2I3TA

Bub3 complex with mad3 (bubr1) glebs motif
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
340
structure length
334
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell cycle arrest protein
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 334
sequence length 340
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3tA00
5TEFA 3PVWB 3K27A 5EAPA 4J82A 4H5JA 4FB1D 3RSEC 1Q47A 3UVKA 3BWSA 4R7AB 3MKSB 2I3SA 4I79A 2P9KC 5TDHB 4PBYA 3V9FA 5GXHA 4A09A 2AGXA 4Y7RA 2XL3A 2P9LC 2CE9A 2I0SA 4K3JB 4ESGA 1N6DA 2IUQA 3SVWD 3BG0A 3I7KA 3FRXA 3EG6A 4QQEA 3C5MA 5THAA 4G56B 3L4OD 5IJ7E 2Q7QA 4YVDA 2P9NC 3J81g 4CZYA 1OLZA 1PEVA 2W18A 1K8KC 2P9SC 3UR4A 3PSCB 5FQDA 1K32A 1OMWB 4XYIA 4J8BA 4Z8LA 4CZXA 2IURA 3CFSB 2OIZA 3AFCA 3PSLA 3VA6A 1B9YA 2B5MA 4IA9A 2J57G 4J78A 2IUVA 4PXWA 1JOFA 2QXVA 3DXKC 4X3EA 2J55H 4LGNA 3RN1D 5I5MA 3UVMA 2H9NA 3OL2B 4XYHA 2HKMA 5EMJB 4GM9A 2I3TA 5HE2B 3JB9L 2H13A 3SWSD 4J86A 4A2MA 4O3TB 3F3FA 2H68A 5HE0B 4L9OA 4J0WA 4FAVD 4PBZA 4CI8A 2CN3A 5FKSA 1JMXB 3SBRA 4A0AB 1MG2A 3OL2A 3MXXA 3I7OA 3I7LA 2PBIB 4O1QD 3IJCA 2H9LA 5GMKn 3UVNA 5EMLB 5TEEA 3EWEA 5GXIA 4OWRA 4KFMB 2YMUA 3JPXA 2OVPB 3KRXB 3MMYA 4ZN4A 3V7DB 3C9CA 4A0AA 2H6KA 3OKYB 3RFHA 1N6EA 4BUJC 5K19A 3SJLD 1GOTB 1YFQA 4U1EI 3BG1A 3PVUB 3SMRA 5K1CC 3IIYA 4GGAA 4JSNC 1JJUB 4Y5RD 4J79A 2XU7A 5HQGA 4GQ2P 4PNKB 2BCJB 4QT8A 4ZOXA 5IGQA 3NVQA 3OKYA 3EI2B 4JSPC 5IC7A 2OK4A 1GP2B 3RMZD 5H1MA 5EARA 4GM3A 4L1QD 4GM8A 1MG3A 3FGBA 3RFGA 1SHYB 5SXMA 3IJ1A 5JWZA 5HE1B 3EI2A 3SBPA 5EMMB 3SCYA 4BH6A 5EM2B 1U2VC 3GFCA 5H17A 3E0CA 4BL0A 3UVOA 1GG2B 3RLMD 2YNOA 4H5IA 3U4YA 4CC9A 3UVLA 2P9IC 3AH8B 2YNNA 1QNIA 2YB8B 3C99A 3SBQA 4PC0A 2B5LA 5AMSA 1L0QA 2IAAA 5EM2A 3VGZA 4ERQA 4OZUA 3N0DA 4CY2A 1TBGA 3VH0A 3AL8B 3L4MD 3N0EA 2AQ5A 3V5WB 5I5IA 3I7NA 4CZVA 5C2WB 4XEIC 5B4WA 2P9PC 4D6VA 1SQJA 4JSVC 5FKRA 3MZLA 4JT5C 4J81A 2HESX 4ERZA 1GXRA 3MZKA 1A0RB 1MDAH 2OJYA 5EAMA 3JROA 1S4UX 2XYIA 3AL8A 4ZOYA 3F3PA 4A2LA 2CE8A 2QC5A 1B9XA 2H3XA 2H9PA 2Z2NA 3JAMg 4FA9D 2YNPA 3OTTA 4LG8A 4HDJA 3I7PA 4GMBA 3ODTA 3W15A 2Z2OA 4FA5D 3SXTD 2AGYA 3K26A 3I8EA 4ZOVA 1RI6A 4JSXC 4JD2C 1R5MA 4NSXA 3SHFA 4ERYA 5FXYA 2J56H 3JZGA 2I0TA 1PBYB 4J87A 5HYNB 4AOWA 1VYHC 2I0RA 4GZ8A 2GNQA 3DXMC 4D0KA 2GC7A 3SLED 4E5ZB 2BBKH 2CO0A 2XL2A 3RRMC 4LG9A 3B7FA 2HJ4A 3EI3B 4J8GA 3C75H 4E54A 2IWFA 2UZYB 5AJAA 3ULEC 1PI6A 3I8CA 3OKTA 3CFVA 3F3GA 1NR0A 4O3UB 4L3HD 5FKQA 4E5ZA 4CI1A 3EI4B 4J73A 5CXBA 1XIPA 5TF2A 2GC4A 4GGDA 3EI3A 3JZNA 3ORVD 3PXSD 2PM6B 3NVNA 3I2NA 3DWLC 1SQ9A 4CI3A 3J80g 5IJ8E 2H14A 3JZHA 2PM9B 4GGCA 4QL1A 3PE7A 3OW8A 3SN6B 3EI4A 3EI1A 2HKRA 2G99A 2AGLA 2P9UC 3UKRC 1NEXB 1TYQC 4O45A 2TRCB 4U7AA 2B5NA 2HYEA 2AGZA 3ZWLB 4FA1D 5C2VB 2PM9A 2OVRB 4X60B 3EU7A 2AH0A 3FM0A 4A11B 3I7HA 2OK6A 4A0BB 3RN0D 5FKTA 5GSAA 1JMZB 3CIKB 2IUPA 3SFZA 2OVQB 4JXMA 2PM7B 2CO0C 3HFQA 2UZXB 4X61B 5EMKB 5IT9g 4AEZA 1XKSA 4L3GD 1XHMA 4ZOZA 3NVXA 2G9AA 3MKQA 5CXCB 5IGOA 4A7JA 4A11A 4A0BA 5EALA 5A2Qg 5HE3B 3KRWB 4O9DA 3DSMA 5FLXg 4J0XA 1PGUA 4A08B 5CYKB 3EMHA 2H6NA 4TZ4A 4CI2A 2Z2PA 4EWRA 4MK0B 1FWXA 2H9MA 4CY5A 5CXCA 2AGWA 3A0FA 1ERJA 2CNXA 1P22A 4E54B 3PXWD 4GQBB 1U4CA 3JRPA 2MTAH 2AH1A 4PSWB 2H47A 3DM0A 4FHLA 5C9ZB 2O9KA 3PXTD 4X63B 5FA5B 4A08A 4PSXB 4ES0A 5CYKA 5I5JA 4JT6C 2HXCA 3IKOA 5CXBB 4FAND 5KDOB 2B4EA 4UI9R 4K3ID 2HJBA 4IMMA 3I89A 4GQ1A 3IJ0A 2IWKA 4CY3A 4CY1A 4J77A 4FA4D 3IIWA 4QRJA 1N6FA 3P4FA 4A09B 5H14A 3OKWA 2H6QA 4N14A 2EBSA 3AL9A 4FWWA 5AFU3 4J84A 2CN2A 3EI1B 3GREA 2YBAA 3UKUC
chains in the Genus database with same CATH superfamily
5TEFA 3PVWB 3K27A 5EAPA 4J82A 4H5JA 4FB1D 3RSEC 4DNUA 1Q47A 3UVKA 1E8NA 3BWSA 4R7AB 3MKSB 2I3SA 4I79A 3IUJA 5FFOA 2P9KC 5TDHB 4PBYA 3V9FA 5GXHA 4A09A 2AGXA 4Y7RA 2XL3A 2P9LC 2CE9A 2I0SA 5E6SA 1E5TA 4K3JB 2VC2A 4ESGA 1N6DA 2IUQA 3SVWD 3BG0A 3ZDYA 3I7KA 3FRXA 1JV2A 3EG6A 4QQEA 3C5MA 2HU5A 5THAA 4G56B 3L4OD 5IJ7E 2Q7QA 4YVDA 4AMZA 5HDBA 5C92A 2P9NC 4WJKA 3J81g 4CZYA 1OLZA 1PEVA 1C9IA 2W18A 4Z7NA 1K8KC 2P9SC 3UR4A 3PSCB 5FQDA 1K32A 3O4GA 1OMWB 4XYIA 4BP9A 4J8BA 4Z8LA 2HU8A 2XE4A 4CZXA 2IURA 3CFSB 2VDMA 2OIZA 3AFCA 3PSLA 3VA6A 1B9YA 2B5MA 5M5TA 4IA9A 2J57G 4BCBA 4J78A 2IUVA 1E8MA 4PXWA 1JOFA 4AN0A 2QXVA 3DXKC 4X3EA 2J55H 4LGNA 3RN1D 5I5MA 3UVMA 2XZGA 2H9NA 3OL2B 4XYHA 2HKMA 4D9SA 5EMJB 4GM9A 4JHPC 2I3TA 5HE2B 3JB9L 1T2XA 2H13A 3SWSD 4J86A 4A2MA 3EQ9A 4O3TB 3VI4A 1O6GA 3F3FA 2H68A 2HU7A 5HE0B 4IRZA 4L9OA 4J0WA 4FAVD 4PBZA 4CI8A 2CN3A 3NIFA 3FCUA 5FKSA 1JMXB 3SBRA 4A0AB 4Z7QA 1MG2A 3OL2A 3MXXA 3I7OA 3I7LA 2PBIB 4O1QD 3IJCA 5M5UA 2H9LA 5GMKn 4O2WA 2EIBA 1H2WA 3UVNA 5EMLB 5TEEA 3ZE1A 3EWEA 5GXIA 4OWRA 4KFMB 2YMUA 3JPXA 2OVPB 3KRXB 3MMYA 4ZN4A 3V7DB 3C9CA 4A0AA 3K71A 2H6KA 3OKYB 3RFHA 1N6EA 4BUJC 5K19A 3SJLD 1GOTB 1YFQA 4U1EI 3BG1A 3PVUB 4AN1A 3SMRA 5K1CC 3IIYA 4GGAA 4AMYA 4JSNC 2WQ8A 1JJUB 4Y5RD 4J79A 2XU7A 5M5RA 5HQGA 4GQ2P 4PNKB 2BCJB 4QT8A 4ZOXA 5IGQA 3NVQA 3OKYA 5FFGA 3EI2B 4JSPC 1C9LA 5IC7A 2OK4A 3VI3A 1GP2B 3RMZD 5H1MA 2VZ3A 5EARA 4GM3A 4L1QD 4GM8A 1I2MB 2VDLA 1MG3A 3FGBA 3QI0A 1O6FA 3RFGA 1SHYB 5SXMA 3IJ1A 5JWZA 5HE1B 4MMYA 4BCDA 4DNVA 2VDKA 3EQ7A 3SBPA 5EMMB 3EI2A 3SCYA 4BH6A 5EM2B 1U2VC 3GFCA 1UOOA 5H17A 3E0CA 4UM9A 4BL0A 3UVOA 4MMZA 1GG2B 3RLMD 2VDPA 3IVMA 2YNOA 2VDQA 3IURA 4H5IA 3DDUA 3EQ8A 3U4YA 4CC9A 3UVLA 2P9IC 3AH8B 2YNNA 1QNIA 2YB8B 3C99A 3SBQA 4PC0A 2B5LA 5AMSA 1L0QA 2IAAA 5EM2A 3VGZA 3KCIA 4ERQA 3QHYB 1M1XA 3N0DA 3O4JA 4OZUA 1TBGA 4CY2A 3VH0A 3AL8B 3L4MD 3N0EA 2AQ5A 3V5WB 5I5IA 1L5GA 3I7NA 4CZVA 4MMXA 1UOPA 4XEIC 5C2WB 5B4WA 4WK4A 2P9PC 4D6VA 3GD1I 4NAAA 1SQJA 4JSVC 5FKRA 3MZLA 4JT5C 2HESX 4J81A 4ERZA 1GXRA 3OF7A 3MZKA 1A0RB 1MDAH 2OJYA 5EAMA 3JROA 1S4UX 2XYIA 3AL8A 4WK0A 4ZOYA 3F3PA 4A2LA 2CE8A 2QC5A 1B9XA 2H3XA 1GOFA 3ZDZA 2H9PA 2Z2NA 3JAMg 4FA9D 4UM8A 1GOHA 2YNPA 3OTTA 4LG8A 4HDJA 3I7PA 4GMBA 3ODTA 4NC4A 3K6SA 3W15A 2Z2OA 4FA5D 3IUQA 3SXTD 2AGYA 3K26A 3I8EA 4ZOVA 1RI6A 4JSXC 4JD2C 1R5MA 4NSXA 3SHFA 2BKLA 4ERYA 5FXYA 2J56H 3JZGA 2I0TA 1PBYB 2VDNA 4J87A 5HYNB 2JKXA 4AOWA 3IUNA 1VYHC 2I0RA 2EICA 4GZ8A 2GNQA 3DXMC 4D0KA 2GC7A 3SLED 4E5ZB 2BBKH 2CO0A 2XL2A 4JHNA 4L1MA 3RRMC 4WK2A 4LG9A 3V4VA 3B7FA 2HJ4A 3EI3B 4J8GA 4O02A 1UTCA 3C75H 5C86A 4E54A 2IWFA 4QAMA 2UZYB 5AJAA 5M61A 3ULEC 1PI6A 3I8CA 3OKTA 3CFVA 3F3GA 1NR0A 3ZE2A 4O3UB 4L3HD 5FKQA 4E5ZA 4CI1A 4NENA 3EI4B 4J73A 1UOQA 5CXBA 1XIPA 5TF2A 2GC4A 3IJEA 4GGDA 3EI3A 3ZE0A 3JZNA 3ORVD 3PXSD 2PM6B 3NVNA 1QFMA 3I2NA 3DWLC 1H2ZA 1GOGA 1SQ9A 4CI3A 3J80g 2EIDA 5IJ8E 2H14A 3JZHA 2PM9B 4GGCA 2VDRA 4QL1A 3PE7A 3OW8A 3SN6B 3EI4A 3EI1A 2HKRA 2G99A 2AGLA 2P9UC 3UKRC 1NEXB 1TYQC 5M5SA 4O45A 1VE6A 2TRCB 4U7AA 2B5NA 2HYEA 2AGZA 3ZWLB 4FA1D 5C2VB 2PM9A 2XDWA 2OVRB 4X60B 3EU7A 3ZDXA 3IULA 2AH0A 3O4HA 3FM0A 4A11B 1JTDB 3I7HA 3GC3B 2OK6A 4A0BB 3RN0D 5FKTA 5GSAA 1JMZB 3CIKB 2IUPA 5E6RA 2OVQB 3SFZA 4JXMA 2PM7B 2CO0C 3HFQA 2UZXB 4RE6A 4X61B 2VZ1A 5EMKB 1XKSA 4AEZA 5IT9g 4L3GD 1XHMA 1H2YA 4G1MA 3FCSA 4ZOZA 3NVXA 2G9AA 3MKQA 1TYEA 1VE7A 5CXCB 1YR2A 2VDOA 3T3MA 5IGOA 4RE5A 4A7JA 4A11A 4DNWA 4A0BA 5E6UA 1U8CA 5EALA 5A2Qg 5HE3B 4G55A 3KRWB 4O9DA 3DSMA 5FLXg 4G1EA 3IUMA 4J0XA 1PGUA 4A08B 5CYKB 3EMHA 1VZ3A 2H6NA 3MUNA 4TZ4A 4CI2A 2Z2PA 4EWRA 4MK0B 1FWXA 2H9MA 4CY5A 5CXCA 2AGWA 1A12A 2QR5A 3A0FA 1ERJA 2CNXA 2QZPA 1P22A 4E54B 3PXWD 1U4CA 4GQBB 3JRPA 2MTAH 2AH1A 4PSWB 3NIGA 5M5VA 3NIDA 4AX4A 2H47A 3DM0A 4FHLA 3MVDK 5C9ZB 1H2XA 2O9KA 3PXTD 4X63B 5FA5B 4A08A 4PSXB 4ES0A 5CYKA 5I5JA 4JT6C 2HXCA 2EIEA 3IKOA 4Z7OA 5CXBB 1VZ2A 4FAND 5KDOB 4BCCA 2B4EA 4UI9R 3MUOA 4K3ID 2HJBA 4IMMA 3T3PA 1BPOA 3I89A 4BP8A 4GQ1A 3IJ0A 2IWKA 4CY3A 4CY1A 4J77A 4FA4D 3IIWA 4QRJA 1N6FA 3P4FA 3V4PA 4A09B 5H14A 3OKWA 2H6QA 4FWWA 2EBSA 3AL9A 4N14A 4NBMA 5AFU3 4J84A 1QFSA 2CN2A 3EI1B 3GREA 3O4IA 1K3IA 3K72A 2YBAA 3UKUC
chains in the Genus database with same CATH topology
5TEFA 3PVWB 3K27A 5EAPA 4J82A 4H5JA 4FB1D 3RSEC 1Q47A 3UVKA 3BWSA 4R7AB 3MKSB 2I3SA 4I79A 2P9KC 5TDHB 4PBYA 3V9FA 5GXHA 4A09A 2AGXA 4Y7RA 2XL3A 2P9LC 2CE9A 2I0SA 4K3JB 4ESGA 1N6DA 2IUQA 3SVWD 3BG0A 3I7KA 3FRXA 3EG6A 4QQEA 3C5MA 5THAA 4G56B 3L4OD 5IJ7E 2Q7QA 4YVDA 2P9NC 3J81g 4CZYA 1OLZA 1PEVA 2W18A 1K8KC 2P9SC 3UR4A 3PSCB 5FQDA 1K32A 1OMWB 4XYIA 4J8BA 4Z8LA 4CZXA 2IURA 3CFSB 2OIZA 3AFCA 3PSLA 3VA6A 1B9YA 2B5MA 4IA9A 2J57G 4J78A 2IUVA 4PXWA 1JOFA 2QXVA 3DXKC 4X3EA 2J55H 4LGNA 3RN1D 5I5MA 3UVMA 2H9NA 3OL2B 4XYHA 2HKMA 5EMJB 4GM9A 2I3TA 5HE2B 3JB9L 2H13A 3SWSD 4J86A 4A2MA 4O3TB 3F3FA 2H68A 5HE0B 4L9OA 4J0WA 4FAVD 4PBZA 4CI8A 2CN3A 5FKSA 1JMXB 3SBRA 4A0AB 1MG2A 3OL2A 3MXXA 3I7OA 3I7LA 2PBIB 4O1QD 3IJCA 2H9LA 5GMKn 3UVNA 5EMLB 5TEEA 3EWEA 5GXIA 4OWRA 4KFMB 2YMUA 3JPXA 2OVPB 3KRXB 3MMYA 4ZN4A 3V7DB 3C9CA 4A0AA 2H6KA 3OKYB 3RFHA 1N6EA 4BUJC 5K19A 3SJLD 1GOTB 1YFQA 4U1EI 3BG1A 3PVUB 3SMRA 5K1CC 3IIYA 4GGAA 4JSNC 1JJUB 4Y5RD 4J79A 2XU7A 5HQGA 4GQ2P 4PNKB 2BCJB 4QT8A 4ZOXA 5IGQA 3NVQA 3OKYA 3EI2B 4JSPC 5IC7A 2OK4A 1GP2B 3RMZD 5H1MA 5EARA 4GM3A 4L1QD 4GM8A 1MG3A 3FGBA 3RFGA 1SHYB 5SXMA 3IJ1A 5JWZA 5HE1B 3EI2A 3SBPA 5EMMB 3SCYA 4BH6A 5EM2B 1U2VC 3GFCA 5H17A 3E0CA 4BL0A 3UVOA 1GG2B 3RLMD 2YNOA 4H5IA 3U4YA 4CC9A 3UVLA 2P9IC 3AH8B 2YNNA 1QNIA 2YB8B 3C99A 3SBQA 4PC0A 2B5LA 5AMSA 1L0QA 2IAAA 5EM2A 3VGZA 4ERQA 4OZUA 3N0DA 4CY2A 1TBGA 3VH0A 3AL8B 3L4MD 3N0EA 2AQ5A 3V5WB 5I5IA 3I7NA 4CZVA 5C2WB 4XEIC 5B4WA 2P9PC 4D6VA 1SQJA 4JSVC 5FKRA 3MZLA 4JT5C 4J81A 2HESX 4ERZA 1GXRA 3MZKA 1A0RB 1MDAH 2OJYA 5EAMA 3JROA 1S4UX 2XYIA 3AL8A 4ZOYA 3F3PA 4A2LA 2CE8A 2QC5A 1B9XA 2H3XA 2H9PA 2Z2NA 3JAMg 4FA9D 2YNPA 3OTTA 4LG8A 4HDJA 3I7PA 4GMBA 3ODTA 3W15A 2Z2OA 4FA5D 3SXTD 2AGYA 3K26A 3I8EA 4ZOVA 1RI6A 4JSXC 4JD2C 1R5MA 4NSXA 3SHFA 4ERYA 5FXYA 2J56H 3JZGA 2I0TA 1PBYB 4J87A 5HYNB 4AOWA 1VYHC 2I0RA 4GZ8A 2GNQA 3DXMC 4D0KA 2GC7A 3SLED 4E5ZB 2BBKH 2CO0A 2XL2A 3RRMC 4LG9A 3B7FA 2HJ4A 3EI3B 4J8GA 3C75H 4E54A 2IWFA 2UZYB 5AJAA 3ULEC 1PI6A 3I8CA 3OKTA 3CFVA 3F3GA 1NR0A 4O3UB 4L3HD 5FKQA 4E5ZA 4CI1A 3EI4B 4J73A 5CXBA 1XIPA 5TF2A 2GC4A 4GGDA 3EI3A 3JZNA 3ORVD 3PXSD 2PM6B 3NVNA 3I2NA 3DWLC 1SQ9A 4CI3A 3J80g 5IJ8E 2H14A 3JZHA 2PM9B 4GGCA 4QL1A 3PE7A 3OW8A 3SN6B 3EI4A 3EI1A 2HKRA 2G99A 2AGLA 2P9UC 3UKRC 1NEXB 1TYQC 4O45A 2TRCB 4U7AA 2B5NA 2HYEA 2AGZA 3ZWLB 4FA1D 5C2VB 2PM9A 2OVRB 4X60B 3EU7A 2AH0A 3FM0A 4A11B 3I7HA 2OK6A 4A0BB 3RN0D 5FKTA 5GSAA 1JMZB 3CIKB 2IUPA 3SFZA 2OVQB 4JXMA 2PM7B 2CO0C 3HFQA 2UZXB 4X61B 5EMKB 5IT9g 4AEZA 1XKSA 4L3GD 1XHMA 4ZOZA 3NVXA 2G9AA 3MKQA 5CXCB 5IGOA 4A7JA 4A11A 4A0BA 5EALA 5A2Qg 5HE3B 3KRWB 4O9DA 3DSMA 5FLXg 4J0XA 1PGUA 4A08B 5CYKB 3EMHA 2H6NA 4TZ4A 4CI2A 2Z2PA 4EWRA 4MK0B 1FWXA 2H9MA 4CY5A 5CXCA 2AGWA 3A0FA 1ERJA 2CNXA 1P22A 4E54B 3PXWD 4GQBB 1U4CA 3JRPA 2MTAH 2AH1A 4PSWB 2H47A 3DM0A 4FHLA 5C9ZB 2O9KA 3PXTD 4X63B 5FA5B 4A08A 4PSXB 4ES0A 5CYKA 5I5JA 4JT6C 2HXCA 3IKOA 5CXBB 4FAND 5KDOB 2B4EA 4UI9R 4K3ID 2HJBA 4IMMA 3I89A 4GQ1A 3IJ0A 2IWKA 4CY3A 4CY1A 4J77A 4FA4D 3IIWA 4QRJA 1N6FA 3P4FA 4A09B 5H14A 3OKWA 2H6QA 4N14A 2EBSA 3AL9A 4FWWA 5AFU3 4J84A 2CN2A 3EI1B 3GREA 2YBAA 3UKUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TEF A;  3PVW B;  3K27 A;  5EAP A;  4J82 A;  4H5J A;  4FB1 D;  3RSE C;  1Q47 A;  3UVK A;  3BWS A;  4R7A B;  3MKS B;  2I3S A;  4I79 A;  2P9K C;  5TDH B;  4PBY A;  3V9F A;  5GXH A;  4A09 A;  2AGX A;  4Y7R A;  2XL3 A;  2P9L C;  2CE9 A;  2I0S A;  4K3J B;  4ESG A;  1N6D A;  2IUQ A;  3SVW D;  3BG0 A;  3I7K A;  3FRX A;  3EG6 A;  4QQE A;  3C5M A;  5THA A;  4G56 B;  3L4O D;  5IJ7 E;  2Q7Q A;  4YVD A;  2P9N C;  3J81 g;  4CZY A;  1OLZ A;  1PEV A;  2W18 A;  1K8K C;  2P9S C;  3UR4 A;  3PSC B;  5FQD A;  1K32 A;  1OMW B;  4XYI A;  4J8B A;  4Z8L A;  4CZX A;  2IUR A;  3CFS B;  2OIZ A;  3AFC A;  3PSL A;  3VA6 A;  1B9Y A;  2B5M A;  4IA9 A;  2J57 G;  4J78 A;  2IUV A;  4PXW A;  1JOF A;  2QXV A;  3DXK C;  4X3E A;  2J55 H;  4LGN A;  3RN1 D;  5I5M A;  3UVM A;  2H9N A;  3OL2 B;  4XYH A;  2HKM A;  5EMJ B;  4GM9 A;  2I3T A;  5HE2 B;  3JB9 L;  2H13 A;  3SWS D;  4J86 A;  4A2M A;  4O3T B;  3F3F A;  2H68 A;  5HE0 B;  4L9O A;  4J0W A;  4FAV D;  4PBZ A;  4CI8 A;  2CN3 A;  5FKS A;  1JMX B;  3SBR A;  4A0A B;  1MG2 A;  3OL2 A;  3MXX A;  3I7O A;  3I7L A;  2PBI B;  4O1Q D;  3IJC A;  2H9L A;  5GMK n;  3UVN A;  5EML B;  5TEE A;  3EWE A;  5GXI A;  4OWR A;  4KFM B;  2YMU A;  3JPX A;  2OVP B;  3KRX B;  3MMY A;  4ZN4 A;  3V7D B;  3C9C A;  4A0A A;  2H6K A;  3OKY B;  3RFH A;  1N6E A;  4BUJ C;  5K19 A;  3SJL D;  1GOT B;  1YFQ A;  4U1E I;  3BG1 A;  3PVU B;  3SMR A;  5K1C C;  3IIY A;  4GGA A;  4JSN C;  1JJU B;  4Y5R D;  4J79 A;  2XU7 A;  5HQG A;  4GQ2 P;  4PNK B;  2BCJ B;  4QT8 A;  4ZOX A;  5IGQ A;  3NVQ A;  3OKY A;  3EI2 B;  4JSP C;  5IC7 A;  2OK4 A;  1GP2 B;  3RMZ D;  5H1M A;  5EAR A;  4GM3 A;  4L1Q D;  4GM8 A;  1MG3 A;  3FGB A;  3RFG A;  1SHY B;  5SXM A;  3IJ1 A;  5JWZ A;  5HE1 B;  3EI2 A;  3SBP A;  5EMM B;  3SCY A;  4BH6 A;  5EM2 B;  1U2V C;  3GFC A;  5H17 A;  3E0C A;  4BL0 A;  3UVO A;  1GG2 B;  3RLM D;  2YNO A;  4H5I A;  3U4Y A;  4CC9 A;  3UVL A;  2P9I C;  3AH8 B;  2YNN A;  1QNI A;  2YB8 B;  3C99 A;  3SBQ A;  4PC0 A;  2B5L A;  5AMS A;  1L0Q A;  2IAA A;  5EM2 A;  3VGZ A;  4ERQ A;  4OZU A;  3N0D A;  4CY2 A;  1TBG A;  3VH0 A;  3AL8 B;  3L4M D;  3N0E A;  2AQ5 A;  3V5W B;  5I5I A;  3I7N A;  4CZV A;  5C2W B;  4XEI C;  5B4W A;  2P9P C;  4D6V A;  1SQJ A;  4JSV C;  5FKR A;  3MZL A;  4JT5 C;  4J81 A;  2HES X;  4ERZ A;  1GXR A;  3MZK A;  1A0R B;  1MDA H;  2OJY A;  5EAM A;  3JRO A;  1S4U X;  2XYI A;  3AL8 A;  4ZOY A;  3F3P A;  4A2L A;  2CE8 A;  2QC5 A;  1B9X A;  2H3X A;  2H9P A;  2Z2N A;  3JAM g;  4FA9 D;  2YNP A;  3OTT A;  4LG8 A;  4HDJ A;  3I7P A;  4GMB A;  3ODT A;  3W15 A;  2Z2O A;  4FA5 D;  3SXT D;  2AGY A;  3K26 A;  3I8E A;  4ZOV A;  1RI6 A;  4JSX C;  4JD2 C;  1R5M A;  4NSX A;  3SHF A;  4ERY A;  5FXY A;  2J56 H;  3JZG A;  2I0T A;  1PBY B;  4J87 A;  5HYN B;  4AOW A;  1VYH C;  2I0R A;  4GZ8 A;  2GNQ A;  3DXM C;  4D0K A;  2GC7 A;  3SLE D;  4E5Z B;  2BBK H;  2CO0 A;  2XL2 A;  3RRM C;  4LG9 A;  3B7F A;  2HJ4 A;  3EI3 B;  4J8G A;  3C75 H;  4E54 A;  2IWF A;  2UZY B;  5AJA A;  3ULE C;  1PI6 A;  3I8C A;  3OKT A;  3CFV A;  3F3G A;  1NR0 A;  4O3U B;  4L3H D;  5FKQ A;  4E5Z A;  4CI1 A;  3EI4 B;  4J73 A;  5CXB A;  1XIP A;  5TF2 A;  2GC4 A;  4GGD A;  3EI3 A;  3JZN A;  3ORV D;  3PXS D;  2PM6 B;  3NVN A;  3I2N A;  3DWL C;  1SQ9 A;  4CI3 A;  3J80 g;  5IJ8 E;  2H14 A;  3JZH A;  2PM9 B;  4GGC A;  4QL1 A;  3PE7 A;  3OW8 A;  3SN6 B;  3EI4 A;  3EI1 A;  2HKR A;  2G99 A;  2AGL A;  2P9U C;  3UKR C;  1NEX B;  1TYQ C;  4O45 A;  2TRC B;  4U7A A;  2B5N A;  2HYE A;  2AGZ A;  3ZWL B;  4FA1 D;  5C2V B;  2PM9 A;  2OVR B;  4X60 B;  3EU7 A;  2AH0 A;  3FM0 A;  4A11 B;  3I7H A;  2OK6 A;  4A0B B;  3RN0 D;  5FKT A;  5GSA A;  1JMZ B;  3CIK B;  2IUP A;  3SFZ A;  2OVQ B;  4JXM A;  2PM7 B;  2CO0 C;  3HFQ A;  2UZX B;  4X61 B;  5EMK B;  5IT9 g;  4AEZ A;  1XKS A;  4L3G D;  1XHM A;  4ZOZ A;  3NVX A;  2G9A A;  3MKQ A;  5CXC B;  5IGO A;  4A7J A;  4A11 A;  4A0B A;  5EAL A;  5A2Q g;  5HE3 B;  3KRW B;  4O9D A;  3DSM A;  5FLX g;  4J0X A;  1PGU A;  4A08 B;  5CYK B;  3EMH A;  2H6N A;  4TZ4 A;  4CI2 A;  2Z2P A;  4EWR A;  4MK0 B;  1FWX A;  2H9M A;  4CY5 A;  5CXC A;  2AGW A;  3A0F A;  1ERJ A;  2CNX A;  1P22 A;  4E54 B;  3PXW D;  4GQB B;  1U4C A;  3JRP A;  2MTA H;  2AH1 A;  4PSW B;  2H47 A;  3DM0 A;  4FHL A;  5C9Z B;  2O9K A;  3PXT D;  4X63 B;  5FA5 B;  4A08 A;  4PSX B;  4ES0 A;  5CYK A;  5I5J A;  4JT6 C;  2HXC A;  3IKO A;  5CXB B;  4FAN D;  5KDO B;  2B4E A;  4UI9 R;  4K3I D;  2HJB A;  4IMM A;  3I89 A;  4GQ1 A;  3IJ0 A;  2IWK A;  4CY3 A;  4CY1 A;  4J77 A;  4FA4 D;  3IIW A;  4QRJ A;  1N6F A;  3P4F A;  4A09 B;  5H14 A;  3OKW A;  2H6Q A;  4N14 A;  2EBS A;  3AL9 A;  4FWW A;  5AFU 3;  4J84 A;  2CN2 A;  3EI1 B;  3GRE A;  2YBA A;  3UKU C; 
#chains in the Genus database with same CATH topology
 5TEF A;  3PVW B;  3K27 A;  5EAP A;  4J82 A;  4H5J A;  4FB1 D;  3RSE C;  4DNU A;  1Q47 A;  3UVK A;  1E8N A;  3BWS A;  4R7A B;  3MKS B;  2I3S A;  4I79 A;  3IUJ A;  5FFO A;  2P9K C;  5TDH B;  4PBY A;  3V9F A;  5GXH A;  4A09 A;  2AGX A;  4Y7R A;  2XL3 A;  2P9L C;  2CE9 A;  2I0S A;  5E6S A;  1E5T A;  4K3J B;  2VC2 A;  4ESG A;  1N6D A;  2IUQ A;  3SVW D;  3BG0 A;  3ZDY A;  3I7K A;  3FRX A;  1JV2 A;  3EG6 A;  4QQE A;  3C5M A;  2HU5 A;  5THA A;  4G56 B;  3L4O D;  5IJ7 E;  2Q7Q A;  4YVD A;  4AMZ A;  5HDB A;  5C92 A;  2P9N C;  4WJK A;  3J81 g;  4CZY A;  1OLZ A;  1PEV A;  1C9I A;  2W18 A;  4Z7N A;  1K8K C;  2P9S C;  3UR4 A;  3PSC B;  5FQD A;  1K32 A;  3O4G A;  1OMW B;  4XYI A;  4BP9 A;  4J8B A;  4Z8L A;  2HU8 A;  2XE4 A;  4CZX A;  2IUR A;  3CFS B;  2VDM A;  2OIZ A;  3AFC A;  3PSL A;  3VA6 A;  1B9Y A;  2B5M A;  5M5T A;  4IA9 A;  2J57 G;  4BCB A;  4J78 A;  2IUV A;  1E8M A;  4PXW A;  1JOF A;  4AN0 A;  2QXV A;  3DXK C;  4X3E A;  2J55 H;  4LGN A;  3RN1 D;  5I5M A;  3UVM A;  2XZG A;  2H9N A;  3OL2 B;  4XYH A;  2HKM A;  4D9S A;  5EMJ B;  4GM9 A;  4JHP C;  2I3T A;  5HE2 B;  3JB9 L;  1T2X A;  2H13 A;  3SWS D;  4J86 A;  4A2M A;  3EQ9 A;  4O3T B;  3VI4 A;  1O6G A;  3F3F A;  2H68 A;  2HU7 A;  5HE0 B;  4IRZ A;  4L9O A;  4J0W A;  4FAV D;  4PBZ A;  4CI8 A;  2CN3 A;  3NIF A;  3FCU A;  5FKS A;  1JMX B;  3SBR A;  4A0A B;  4Z7Q A;  1MG2 A;  3OL2 A;  3MXX A;  3I7O A;  3I7L A;  2PBI B;  4O1Q D;  3IJC A;  5M5U A;  2H9L A;  5GMK n;  4O2W A;  2EIB A;  1H2W A;  3UVN A;  5EML B;  5TEE A;  3ZE1 A;  3EWE A;  5GXI A;  4OWR A;  4KFM B;  2YMU A;  3JPX A;  2OVP B;  3KRX B;  3MMY A;  4ZN4 A;  3V7D B;  3C9C A;  4A0A A;  3K71 A;  2H6K A;  3OKY B;  3RFH A;  1N6E A;  4BUJ C;  5K19 A;  3SJL D;  1GOT B;  1YFQ A;  4U1E I;  3BG1 A;  3PVU B;  4AN1 A;  3SMR A;  5K1C C;  3IIY A;  4GGA A;  4AMY A;  4JSN C;  2WQ8 A;  1JJU B;  4Y5R D;  4J79 A;  2XU7 A;  5M5R A;  5HQG A;  4GQ2 P;  4PNK B;  2BCJ B;  4QT8 A;  4ZOX A;  5IGQ A;  3NVQ A;  3OKY A;  5FFG A;  3EI2 B;  4JSP C;  1C9L A;  5IC7 A;  2OK4 A;  3VI3 A;  1GP2 B;  3RMZ D;  5H1M A;  2VZ3 A;  5EAR A;  4GM3 A;  4L1Q D;  4GM8 A;  1I2M B;  2VDL A;  1MG3 A;  3FGB A;  3QI0 A;  1O6F A;  3RFG A;  1SHY B;  5SXM A;  3IJ1 A;  5JWZ A;  5HE1 B;  4MMY A;  4BCD A;  4DNV A;  2VDK A;  3EQ7 A;  3SBP A;  5EMM B;  3EI2 A;  3SCY A;  4BH6 A;  5EM2 B;  1U2V C;  3GFC A;  1UOO A;  5H17 A;  3E0C A;  4UM9 A;  4BL0 A;  3UVO A;  4MMZ A;  1GG2 B;  3RLM D;  2VDP A;  3IVM A;  2YNO A;  2VDQ A;  3IUR A;  4H5I A;  3DDU A;  3EQ8 A;  3U4Y A;  4CC9 A;  3UVL A;  2P9I C;  3AH8 B;  2YNN A;  1QNI A;  2YB8 B;  3C99 A;  3SBQ A;  4PC0 A;  2B5L A;  5AMS A;  1L0Q A;  2IAA A;  5EM2 A;  3VGZ A;  3KCI A;  4ERQ A;  3QHY B;  1M1X A;  3N0D A;  3O4J A;  4OZU A;  1TBG A;  4CY2 A;  3VH0 A;  3AL8 B;  3L4M D;  3N0E A;  2AQ5 A;  3V5W B;  5I5I A;  1L5G A;  3I7N A;  4CZV A;  4MMX A;  1UOP A;  4XEI C;  5C2W B;  5B4W A;  4WK4 A;  2P9P C;  4D6V A;  3GD1 I;  4NAA A;  1SQJ A;  4JSV C;  5FKR A;  3MZL A;  4JT5 C;  2HES X;  4J81 A;  4ERZ A;  1GXR A;  3OF7 A;  3MZK A;  1A0R B;  1MDA H;  2OJY A;  5EAM A;  3JRO A;  1S4U X;  2XYI A;  3AL8 A;  4WK0 A;  4ZOY A;  3F3P A;  4A2L A;  2CE8 A;  2QC5 A;  1B9X A;  2H3X A;  1GOF A;  3ZDZ A;  2H9P A;  2Z2N A;  3JAM g;  4FA9 D;  4UM8 A;  1GOH A;  2YNP A;  3OTT A;  4LG8 A;  4HDJ A;  3I7P A;  4GMB A;  3ODT A;  4NC4 A;  3K6S A;  3W15 A;  2Z2O A;  4FA5 D;  3IUQ A;  3SXT D;  2AGY A;  3K26 A;  3I8E A;  4ZOV A;  1RI6 A;  4JSX C;  4JD2 C;  1R5M A;  4NSX A;  3SHF A;  2BKL A;  4ERY A;  5FXY A;  2J56 H;  3JZG A;  2I0T A;  1PBY B;  2VDN A;  4J87 A;  5HYN B;  2JKX A;  4AOW A;  3IUN A;  1VYH C;  2I0R A;  2EIC A;  4GZ8 A;  2GNQ A;  3DXM C;  4D0K A;  2GC7 A;  3SLE D;  4E5Z B;  2BBK H;  2CO0 A;  2XL2 A;  4JHN A;  4L1M A;  3RRM C;  4WK2 A;  4LG9 A;  3V4V A;  3B7F A;  2HJ4 A;  3EI3 B;  4J8G A;  4O02 A;  1UTC A;  3C75 H;  5C86 A;  4E54 A;  2IWF A;  4QAM A;  2UZY B;  5AJA A;  5M61 A;  3ULE C;  1PI6 A;  3I8C A;  3OKT A;  3CFV A;  3F3G A;  1NR0 A;  3ZE2 A;  4O3U B;  4L3H D;  5FKQ A;  4E5Z A;  4CI1 A;  4NEN A;  3EI4 B;  4J73 A;  1UOQ A;  5CXB A;  1XIP A;  5TF2 A;  2GC4 A;  3IJE A;  4GGD A;  3EI3 A;  3ZE0 A;  3JZN A;  3ORV D;  3PXS D;  2PM6 B;  3NVN A;  1QFM A;  3I2N A;  3DWL C;  1H2Z A;  1GOG A;  1SQ9 A;  4CI3 A;  3J80 g;  2EID A;  5IJ8 E;  2H14 A;  3JZH A;  2PM9 B;  4GGC A;  2VDR A;  4QL1 A;  3PE7 A;  3OW8 A;  3SN6 B;  3EI4 A;  3EI1 A;  2HKR A;  2G99 A;  2AGL A;  2P9U C;  3UKR C;  1NEX B;  1TYQ C;  5M5S A;  4O45 A;  1VE6 A;  2TRC B;  4U7A A;  2B5N A;  2HYE A;  2AGZ A;  3ZWL B;  4FA1 D;  5C2V B;  2PM9 A;  2XDW A;  2OVR B;  4X60 B;  3EU7 A;  3ZDX A;  3IUL A;  2AH0 A;  3O4H A;  3FM0 A;  4A11 B;  1JTD B;  3I7H A;  3GC3 B;  2OK6 A;  4A0B B;  3RN0 D;  5FKT A;  5GSA A;  1JMZ B;  3CIK B;  2IUP A;  5E6R A;  2OVQ B;  3SFZ A;  4JXM A;  2PM7 B;  2CO0 C;  3HFQ A;  2UZX B;  4RE6 A;  4X61 B;  2VZ1 A;  5EMK B;  1XKS A;  4AEZ A;  5IT9 g;  4L3G D;  1XHM A;  1H2Y A;  4G1M A;  3FCS A;  4ZOZ A;  3NVX A;  2G9A A;  3MKQ A;  1TYE A;  1VE7 A;  5CXC B;  1YR2 A;  2VDO A;  3T3M A;  5IGO A;  4RE5 A;  4A7J A;  4A11 A;  4DNW A;  4A0B A;  5E6U A;  1U8C A;  5EAL A;  5A2Q g;  5HE3 B;  4G55 A;  3KRW B;  4O9D A;  3DSM A;  5FLX g;  4G1E A;  3IUM A;  4J0X A;  1PGU A;  4A08 B;  5CYK B;  3EMH A;  1VZ3 A;  2H6N A;  3MUN A;  4TZ4 A;  4CI2 A;  2Z2P A;  4EWR A;  4MK0 B;  1FWX A;  2H9M A;  4CY5 A;  5CXC A;  2AGW A;  1A12 A;  2QR5 A;  3A0F A;  1ERJ A;  2CNX A;  2QZP A;  1P22 A;  4E54 B;  3PXW D;  1U4C A;  4GQB B;  3JRP A;  2MTA H;  2AH1 A;  4PSW B;  3NIG A;  5M5V A;  3NID A;  4AX4 A;  2H47 A;  3DM0 A;  4FHL A;  3MVD K;  5C9Z B;  1H2X A;  2O9K A;  3PXT D;  4X63 B;  5FA5 B;  4A08 A;  4PSX B;  4ES0 A;  5CYK A;  5I5J A;  4JT6 C;  2HXC A;  2EIE A;  3IKO A;  4Z7O A;  5CXB B;  1VZ2 A;  4FAN D;  5KDO B;  4BCC A;  2B4E A;  4UI9 R;  3MUO A;  4K3I D;  2HJB A;  4IMM A;  3T3P A;  1BPO A;  3I89 A;  4BP8 A;  4GQ1 A;  3IJ0 A;  2IWK A;  4CY3 A;  4CY1 A;  4J77 A;  4FA4 D;  3IIW A;  4QRJ A;  1N6F A;  3P4F A;  3V4P A;  4A09 B;  5H14 A;  3OKW A;  2H6Q A;  4FWW A;  2EBS A;  3AL9 A;  4N14 A;  4NBM A;  5AFU 3;  4J84 A;  1QFS A;  2CN2 A;  3EI1 B;  3GRE A;  3O4I A;  1K3I A;  3K72 A;  2YBA A;  3UKU C; 
#chains in the Genus database with same CATH homology
 5TEF A;  3PVW B;  3K27 A;  5EAP A;  4J82 A;  4H5J A;  4FB1 D;  3RSE C;  1Q47 A;  3UVK A;  3BWS A;  4R7A B;  3MKS B;  2I3S A;  4I79 A;  2P9K C;  5TDH B;  4PBY A;  3V9F A;  5GXH A;  4A09 A;  2AGX A;  4Y7R A;  2XL3 A;  2P9L C;  2CE9 A;  2I0S A;  4K3J B;  4ESG A;  1N6D A;  2IUQ A;  3SVW D;  3BG0 A;  3I7K A;  3FRX A;  3EG6 A;  4QQE A;  3C5M A;  5THA A;  4G56 B;  3L4O D;  5IJ7 E;  2Q7Q A;  4YVD A;  2P9N C;  3J81 g;  4CZY A;  1OLZ A;  1PEV A;  2W18 A;  1K8K C;  2P9S C;  3UR4 A;  3PSC B;  5FQD A;  1K32 A;  1OMW B;  4XYI A;  4J8B A;  4Z8L A;  4CZX A;  2IUR A;  3CFS B;  2OIZ A;  3AFC A;  3PSL A;  3VA6 A;  1B9Y A;  2B5M A;  4IA9 A;  2J57 G;  4J78 A;  2IUV A;  4PXW A;  1JOF A;  2QXV A;  3DXK C;  4X3E A;  2J55 H;  4LGN A;  3RN1 D;  5I5M A;  3UVM A;  2H9N A;  3OL2 B;  4XYH A;  2HKM A;  5EMJ B;  4GM9 A;  2I3T A;  5HE2 B;  3JB9 L;  2H13 A;  3SWS D;  4J86 A;  4A2M A;  4O3T B;  3F3F A;  2H68 A;  5HE0 B;  4L9O A;  4J0W A;  4FAV D;  4PBZ A;  4CI8 A;  2CN3 A;  5FKS A;  1JMX B;  3SBR A;  4A0A B;  1MG2 A;  3OL2 A;  3MXX A;  3I7O A;  3I7L A;  2PBI B;  4O1Q D;  3IJC A;  2H9L A;  5GMK n;  3UVN A;  5EML B;  5TEE A;  3EWE A;  5GXI A;  4OWR A;  4KFM B;  2YMU A;  3JPX A;  2OVP B;  3KRX B;  3MMY A;  4ZN4 A;  3V7D B;  3C9C A;  4A0A A;  2H6K A;  3OKY B;  3RFH A;  1N6E A;  4BUJ C;  5K19 A;  3SJL D;  1GOT B;  1YFQ A;  4U1E I;  3BG1 A;  3PVU B;  3SMR A;  5K1C C;  3IIY A;  4GGA A;  4JSN C;  1JJU B;  4Y5R D;  4J79 A;  2XU7 A;  5HQG A;  4GQ2 P;  4PNK B;  2BCJ B;  4QT8 A;  4ZOX A;  5IGQ A;  3NVQ A;  3OKY A;  3EI2 B;  4JSP C;  5IC7 A;  2OK4 A;  1GP2 B;  3RMZ D;  5H1M A;  5EAR A;  4GM3 A;  4L1Q D;  4GM8 A;  1MG3 A;  3FGB A;  3RFG A;  1SHY B;  5SXM A;  3IJ1 A;  5JWZ A;  5HE1 B;  3EI2 A;  3SBP A;  5EMM B;  3SCY A;  4BH6 A;  5EM2 B;  1U2V C;  3GFC A;  5H17 A;  3E0C A;  4BL0 A;  3UVO A;  1GG2 B;  3RLM D;  2YNO A;  4H5I A;  3U4Y A;  4CC9 A;  3UVL A;  2P9I C;  3AH8 B;  2YNN A;  1QNI A;  2YB8 B;  3C99 A;  3SBQ A;  4PC0 A;  2B5L A;  5AMS A;  1L0Q A;  2IAA A;  5EM2 A;  3VGZ A;  4ERQ A;  4OZU A;  3N0D A;  4CY2 A;  1TBG A;  3VH0 A;  3AL8 B;  3L4M D;  3N0E A;  2AQ5 A;  3V5W B;  5I5I A;  3I7N A;  4CZV A;  5C2W B;  4XEI C;  5B4W A;  2P9P C;  4D6V A;  1SQJ A;  4JSV C;  5FKR A;  3MZL A;  4JT5 C;  4J81 A;  2HES X;  4ERZ A;  1GXR A;  3MZK A;  1A0R B;  1MDA H;  2OJY A;  5EAM A;  3JRO A;  1S4U X;  2XYI A;  3AL8 A;  4ZOY A;  3F3P A;  4A2L A;  2CE8 A;  2QC5 A;  1B9X A;  2H3X A;  2H9P A;  2Z2N A;  3JAM g;  4FA9 D;  2YNP A;  3OTT A;  4LG8 A;  4HDJ A;  3I7P A;  4GMB A;  3ODT A;  3W15 A;  2Z2O A;  4FA5 D;  3SXT D;  2AGY A;  3K26 A;  3I8E A;  4ZOV A;  1RI6 A;  4JSX C;  4JD2 C;  1R5M A;  4NSX A;  3SHF A;  4ERY A;  5FXY A;  2J56 H;  3JZG A;  2I0T A;  1PBY B;  4J87 A;  5HYN B;  4AOW A;  1VYH C;  2I0R A;  4GZ8 A;  2GNQ A;  3DXM C;  4D0K A;  2GC7 A;  3SLE D;  4E5Z B;  2BBK H;  2CO0 A;  2XL2 A;  3RRM C;  4LG9 A;  3B7F A;  2HJ4 A;  3EI3 B;  4J8G A;  3C75 H;  4E54 A;  2IWF A;  2UZY B;  5AJA A;  3ULE C;  1PI6 A;  3I8C A;  3OKT A;  3CFV A;  3F3G A;  1NR0 A;  4O3U B;  4L3H D;  5FKQ A;  4E5Z A;  4CI1 A;  3EI4 B;  4J73 A;  5CXB A;  1XIP A;  5TF2 A;  2GC4 A;  4GGD A;  3EI3 A;  3JZN A;  3ORV D;  3PXS D;  2PM6 B;  3NVN A;  3I2N A;  3DWL C;  1SQ9 A;  4CI3 A;  3J80 g;  5IJ8 E;  2H14 A;  3JZH A;  2PM9 B;  4GGC A;  4QL1 A;  3PE7 A;  3OW8 A;  3SN6 B;  3EI4 A;  3EI1 A;  2HKR A;  2G99 A;  2AGL A;  2P9U C;  3UKR C;  1NEX B;  1TYQ C;  4O45 A;  2TRC B;  4U7A A;  2B5N A;  2HYE A;  2AGZ A;  3ZWL B;  4FA1 D;  5C2V B;  2PM9 A;  2OVR B;  4X60 B;  3EU7 A;  2AH0 A;  3FM0 A;  4A11 B;  3I7H A;  2OK6 A;  4A0B B;  3RN0 D;  5FKT A;  5GSA A;  1JMZ B;  3CIK B;  2IUP A;  3SFZ A;  2OVQ B;  4JXM A;  2PM7 B;  2CO0 C;  3HFQ A;  2UZX B;  4X61 B;  5EMK B;  5IT9 g;  4AEZ A;  1XKS A;  4L3G D;  1XHM A;  4ZOZ A;  3NVX A;  2G9A A;  3MKQ A;  5CXC B;  5IGO A;  4A7J A;  4A11 A;  4A0B A;  5EAL A;  5A2Q g;  5HE3 B;  3KRW B;  4O9D A;  3DSM A;  5FLX g;  4J0X A;  1PGU A;  4A08 B;  5CYK B;  3EMH A;  2H6N A;  4TZ4 A;  4CI2 A;  2Z2P A;  4EWR A;  4MK0 B;  1FWX A;  2H9M A;  4CY5 A;  5CXC A;  2AGW A;  3A0F A;  1ERJ A;  2CNX A;  1P22 A;  4E54 B;  3PXW D;  4GQB B;  1U4C A;  3JRP A;  2MTA H;  2AH1 A;  4PSW B;  2H47 A;  3DM0 A;  4FHL A;  5C9Z B;  2O9K A;  3PXT D;  4X63 B;  5FA5 B;  4A08 A;  4PSX B;  4ES0 A;  5CYK A;  5I5J A;  4JT6 C;  2HXC A;  3IKO A;  5CXB B;  4FAN D;  5KDO B;  2B4E A;  4UI9 R;  4K3I D;  2HJB A;  4IMM A;  3I89 A;  4GQ1 A;  3IJ0 A;  2IWK A;  4CY3 A;  4CY1 A;  4J77 A;  4FA4 D;  3IIW A;  4QRJ A;  1N6F A;  3P4F A;  4A09 B;  5H14 A;  3OKW A;  2H6Q A;  4N14 A;  2EBS A;  3AL9 A;  4FWW A;  5AFU 3;  4J84 A;  2CN2 A;  3EI1 B;  3GRE A;  2YBA A;  3UKU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...