN3A 2I3SA 2AH1A 2MTAH 2CE8A 4X63B 4AMZA 4BP8A 3DXKC 1MG2A 3EI1B 1VE6A 2GNQA 4J78A 4CZXA 4E54A 2Z2PA 3GC3B 3KRXB 1OMWB 3J80g 1T2XA 1JV2A 4J79A 5FXYA 4J77A 2H14A 3MXXA 4QRJA 5EM2A 2UZXB 4JSNC 4N14A 4GM3A 4CY2A 4E5ZB 3DXMC 2O9KA 3FGBA 3KCIA 4AN1A 3PXSD 2EIBA 4FA1D 4L3HD 4IA9A 4BL0A 1R5MA 1PGUA 3RFHA 3IUJA 1TYEA 3RN0D 4GM8A 4Z8LA 5IT9g 4CI8A 1PI6A 2H68A 4WJKA 2BCJB 1GOHA 5GXHA 3EQ8A 1FWXA 3P4FA 2AQ5A 3SCYA 1VZ2A 3PXWD 2H6QA 2J57G 4DNUA 4D6VA 5E6RA 4JT6C 3L4OD 5HYNB 4A7JA 5I5IA 4UM8A 4NSXA 2PM7B 4L3GD 3MVDK 3AL8B 2P9SC 1C9IA 4BCBA 2BBKH 1B9YA 3T3MA 5EAMA 4ZOVA 3ZDYA 3MZLA 1N6EA 5JWZA 4A0AB 4FHLA 3V4PA 3BG0A 4Y7RA 5EARA 4GZ8A 4X61B 2TRCB 2H3XA 2J55H 3EG6A 4A11B 5AFU3 2XZGA 3NIDA 2P9NC 1QNIA 4O3TB 3RFGA 5IGQA 4BUJC 4XYHA 2OIZA 3JPXA 4OWRA 4CI1A 5IJ7E 2HXCA 3DDUA 4PSXB 4GQBB 4A0BB 3K72A 2P9KC 2IUQA 4ZN4A 2AGXA 3NIFA 4D9SA 3AL8A 2XL2A 3I7NA 3EI2A 3MKQA 3IUMA 3V7DB 3I7OA 4AX4A 1SQ9A 3FCSA 2YNPA 2H6NA 5CXCB 1XKSA 5H17A 3ZE1A 3OTTA 3ZWLB 3JZNA 4G1EA 3AH8B 5FFGA 3JROA 5CYKA 4A08A 5M5UA 2AGZA 4JD2C 5EMLB 3JRPA 4JSXC 3VGZA 2EICA 5HE0B 4K3JB 1E8NA 4JT5C 4AN0A 3ZDZA 3I7LA 4IMMA 1O6FA 5K1CC 3GD1I 2CN2A 2PBIB 4A08B 2OJYA 4G55A 3JZGA 1U4CA 3OKYB 3J81g 3AL9A 2Z2OA 2CO0A 3O4HA 2I0RA 2H6KA 5B4WA 1GOGA 1I2MB 3O4GA 3QI0A 2QR5A 1L0QA 4J8BA 3SWSD 5GMKn 4X60B 3SFZA 3I8EA 3PSLA 4QAMA 5M5RA 4O9DA 5EMJB 3C5MA 3MMYA 2H13A 5FKTA 2XE4A 3RMZD 4NC4A 2BKLA 5EALA 3ULEC 3IURA 2VDMA 4QQEA 2OVQB 3O4IA 3KRWB 3K6SA 3VH0A 4FB1D 4Z7NA 4FA5D 4JSVC 2YBAA 3OKTA 2IUPA 4ERYA 4L1MA 1GOFA 2VDOA 3BG1A 3RSEC 1H2ZA 2GC4A 4XEIC 4A2MA 3UR4A 2JKXA 1K32A 1JOFA 1E8MA 3ZDXA 2H9MA 4ZOXA 3MUOA 4Z7QA 5C2VB 3V9FA 4A09A 5HE2B 1TYQC 2H47A 1U8CA 3PVWB 3V4VA 5EM2B 4L1QD 4CI3A 3IUQA 3K71A 1XIPA 3UVOA 3JAMg 2Q7QA 2VC2A 1H2YA 1XHMA 5M61A 3O4JA 1SHYB 3ZE2A 5AJAA 5TDHB 5CXCA 3JZHA 4FA4D 2XDWA 3ZE0A 3A0FA 3PE7A 1Q47A 2P9IC 4CY1A 4KFMB 2P9LC 3F3GA 1QFSA 3NVQA 2HU7A 4HDJA 4JHNA 4GGDA 3SBRA 2XU7A 2OK4A 3B7FA 1K3IA 4K3ID 2EBSA 5EMKB 3FCUA 3NIGA 4A2LA 2H9LA 3EI3B 4BCCA 3UVKA 4ESGA 2HU8A 3EWEA 5FLXg 4GGCA 3EI1A 1MDAH 3SHFA 4ES0A 1JMXB 2QXVA 4E54B 5KDOB 2IURA 1QFMA 2AGLA 4PBYA 5TF2A 2WQ8A 2B5NA 3C75H 4NBMA 3IJCA 1VZ3A 3I89A 4TZ4A 4NENA 3EQ7A 2IUVA 1MG3A 1JJUB 5GXIA 4J73A 2QZPA 3UVNA 5IJ8E 3SN6B 4DNWA 1UOPA 3AFCA 1B9XA 4D0KA 3ODTA 1JTDB 3I7HA 5HQGA 1O6GA 4J82A 4PBZA 4G56B 2IWFA 4J87A 4AEZA 3IIYA 3I8CA 5CYKB 5HDBA 2I3TA 4AMYA 3SLED 4FAVD 4WK4A 5K19A 1VYHC 4J84A 1OLZA 3SBQA 1H2WA 4BP9A 4IRZA 1P22A 1E5TA 2CNXA 3EI3A 5FKRA 4Z7OA 1SQJA 3C9CA 3MZKA 4DNVA 1GG2B 2P9PC 3JB9L 3CFVA 2W18A 5C92A 1VE7A 2VZ3A 4UM9A 2VZ1A 3HFQA 3PSCB 4GMBA 4AOWA 2PM9A 2EIEA 3NVNA 3SJLD 4A09B 2IWKA 3ORVD 1UOOA 4RE5A 5SXMA 2XL3A 2G99A 2CO0C 3RRMC 4A11A 3IKOA 5M5SA 4LG9A 4BCDA 3EI4A 3GFCA 4U1EI 5FFOA 4OZUA 3BWSA 1A12A 4J8GA 5FQDA 4Y5RD 4PXWA 5I5JA 4JSPC 1JMZB 3UKRC 4CC9A 3U4YA 5TEFA 3VI4A 4CZVA 1PEVA 2HJBA 2H9PA 3QHYB 4JXMA 4LG8A 4O02A 3OL2B 5EAPA 5C86A 1K8KC 4EWRA 4FA9D 4A0BA 4FAND 3EU7A 1RI6A 5HE3B 1NEXB 3VA6A 3IUNA 4RE6A 3PVUB 2EIDA 4WK0A 3UVMA 3SVWD 2HU5A 3F3PA 2HJ4A 1YR2A 2Z2NA 4BH6A 2VDLA 5TEEA 3V5WB 4FWWA 4ERZA 5FA5B 5CXBA 2HKMA 3CIKB 3VI3A 4J0XA 3IIWA 2OVPB 2I0SA 2G9AA 1GXRA 4O2WA 3EMHA 4O3UB 2H9NA 3SBPA 4U7AA 5A2Qg 2YNNA 3IJEA 3FRXA 3I7PA 3L4MD 4O1QD 3N0EA 1L5GA 2B5LA 4CZYA 4ZOYA 3IJ1A 4ERQA 4J81A 5I5MA 4MMXA 3EQ9A 3OF7A 3RLMD 3SXTD 4MK0B 3W15A 5E6UA 2CE9A 3IVMA 2YNOA 3UKUC 1U2VC 2AH0A 1M1XA 2HKRA 2PM6B 2VDRA 3OKWA 4H5JA 1H2XA 5AMSA 2QC5A 5IGOA 2J56H 4GM9A 3I2NA 5EMMB 4I79A 1N6DA 5HE1B 2YMUA 2HESX 4YVDA 3EI4B 4PNKB 5H14A 3T3PA 4E5ZA 1TBGA 4LGNA 3CFSB 4GQ1A 2B5MA 4X3EA 1BPOA 4GQ2P 1GOTB 3FM0A 4CI2A 2YB8B 4NAAA 3OKYA 1GP2B 2UZYB 1C9LA 2XYIA 3DM0A 2VDKA 4CY3A 3UVLA 4XYIA 3IULA 3N0DA 3IJ0A 3PXTD 5E6SA 5H1MA 3C99A 2HYEA 2PM9B 5C9ZB 1ERJA 2VDPA 2P9UC
chains in the Genus database with same CATH topology
3MKSB 2GC7A 5THAA 1PBYB 2OVRB 1A0RB 4H5IA 4O45A 5FKQA 2OK6A 4CY5A 4A0AA 3K26A 3GREA 3E0CA 4PC0A 4PSWB 4ZOZA 5IC7A 3SMRA 2IAAA 3K27A 4QL1A 2AGWA 4R7AB 5GSAA 3EI2B 3OW8A 4J0WA 3I7KA 4QT8A 4GGAA 5FKSA 1S4UX 4UI9R 1YFQA 2AGYA 3OL2A 5CXBB 3DWLC 2B4EA 1N6FA 3NVXA 5C2WB 3RN1D 3DSMA 3F3FA 4L9OA 1NR0A 4J86A 2I0TA 2CN3A 2I3SA 2AH1A 2MTAH 2CE8A 4X63B 3DXKC 1MG2A 3EI1B 2GNQA 4J78A 4CZXA 4E54A 2Z2PA 3KRXB 1OMWB 3J80g 4J79A 5FXYA 4J77A 2H14A 3MXXA 4QRJA 5EM2A 2UZXB 4JSNC 4N14A 4GM3A 4CY2A 4E5ZB 3DXMC 2O9KA 3FGBA 3PXSD 4FA1D 4L3HD 4IA9A 4BL0A 1R5MA 1PGUA 3RFHA 3RN0D 4GM8A 4Z8LA 5IT9g 4CI8A 1PI6A 2H68A 2BCJB 5GXHA 1FWXA 3P4FA 2AQ5A 3SCYA 3PXWD 2H6QA 2J57G 4D6VA 4JT6C 3L4OD 5HYNB 4A7JA 5I5IA 4NSXA 2PM7B 4L3GD 3AL8B 2P9SC 2BBKH 1B9YA 5EAMA 4ZOVA 3MZLA 1N6EA 5JWZA 4A0AB 4FHLA 3BG0A 4Y7RA 5EARA 4GZ8A 4X61B 2TRCB 2H3XA 2J55H 3EG6A 4A11B 5AFU3 2P9NC 1QNIA 4O3TB 3RFGA 5IGQA 4BUJC 4XYHA 2OIZA 3JPXA 4OWRA 4CI1A 5IJ7E 2HXCA 4PSXB 4GQBB 4A0BB 2P9KC 2IUQA 4ZN4A 2AGXA 3AL8A 2XL2A 3I7NA 3EI2A 3MKQA 3V7DB 3I7OA 1SQ9A 2YNPA 2H6NA 5CXCB 1XKSA 5H17A 3OTTA 3ZWLB 3JZNA 3AH8B 3JROA 5CYKA 4A08A 2AGZA 4JD2C 5EMLB 3JRPA 4JSXC 3VGZA 5HE0B 4K3JB 4JT5C 3I7LA 4IMMA 5K1CC 2CN2A 2PBIB 4A08B 2OJYA 3JZGA 1U4CA 3OKYB 3J81g 3AL9A 2Z2OA 2CO0A 2I0RA 2H6KA 5B4WA 1L0QA 4J8BA 3SWSD 5GMKn 4X60B 3SFZA 3I8EA 3PSLA 4O9DA 5EMJB 3C5MA 3MMYA 2H13A 5FKTA 3RMZD 5EALA 3ULEC 4QQEA 2OVQB 3KRWB 3VH0A 4FB1D 4FA5D 4JSVC 2YBAA 3OKTA 2IUPA 4ERYA 3BG1A 3RSEC 2GC4A 4XEIC 4A2MA 3UR4A 1K32A 1JOFA 2H9MA 4ZOXA 5C2VB 3V9FA 4A09A 5HE2B 1TYQC 2H47A 3PVWB 4CI3A 5EM2B 4L1QD 1XIPA 3UVOA 3JAMg 2Q7QA 1XHMA 1SHYB 5AJAA 5TDHB 5CXCA 3JZHA 4FA4D 3A0FA 3PE7A 1Q47A 2P9IC 4CY1A 4KFMB 2P9LC 3F3GA 3NVQA 4HDJA 4GGDA 3SBRA 2XU7A 2OK4A 3B7FA 4K3ID 2EBSA 5EMKB 4A2LA 2H9LA 3EI3B 3UVKA 4ESGA 3EWEA 5FLXg 4GGCA 3EI1A 1MDAH 3SHFA 4ES0A 1JMXB 2QXVA 4E54B 5KDOB 2IURA 2AGLA 4PBYA 5TF2A 2B5NA 3C75H 3IJCA 3I89A 4TZ4A 2IUVA 1MG3A 1JJUB 5GXIA 4J73A 5IJ8E 3UVNA 3SN6B 3AFCA 1B9XA 4D0KA 3ODTA 5HQGA 3I7HA 4PBZA 4J82A 2IWFA 4G56B 4J87A 4AEZA 3IIYA 3I8CA 5CYKB 2I3TA 3SLED 4FAVD 5K19A 1VYHC 4J84A 1OLZA 3SBQA 1P22A 3EI3A 2CNXA 5FKRA 1SQJA 3C9CA 3MZKA 1GG2B 2P9PC 3JB9L 3CFVA 2W18A 3HFQA 3PSCB 4GMBA 4AOWA 2PM9A 3NVNA 3SJLD 4A09B 2IWKA 3ORVD 5SXMA 2XL3A 2G99A 2CO0C 3RRMC 4A11A 3IKOA 4LG9A 3EI4A 3GFCA 4U1EI 4OZUA 3BWSA 4J8GA 5FQDA 4Y5RD 4PXWA 5I5JA 4JSPC 1JMZB 3UKRC 4CC9A 3U4YA 5TEFA 4CZVA 1PEVA 2HJBA 2H9PA 4JXMA 4LG8A 3OL2B 5EAPA 1K8KC 4EWRA 4FA9D 4A0BA 4FAND 3EU7A 1RI6A 5HE3B 1NEXB 3VA6A 3PVUB 3UVMA 3SVWD 3F3PA 2HJ4A 4BH6A 2Z2NA 5TEEA 3V5WB 4FWWA 4ERZA 5FA5B 5CXBA 2HKMA 3CIKB 4J0XA 3IIWA 2OVPB 2I0SA 2G9AA 1GXRA 3EMHA 4O3UB 2H9NA 3SBPA 4U7AA 5A2Qg 2YNNA 3FRXA 3I7PA 3L4MD 4O1QD 3N0EA 2B5LA 4CZYA 4ZOYA 3IJ1A 4ERQA 4J81A 5I5MA 3RLMD 3SXTD 4MK0B 3W15A 2CE9A 2YNOA 3UKUC 1U2VC 2AH0A 2HKRA 2PM6B 3OKWA 4H5JA 5AMSA 5IGOA 2QC5A 2J56H 4GM9A 3I2NA 5EMMB 4I79A 1N6DA 5HE1B 2YMUA 2HESX 4YVDA 3EI4B 4PNKB 5H14A 4E5ZA 1TBGA 4LGNA 3CFSB 4GQ1A 2B5MA 4X3EA 4GQ2P 1GOTB 3FM0A 4CI2A 2YB8B 3OKYA 1GP2B 2UZYB 2XYIA 3DM0A 4CY3A 3UVLA 4XYIA 3N0DA 3IJ0A 3PXTD 5H1MA 3C99A 2HYEA 2PM9B 5C9ZB 1ERJA 2P9UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKS B;  2GC7 A;  5THA A;  1PBY B;  2OVR B;  1A0R B;  4H5I A;  4O45 A;  5FKQ A;  2OK6 A;  4CY5 A;  4A0A A;  3K26 A;  3GRE A;  3E0C A;  4PC0 A;  4PSW B;  4ZOZ A;  5IC7 A;  3SMR A;  2IAA A;  3K27 A;  4QL1 A;  2AGW A;  4R7A B;  5GSA A;  3EI2 B;  3OW8 A;  4J0W A;  3I7K A;  4QT8 A;  4GGA A;  5FKS A;  1S4U X;  4UI9 R;  1YFQ A;  2AGY A;  3OL2 A;  5CXB B;  3DWL C;  2B4E A;  1N6F A;  3NVX A;  5C2W B;  3RN1 D;  3DSM A;  3F3F A;  4L9O A;  1NR0 A;  4J86 A;  2I0T A;  2CN3 A;  2I3S A;  2AH1 A;  2MTA H;  2CE8 A;  4X63 B;  3DXK C;  1MG2 A;  3EI1 B;  2GNQ A;  4J78 A;  4CZX A;  4E54 A;  2Z2P A;  3KRX B;  1OMW B;  3J80 g;  4J79 A;  5FXY A;  4J77 A;  2H14 A;  3MXX A;  4QRJ A;  5EM2 A;  2UZX B;  4JSN C;  4N14 A;  4GM3 A;  4CY2 A;  4E5Z B;  3DXM C;  2O9K A;  3FGB A;  3PXS D;  4FA1 D;  4L3H D;  4IA9 A;  4BL0 A;  1R5M A;  1PGU A;  3RFH A;  3RN0 D;  4GM8 A;  4Z8L A;  5IT9 g;  4CI8 A;  1PI6 A;  2H68 A;  2BCJ B;  5GXH A;  1FWX A;  3P4F A;  2AQ5 A;  3SCY A;  3PXW D;  2H6Q A;  2J57 G;  4D6V A;  4JT6 C;  3L4O D;  5HYN B;  4A7J A;  5I5I A;  4NSX A;  2PM7 B;  4L3G D;  3AL8 B;  2P9S C;  2BBK H;  1B9Y A;  5EAM A;  4ZOV A;  3MZL A;  1N6E A;  5JWZ A;  4A0A B;  4FHL A;  3BG0 A;  4Y7R A;  5EAR A;  4GZ8 A;  4X61 B;  2TRC B;  2H3X A;  2J55 H;  3EG6 A;  4A11 B;  5AFU 3;  2P9N C;  1QNI A;  4O3T B;  3RFG A;  5IGQ A;  4BUJ C;  4XYH A;  2OIZ A;  3JPX A;  4OWR A;  4CI1 A;  5IJ7 E;  2HXC A;  4PSX B;  4GQB B;  4A0B B;  2P9K C;  2IUQ A;  4ZN4 A;  2AGX A;  3AL8 A;  2XL2 A;  3I7N A;  3EI2 A;  3MKQ A;  3V7D B;  3I7O A;  1SQ9 A;  2YNP A;  2H6N A;  5CXC B;  1XKS A;  5H17 A;  3OTT A;  3ZWL B;  3JZN A;  3AH8 B;  3JRO A;  5CYK A;  4A08 A;  2AGZ A;  4JD2 C;  5EML B;  3JRP A;  4JSX C;  3VGZ A;  5HE0 B;  4K3J B;  4JT5 C;  3I7L A;  4IMM A;  5K1C C;  2CN2 A;  2PBI B;  4A08 B;  2OJY A;  3JZG A;  1U4C A;  3OKY B;  3J81 g;  3AL9 A;  2Z2O A;  2CO0 A;  2I0R A;  2H6K A;  5B4W A;  1L0Q A;  4J8B A;  3SWS D;  5GMK n;  4X60 B;  3SFZ A;  3I8E A;  3PSL A;  4O9D A;  5EMJ B;  3C5M A;  3MMY A;  2H13 A;  5FKT A;  3RMZ D;  5EAL A;  3ULE C;  4QQE A;  2OVQ B;  3KRW B;  3VH0 A;  4FB1 D;  4FA5 D;  4JSV C;  2YBA A;  3OKT A;  2IUP A;  4ERY A;  3BG1 A;  3RSE C;  2GC4 A;  4XEI C;  4A2M A;  3UR4 A;  1K32 A;  1JOF A;  2H9M A;  4ZOX A;  5C2V B;  3V9F A;  4A09 A;  5HE2 B;  1TYQ C;  2H47 A;  3PVW B;  4CI3 A;  5EM2 B;  4L1Q D;  1XIP A;  3UVO A;  3JAM g;  2Q7Q A;  1XHM A;  1SHY B;  5AJA A;  5TDH B;  5CXC A;  3JZH A;  4FA4 D;  3A0F A;  3PE7 A;  1Q47 A;  2P9I C;  4CY1 A;  4KFM B;  2P9L C;  3F3G A;  3NVQ A;  4HDJ A;  4GGD A;  3SBR A;  2XU7 A;  2OK4 A;  3B7F A;  4K3I D;  2EBS A;  5EMK B;  4A2L A;  2H9L A;  3EI3 B;  3UVK A;  4ESG A;  3EWE A;  5FLX g;  4GGC A;  3EI1 A;  1MDA H;  3SHF A;  4ES0 A;  1JMX B;  2QXV A;  4E54 B;  5KDO B;  2IUR A;  2AGL A;  4PBY A;  5TF2 A;  2B5N A;  3C75 H;  3IJC A;  3I89 A;  4TZ4 A;  2IUV A;  1MG3 A;  1JJU B;  5GXI A;  4J73 A;  5IJ8 E;  3UVN A;  3SN6 B;  3AFC A;  1B9X A;  4D0K A;  3ODT A;  5HQG A;  3I7H A;  4PBZ A;  4J82 A;  2IWF A;  4G56 B;  4J87 A;  4AEZ A;  3IIY A;  3I8C A;  5CYK B;  2I3T A;  3SLE D;  4FAV D;  5K19 A;  1VYH C;  4J84 A;  1OLZ A;  3SBQ A;  1P22 A;  3EI3 A;  2CNX A;  5FKR A;  1SQJ A;  3C9C A;  3MZK A;  1GG2 B;  2P9P C;  3JB9 L;  3CFV A;  2W18 A;  3HFQ A;  3PSC B;  4GMB A;  4AOW A;  2PM9 A;  3NVN A;  3SJL D;  4A09 B;  2IWK A;  3ORV D;  5SXM A;  2XL3 A;  2G99 A;  2CO0 C;  3RRM C;  4A11 A;  3IKO A;  4LG9 A;  3EI4 A;  3GFC A;  4U1E I;  4OZU A;  3BWS A;  4J8G A;  5FQD A;  4Y5R D;  4PXW A;  5I5J A;  4JSP C;  1JMZ B;  3UKR C;  4CC9 A;  3U4Y A;  5TEF A;  4CZV A;  1PEV A;  2HJB A;  2H9P A;  4JXM A;  4LG8 A;  3OL2 B;  5EAP A;  1K8K C;  4EWR A;  4FA9 D;  4A0B A;  4FAN D;  3EU7 A;  1RI6 A;  5HE3 B;  1NEX B;  3VA6 A;  3PVU B;  3UVM A;  3SVW D;  3F3P A;  2HJ4 A;  4BH6 A;  2Z2N A;  5TEE A;  3V5W B;  4FWW A;  4ERZ A;  5FA5 B;  5CXB A;  2HKM A;  3CIK B;  4J0X A;  3IIW A;  2OVP B;  2I0S A;  2G9A A;  1GXR A;  3EMH A;  4O3U B;  2H9N A;  3SBP A;  4U7A A;  5A2Q g;  2YNN A;  3FRX A;  3I7P A;  3L4M D;  4O1Q D;  3N0E A;  2B5L A;  4CZY A;  4ZOY A;  3IJ1 A;  4ERQ A;  4J81 A;  5I5M A;  3RLM D;  3SXT D;  4MK0 B;  3W15 A;  2CE9 A;  2YNO A;  3UKU C;  1U2V C;  2AH0 A;  2HKR A;  2PM6 B;  3OKW A;  4H5J A;  5AMS A;  5IGO A;  2QC5 A;  2J56 H;  4GM9 A;  3I2N A;  5EMM B;  4I79 A;  1N6D A;  5HE1 B;  2YMU A;  2HES X;  4YVD A;  3EI4 B;  4PNK B;  5H14 A;  4E5Z A;  1TBG A;  4LGN A;  3CFS B;  4GQ1 A;  2B5M A;  4X3E A;  4GQ2 P;  1GOT B;  3FM0 A;  4CI2 A;  2YB8 B;  3OKY A;  1GP2 B;  2UZY B;  2XYI A;  3DM0 A;  4CY3 A;  3UVL A;  4XYI A;  3N0D A;  3IJ0 A;  3PXT D;  5H1M A;  3C99 A;  2HYE A;  2PM9 B;  5C9Z B;  1ERJ A;  2P9U C; 
#chains in the Genus database with same CATH topology
 1UOQ A;  3MKS B;  2GC7 A;  5THA A;  1PBY B;  2OVR B;  2VDQ A;  5M5T A;  1A0R B;  2VDN A;  4G1M A;  4H5I A;  4O45 A;  5FKQ A;  2OK6 A;  4CY5 A;  4A0A A;  1UTC A;  3K26 A;  3GRE A;  3E0C A;  4PC0 A;  4PSW B;  4ZOZ A;  5IC7 A;  3SMR A;  2IAA A;  3K27 A;  4QL1 A;  2AGW A;  4R7A B;  5GSA A;  3EI2 B;  3OW8 A;  4J0W A;  3I7K A;  4QT8 A;  4GGA A;  5FKS A;  1S4U X;  4MMY A;  4UI9 R;  1YFQ A;  3MUN A;  2AGY A;  3OL2 A;  5CXB B;  3DWL C;  2B4E A;  1N6F A;  3NVX A;  5C2W B;  4JHP C;  3DSM A;  3RN1 D;  3F3F A;  4L9O A;  4WK2 A;  1NR0 A;  4J86 A;  5M5V A;  2I0T A;  4MMZ A;  2CN3 A;  2I3S A;  2AH1 A;  2MTA H;  2CE8 A;  4X63 B;  4AMZ A;  4BP8 A;  3DXK C;  1MG2 A;  3EI1 B;  1VE6 A;  2GNQ A;  4J78 A;  4CZX A;  4E54 A;  2Z2P A;  3GC3 B;  3KRX B;  1OMW B;  3J80 g;  1T2X A;  1JV2 A;  4J79 A;  5FXY A;  4J77 A;  2H14 A;  3MXX A;  4QRJ A;  5EM2 A;  2UZX B;  4JSN C;  4N14 A;  4GM3 A;  4CY2 A;  4E5Z B;  3DXM C;  2O9K A;  3FGB A;  3KCI A;  4AN1 A;  3PXS D;  2EIB A;  4FA1 D;  4L3H D;  4IA9 A;  4BL0 A;  1R5M A;  1PGU A;  3RFH A;  3IUJ A;  1TYE A;  3RN0 D;  4GM8 A;  4Z8L A;  5IT9 g;  4CI8 A;  1PI6 A;  2H68 A;  4WJK A;  2BCJ B;  1GOH A;  5GXH A;  3EQ8 A;  1FWX A;  3P4F A;  2AQ5 A;  3SCY A;  1VZ2 A;  3PXW D;  2H6Q A;  2J57 G;  4DNU A;  4D6V A;  5E6R A;  4JT6 C;  3L4O D;  5HYN B;  4A7J A;  5I5I A;  4UM8 A;  4NSX A;  2PM7 B;  4L3G D;  3MVD K;  3AL8 B;  2P9S C;  1C9I A;  4BCB A;  2BBK H;  1B9Y A;  3T3M A;  5EAM A;  4ZOV A;  3ZDY A;  3MZL A;  1N6E A;  5JWZ A;  4A0A B;  4FHL A;  3V4P A;  3BG0 A;  4Y7R A;  5EAR A;  4GZ8 A;  4X61 B;  2TRC B;  2H3X A;  2J55 H;  3EG6 A;  4A11 B;  5AFU 3;  2XZG A;  3NID A;  2P9N C;  1QNI A;  4O3T B;  3RFG A;  5IGQ A;  4BUJ C;  4XYH A;  2OIZ A;  3JPX A;  4OWR A;  4CI1 A;  5IJ7 E;  2HXC A;  3DDU A;  4PSX B;  4GQB B;  4A0B B;  3K72 A;  2P9K C;  2IUQ A;  4ZN4 A;  2AGX A;  3NIF A;  4D9S A;  3AL8 A;  2XL2 A;  3I7N A;  3EI2 A;  3MKQ A;  3IUM A;  3V7D B;  3I7O A;  4AX4 A;  1SQ9 A;  3FCS A;  2YNP A;  2H6N A;  5CXC B;  1XKS A;  5H17 A;  3ZE1 A;  3OTT A;  3ZWL B;  3JZN A;  4G1E A;  3AH8 B;  5FFG A;  3JRO A;  5CYK A;  4A08 A;  5M5U A;  2AGZ A;  4JD2 C;  5EML B;  3JRP A;  4JSX C;  3VGZ A;  2EIC A;  5HE0 B;  4K3J B;  1E8N A;  4JT5 C;  4AN0 A;  3ZDZ A;  3I7L A;  4IMM A;  1O6F A;  5K1C C;  3GD1 I;  2CN2 A;  2PBI B;  4A08 B;  2OJY A;  4G55 A;  3JZG A;  1U4C A;  3OKY B;  3J81 g;  3AL9 A;  2Z2O A;  2CO0 A;  3O4H A;  2I0R A;  2H6K A;  5B4W A;  1GOG A;  1I2M B;  3O4G A;  3QI0 A;  2QR5 A;  1L0Q A;  4J8B A;  3SWS D;  5GMK n;  4X60 B;  3SFZ A;  3I8E A;  3PSL A;  4QAM A;  5M5R A;  4O9D A;  5EMJ B;  3C5M A;  3MMY A;  2H13 A;  5FKT A;  2XE4 A;  3RMZ D;  4NC4 A;  2BKL A;  5EAL A;  3ULE C;  3IUR A;  2VDM A;  4QQE A;  2OVQ B;  3O4I A;  3KRW B;  3K6S A;  3VH0 A;  4FB1 D;  4Z7N A;  4FA5 D;  4JSV C;  2YBA A;  3OKT A;  2IUP A;  4ERY A;  4L1M A;  1GOF A;  2VDO A;  3BG1 A;  3RSE C;  1H2Z A;  2GC4 A;  4XEI C;  4A2M A;  3UR4 A;  2JKX A;  1K32 A;  1JOF A;  1E8M A;  3ZDX A;  2H9M A;  4ZOX A;  3MUO A;  4Z7Q A;  5C2V B;  3V9F A;  4A09 A;  5HE2 B;  1TYQ C;  2H47 A;  1U8C A;  3PVW B;  3V4V A;  5EM2 B;  4L1Q D;  4CI3 A;  3IUQ A;  3K71 A;  1XIP A;  3UVO A;  3JAM g;  2Q7Q A;  2VC2 A;  1H2Y A;  1XHM A;  5M61 A;  3O4J A;  1SHY B;  3ZE2 A;  5AJA A;  5TDH B;  5CXC A;  3JZH A;  4FA4 D;  2XDW A;  3ZE0 A;  3A0F A;  3PE7 A;  1Q47 A;  2P9I C;  4CY1 A;  4KFM B;  2P9L C;  3F3G A;  1QFS A;  3NVQ A;  2HU7 A;  4HDJ A;  4JHN A;  4GGD A;  3SBR A;  2XU7 A;  2OK4 A;  3B7F A;  1K3I A;  4K3I D;  2EBS A;  5EMK B;  3FCU A;  3NIG A;  4A2L A;  2H9L A;  3EI3 B;  4BCC A;  3UVK A;  4ESG A;  2HU8 A;  3EWE A;  5FLX g;  4GGC A;  3EI1 A;  1MDA H;  3SHF A;  4ES0 A;  1JMX B;  2QXV A;  4E54 B;  5KDO B;  2IUR A;  1QFM A;  2AGL A;  4PBY A;  5TF2 A;  2WQ8 A;  2B5N A;  3C75 H;  4NBM A;  3IJC A;  1VZ3 A;  3I89 A;  4TZ4 A;  4NEN A;  3EQ7 A;  2IUV A;  1MG3 A;  1JJU B;  5GXI A;  4J73 A;  2QZP A;  3UVN A;  5IJ8 E;  3SN6 B;  4DNW A;  1UOP A;  3AFC A;  1B9X A;  4D0K A;  3ODT A;  1JTD B;  3I7H A;  5HQG A;  1O6G A;  4J82 A;  4PBZ A;  4G56 B;  2IWF A;  4J87 A;  4AEZ A;  3IIY A;  3I8C A;  5CYK B;  5HDB A;  2I3T A;  4AMY A;  3SLE D;  4FAV D;  4WK4 A;  5K19 A;  1VYH C;  4J84 A;  1OLZ A;  3SBQ A;  1H2W A;  4BP9 A;  4IRZ A;  1P22 A;  1E5T A;  2CNX A;  3EI3 A;  5FKR A;  4Z7O A;  1SQJ A;  3C9C A;  3MZK A;  4DNV A;  1GG2 B;  2P9P C;  3JB9 L;  3CFV A;  2W18 A;  5C92 A;  1VE7 A;  2VZ3 A;  4UM9 A;  2VZ1 A;  3HFQ A;  3PSC B;  4GMB A;  4AOW A;  2PM9 A;  2EIE A;  3NVN A;  3SJL D;  4A09 B;  2IWK A;  3ORV D;  1UOO A;  4RE5 A;  5SXM A;  2XL3 A;  2G99 A;  2CO0 C;  3RRM C;  4A11 A;  3IKO A;  5M5S A;  4LG9 A;  4BCD A;  3EI4 A;  3GFC A;  4U1E I;  5FFO A;  4OZU A;  3BWS A;  1A12 A;  4J8G A;  5FQD A;  4Y5R D;  4PXW A;  5I5J A;  4JSP C;  1JMZ B;  3UKR C;  4CC9 A;  3U4Y A;  5TEF A;  3VI4 A;  4CZV A;  1PEV A;  2HJB A;  2H9P A;  3QHY B;  4JXM A;  4LG8 A;  4O02 A;  3OL2 B;  5EAP A;  5C86 A;  1K8K C;  4EWR A;  4FA9 D;  4A0B A;  4FAN D;  3EU7 A;  1RI6 A;  5HE3 B;  1NEX B;  3VA6 A;  3IUN A;  4RE6 A;  3PVU B;  2EID A;  4WK0 A;  3UVM A;  3SVW D;  2HU5 A;  3F3P A;  2HJ4 A;  1YR2 A;  2Z2N A;  4BH6 A;  2VDL A;  5TEE A;  3V5W B;  4FWW A;  4ERZ A;  5FA5 B;  5CXB A;  2HKM A;  3CIK B;  3VI3 A;  4J0X A;  3IIW A;  2OVP B;  2I0S A;  2G9A A;  1GXR A;  4O2W A;  3EMH A;  4O3U B;  2H9N A;  3SBP A;  4U7A A;  5A2Q g;  2YNN A;  3IJE A;  3FRX A;  3I7P A;  3L4M D;  4O1Q D;  3N0E A;  1L5G A;  2B5L A;  4CZY A;  4ZOY A;  3IJ1 A;  4ERQ A;  4J81 A;  5I5M A;  4MMX A;  3EQ9 A;  3OF7 A;  3RLM D;  3SXT D;  4MK0 B;  3W15 A;  5E6U A;  2CE9 A;  3IVM A;  2YNO A;  3UKU C;  1U2V C;  2AH0 A;  1M1X A;  2HKR A;  2PM6 B;  2VDR A;  3OKW A;  4H5J A;  1H2X A;  5AMS A;  2QC5 A;  5IGO A;  2J56 H;  4GM9 A;  3I2N A;  5EMM B;  4I79 A;  1N6D A;  5HE1 B;  2YMU A;  2HES X;  4YVD A;  3EI4 B;  4PNK B;  5H14 A;  3T3P A;  4E5Z A;  1TBG A;  4LGN A;  3CFS B;  4GQ1 A;  2B5M A;  4X3E A;  1BPO A;  4GQ2 P;  1GOT B;  3FM0 A;  4CI2 A;  2YB8 B;  4NAA A;  3OKY A;  1GP2 B;  2UZY B;  1C9L A;  2XYI A;  3DM0 A;  2VDK A;  4CY3 A;  3UVL A;  4XYI A;  3IUL A;  3N0D A;  3IJ0 A;  3PXT D;  5E6S A;  5H1M A;  3C99 A;  2HYE A;  2PM9 B;  5C9Z B;  1ERJ A;  2VDP A;  2P9U C; 
#chains in the Genus database with same CATH homology
 3MKS B;  2GC7 A;  5THA A;  1PBY B;  2OVR B;  1A0R B;  4H5I A;  4O45 A;  5FKQ A;  2OK6 A;  4CY5 A;  4A0A A;  3K26 A;  3GRE A;  3E0C A;  4PC0 A;  4PSW B;  4ZOZ A;  5IC7 A;  3SMR A;  2IAA A;  3K27 A;  4QL1 A;  2AGW A;  4R7A B;  5GSA A;  3EI2 B;  3OW8 A;  4J0W A;  3I7K A;  4QT8 A;  4GGA A;  5FKS A;  1S4U X;  4UI9 R;  1YFQ A;  2AGY A;  3OL2 A;  5CXB B;  3DWL C;  2B4E A;  1N6F A;  3NVX A;  5C2W B;  3RN1 D;  3DSM A;  3F3F A;  4L9O A;  1NR0 A;  4J86 A;  2I0T A;  2CN3 A;  2I3S A;  2AH1 A;  2MTA H;  2CE8 A;  4X63 B;  3DXK C;  1MG2 A;  3EI1 B;  2GNQ A;  4J78 A;  4CZX A;  4E54 A;  2Z2P A;  3KRX B;  1OMW B;  3J80 g;  4J79 A;  5FXY A;  4J77 A;  2H14 A;  3MXX A;  4QRJ A;  5EM2 A;  2UZX B;  4JSN C;  4N14 A;  4GM3 A;  4CY2 A;  4E5Z B;  3DXM C;  2O9K A;  3FGB A;  3PXS D;  4FA1 D;  4L3H D;  4IA9 A;  4BL0 A;  1R5M A;  1PGU A;  3RFH A;  3RN0 D;  4GM8 A;  4Z8L A;  5IT9 g;  4CI8 A;  1PI6 A;  2H68 A;  2BCJ B;  5GXH A;  1FWX A;  3P4F A;  2AQ5 A;  3SCY A;  3PXW D;  2H6Q A;  2J57 G;  4D6V A;  4JT6 C;  3L4O D;  5HYN B;  4A7J A;  5I5I A;  4NSX A;  2PM7 B;  4L3G D;  3AL8 B;  2P9S C;  2BBK H;  1B9Y A;  5EAM A;  4ZOV A;  3MZL A;  1N6E A;  5JWZ A;  4A0A B;  4FHL A;  3BG0 A;  4Y7R A;  5EAR A;  4GZ8 A;  4X61 B;  2TRC B;  2H3X A;  2J55 H;  3EG6 A;  4A11 B;  5AFU 3;  2P9N C;  1QNI A;  4O3T B;  3RFG A;  5IGQ A;  4BUJ C;  4XYH A;  2OIZ A;  3JPX A;  4OWR A;  4CI1 A;  5IJ7 E;  2HXC A;  4PSX B;  4GQB B;  4A0B B;  2P9K C;  2IUQ A;  4ZN4 A;  2AGX A;  3AL8 A;  2XL2 A;  3I7N A;  3EI2 A;  3MKQ A;  3V7D B;  3I7O A;  1SQ9 A;  2YNP A;  2H6N A;  5CXC B;  1XKS A;  5H17 A;  3OTT A;  3ZWL B;  3JZN A;  3AH8 B;  3JRO A;  5CYK A;  4A08 A;  2AGZ A;  4JD2 C;  5EML B;  3JRP A;  4JSX C;  3VGZ A;  5HE0 B;  4K3J B;  4JT5 C;  3I7L A;  4IMM A;  5K1C C;  2CN2 A;  2PBI B;  4A08 B;  2OJY A;  3JZG A;  1U4C A;  3OKY B;  3J81 g;  3AL9 A;  2Z2O A;  2CO0 A;  2I0R A;  2H6K A;  5B4W A;  1L0Q A;  4J8B A;  3SWS D;  5GMK n;  4X60 B;  3SFZ A;  3I8E A;  3PSL A;  4O9D A;  5EMJ B;  3C5M A;  3MMY A;  2H13 A;  5FKT A;  3RMZ D;  5EAL A;  3ULE C;  4QQE A;  2OVQ B;  3KRW B;  3VH0 A;  4FB1 D;  4FA5 D;  4JSV C;  2YBA A;  3OKT A;  2IUP A;  4ERY A;  3BG1 A;  3RSE C;  2GC4 A;  4XEI C;  4A2M A;  3UR4 A;  1K32 A;  1JOF A;  2H9M A;  4ZOX A;  5C2V B;  3V9F A;  4A09 A;  5HE2 B;  1TYQ C;  2H47 A;  3PVW B;  4CI3 A;  5EM2 B;  4L1Q D;  1XIP A;  3UVO A;  3JAM g;  2Q7Q A;  1XHM A;  1SHY B;  5AJA A;  5TDH B;  5CXC A;  3JZH A;  4FA4 D;  3A0F A;  3PE7 A;  1Q47 A;  2P9I C;  4CY1 A;  4KFM B;  2P9L C;  3F3G A;  3NVQ A;  4HDJ A;  4GGD A;  3SBR A;  2XU7 A;  2OK4 A;  3B7F A;  4K3I D;  2EBS A;  5EMK B;  4A2L A;  2H9L A;  3EI3 B;  3UVK A;  4ESG A;  3EWE A;  5FLX g;  4GGC A;  3EI1 A;  1MDA H;  3SHF A;  4ES0 A;  1JMX B;  2QXV A;  4E54 B;  5KDO B;  2IUR A;  2AGL A;  4PBY A;  5TF2 A;  2B5N A;  3C75 H;  3IJC A;  3I89 A;  4TZ4 A;  2IUV A;  1MG3 A;  1JJU B;  5GXI A;  4J73 A;  5IJ8 E;  3UVN A;  3SN6 B;  3AFC A;  1B9X A;  4D0K A;  3ODT A;  5HQG A;  3I7H A;  4PBZ A;  4J82 A;  2IWF A;  4G56 B;  4J87 A;  4AEZ A;  3IIY A;  3I8C A;  5CYK B;  2I3T A;  3SLE D;  4FAV D;  5K19 A;  1VYH C;  4J84 A;  1OLZ A;  3SBQ A;  1P22 A;  3EI3 A;  2CNX A;  5FKR A;  1SQJ A;  3C9C A;  3MZK A;  1GG2 B;  2P9P C;  3JB9 L;  3CFV A;  2W18 A;  3HFQ A;  3PSC B;  4GMB A;  4AOW A;  2PM9 A;  3NVN A;  3SJL D;  4A09 B;  2IWK A;  3ORV D;  5SXM A;  2XL3 A;  2G99 A;  2CO0 C;  3RRM C;  4A11 A;  3IKO A;  4LG9 A;  3EI4 A;  3GFC A;  4U1E I;  4OZU A;  3BWS A;  4J8G A;  5FQD A;  4Y5R D;  4PXW A;  5I5J A;  4JSP C;  1JMZ B;  3UKR C;  4CC9 A;  3U4Y A;  5TEF A;  4CZV A;  1PEV A;  2HJB A;  2H9P A;  4JXM A;  4LG8 A;  3OL2 B;  5EAP A;  1K8K C;  4EWR A;  4FA9 D;  4A0B A;  4FAN D;  3EU7 A;  1RI6 A;  5HE3 B;  1NEX B;  3VA6 A;  3PVU B;  3UVM A;  3SVW D;  3F3P A;  2HJ4 A;  4BH6 A;  2Z2N A;  5TEE A;  3V5W B;  4FWW A;  4ERZ A;  5FA5 B;  5CXB A;  2HKM A;  3CIK B;  4J0X A;  3IIW A;  2OVP B;  2I0S A;  2G9A A;  1GXR A;  3EMH A;  4O3U B;  2H9N A;  3SBP A;  4U7A A;  5A2Q g;  2YNN A;  3FRX A;  3I7P A;  3L4M D;  4O1Q D;  3N0E A;  2B5L A;  4CZY A;  4ZOY A;  3IJ1 A;  4ERQ A;  4J81 A;  5I5M A;  3RLM D;  3SXT D;  4MK0 B;  3W15 A;  2CE9 A;  2YNO A;  3UKU C;  1U2V C;  2AH0 A;  2HKR A;  2PM6 B;  3OKW A;  4H5J A;  5AMS A;  5IGO A;  2QC5 A;  2J56 H;  4GM9 A;  3I2N A;  5EMM B;  4I79 A;  1N6D A;  5HE1 B;  2YMU A;  2HES X;  4YVD A;  3EI4 B;  4PNK B;  5H14 A;  4E5Z A;  1TBG A;  4LGN A;  3CFS B;  4GQ1 A;  2B5M A;  4X3E A;  4GQ2 P;  1GOT B;  3FM0 A;  4CI2 A;  2YB8 B;  3OKY A;  1GP2 B;  2UZY B;  2XYI A;  3DM0 A;  4CY3 A;  3UVL A;  4XYI A;  3N0D A;  3IJ0 A;  3PXT D;  5H1M A;  3C99 A;  2HYE A;  2PM9 B;  5C9Z B;  1ERJ A;  2P9U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...