2I3TA

Bub3 complex with mad3 (bubr1) glebs motif
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
340
structure length
334
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell cycle arrest protein
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 81
structure length 334
sequence length 340
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3tA00
5HQGA 4Y5RD 5THAA 4ZOZA 4JT5C 5EMMB 3RN1D 1YFQA 1FWXA 2YB8B 4O3TB 3EG6A 5IGQA 2IURA 2H14A 2UZXB 2PM9A 1PGUA 4PBZA 3SN6B 1XKSA 4A0BA 5K1CC 5FLXg 2HKMA 1OLZA 4QL1A 5C2VB 2MTAH 3SXTD 3C75H 5HYNB 3VA6A 4J87A 3SBRA 2QC5A 5CXCB 4GGDA 5EMLB 5IJ8E 5C9ZB 3EI1A 2AGXA 2OJYA 4OZUA 3NVNA 2UZYB 3HFQA 2IUVA 3EI2A 3PXTD 3JZHA 4U7AA 2PM6B 4PXWA 1L0QA 3CIKB 5FKTA 2Z2PA 4TZ4A 3MMYA 2IUPA 3W15A 4G56B 2PBIB 4ZOYA 2J55H 3BG0A 4CC9A 4BL0A 2O9KA 4LGNA 4J86A 3VGZA 3RRMC 2AH1A 4QT8A 3I8EA 3JROA 5IC7A 4R7AB 3EWEA 3IIYA 3KRXB 1GP2B 4E5ZA 3C99A 1Q47A 3SLED 5TEEA 2P9NC 1B9YA 3AL8B 3AL9A 3J80g 2H6KA 4D6VA 2H9MA 4GM9A 1MG3A 3UVLA 2PM7B 4E54B 5H14A 3IJ1A 2B5MA 3SCYA 1PBYB 3JPXA 2YNNA 4GMBA 4J73A 4J78A 3UVNA 5HE1B 3UKRC 3PXSD 2IWKA 4BUJC 4K3JB 5I5JA 4CI2A 5JWZA 4L3GD 1A0RB 4A0AB 3SBQA 4CY2A 2AGZA 4A11A 4FAND 2XL2A 1U4CA 4I79A 4L1QD 3U4YA 2HESX 5KDOB 1NR0A 3C9CA 5EAPA 2IAAA 3RSEC 4PC0A 1GG2B 2B5NA 4CI1A 4J8GA 4J79A 2P9KC 1JOFA 3PVWB 4X63B 4IMMA 2CE9A 2HXCA 3L4OD 3ORVD 5IGOA 2I3TA 5FKQA 5FKSA 3JZNA 3CFSB 3OL2B 1K32A 5IJ7E 4JSPC 3SVWD 2I3SA 3MKQA 3K26A 2GC7A 4ERYA 4A08B 3ZWLB 4O1QD 3EI3A 1SHYB 4BH6A 3PSLA 3FM0A 3IKOA 2CE8A 3MZLA 3RMZD 3J81g 4PSWB 4X60B 3OKTA 2GC4A 2TRCB 4J77A 5CYKB 4XYIA 3KRWB 5EMKB 4CY5A 2H9LA 3AL8A 4CI8A 1GXRA 1P22A 5B4WA 4J84A 3SJLD 5A2Qg 3IJ0A 3I7OA 2YNOA 3UVOA 4JXMA 3SBPA 4FHLA 4A2MA 2HJBA 1U2VC 1PEVA 4JSXC 1MG2A 1NEXB 3FRXA 4CZXA 3OTTA 4A0BB 2BCJB 2AH0A 1RI6A 4D0KA 5IT9g 2CN2A 4A0AA 4J8BA 3UKUC 5HE2B 3EI4B 3V5WB 1SQ9A 1K8KC 1N6EA 3AH8B 3SWSD 2XU7A 4H5IA 4O3UB 2OVRB 2IWFA 5HE0B 3NVXA 4Y7RA 3VH0A 5TF2A 3UR4A 2W18A 1MDAH 2YNPA 3EI1B 4ZOVA 2H68A 3SFZA 3NVQA 4PBYA 2OVPB 2HYEA 3V9FA 4K3ID 3I7LA 5AMSA 1N6DA 1ERJA 5FKRA 4YVDA 3V7DB 4OWRA 2XYIA 2XL3A 4J82A 3DWLC 1GOTB 5FA5B 1N6FA 3UVKA 5EM2B 2J57G 2I0TA 3MXXA 5AFU3 4FB1D 3BWSA 5AJAA 4PNKB 3I89A 3DXMC 1JJUB 3I2NA 4GGAA 2GNQA 2Z2NA 2G99A 2H6NA 1S4UX 4IA9A 3PSCB 4HDJA 5H1MA 3MZKA 3I7HA 3I7NA 5CXCA 2YMUA 4QRJA 4O45A 4L9OA 4FWWA 4E5ZB 3IJCA 3L4MD 1R5MA 2CO0A 2Z2OA 3GFCA 4J0XA 5CYKA 3EU7A 4GGCA 5TEFA 4FA4D 4A09B 2H6QA 4FA1D 5CXBB 1OMWB 4AEZA 3RFGA 3C5MA 5K19A 4CY3A 2B5LA 3OKYB 3F3PA 4EWRA 2AQ5A 4XEIC 3JB9L 2P9IC 3RFHA 5GMKn 2I0SA 2H47A 3IIWA 3I7KA 4CY1A 4ZOXA 4LG8A 4L3HD 2BBKH 1XIPA 4XYHA 4A11B 5FXYA 3F3FA 3EI4A 3CFVA 4ERQA 4Z8LA 3JAMg 5GXHA 3UVMA 4LG9A 3SMRA 2P9SC 5I5MA 4E54A 2QXVA 4FAVD 5GXIA 5C2WB 4J0WA 2AGLA 1JMXB 1PI6A 1SQJA 4ESGA 3OKWA 4J81A 1JMZB 3MKSB 1TYQC 3JZGA 4X61B 4JT6C 3N0DA 2I0RA 5HE3B 2CNXA 4GM3A 4O9DA 4JD2C 4ES0A 2OVQB 2PM9B 2H3XA 2YBAA 3GREA 2J56H 3ULEC 5EM2A 2CO0C 3P4FA 3N0EA 4KFMB 4PSXB 5EAMA 4A7JA 3EI3B 3PVUB 3E0CA 3I7PA 2P9PC 4N14A 3AFCA 3SHFA 1B9XA 3OW8A 3F3GA 4U1EI 4GQBB 5I5IA 4JSNC 2OK6A 4QQEA 4ZN4A 5SXMA 2EBSA 3PXWD 4A2LA 3RN0D 1TBGA 4CZYA 2CN3A 3EI2B 4ERZA 4CI3A 2AGYA 3PE7A 2OK4A 3DSMA 3DM0A 2H9NA 5FQDA 3OL2A 5EMJB 4A09A 4X3EA 3K27A 2HJ4A 5CXBA 5EALA 4FA5D 3BG1A 2G9AA 3ODTA 1XHMA 3OKYA 5TDHB 4UI9R 2P9UC 4A08A 3EMHA 3FGBA 3I8CA 2AGWA 2HKRA 4AOWA 3B7FA 4JSVC 4MK0B 4NSXA 2H13A 2H9PA 4GQ1A 1QNIA 4GM8A 4GZ8A 4CZVA 1VYHC 4FA9D 5GSAA 2P9LC 4H5JA 3A0FA 3JRPA 5EARA 2Q7QA 5H17A 2IUQA 4GQ2P 2OIZA 3DXKC 3RLMD 2B4EA
chains in the Genus database with same CATH superfamily
5HQGA 4Y5RD 5THAA 4ZOZA 4JT5C 5EMMB 3RN1D 3T3PA 1YFQA 1FWXA 2YB8B 4O3TB 5FFOA 3EG6A 5IGQA 2IURA 2H14A 2UZXB 2PM9A 1PGUA 4PBZA 3SN6B 1XKSA 4A0BA 1GOGA 5K1CC 5FLXg 2HKMA 1OLZA 4QL1A 5C2VB 1YR2A 2MTAH 3SXTD 1QFSA 3C75H 4NENA 5HYNB 3EQ7A 3VA6A 1JV2A 4J87A 3SBRA 1TYEA 2QC5A 1M1XA 2XZGA 4GGDA 5CXCB 3ZE2A 5EMLB 5IJ8E 3K6SA 5C9ZB 3EI1A 2AGXA 2OJYA 4OZUA 3NVNA 2UZYB 3HFQA 2EIBA 2IUVA 2JKXA 3EI2A 4BP9A 3PXTD 3JZHA 4U7AA 2PM6B 2VDMA 4Z7OA 4PXWA 2EIEA 1L0QA 3CIKB 4NAAA 5FKTA 3IUNA 2Z2PA 4TZ4A 3MMYA 2IUPA 3W15A 4G56B 2PBIB 4ZOYA 2J55H 3BG0A 4CC9A 3K71A 4BL0A 2O9KA 4LGNA 4NC4A 4J86A 3VGZA 3RRMC 2AH1A 4QT8A 3I8EA 3JROA 5IC7A 4R7AB 3QHYB 3EWEA 3IIYA 3KRXB 1GP2B 3EQ8A 4E5ZA 3C99A 1Q47A 3SLED 5TEEA 2BKLA 2P9NC 3NIGA 2VDOA 3DDUA 1B9YA 3AL8B 3AL9A 3J80g 2H6KA 4D6VA 2H9MA 2VDLA 4GM9A 4Z7NA 1MG3A 3UVLA 2PM7B 4E54B 5H14A 3IJ1A 4RE5A 1VZ2A 2B5MA 3SCYA 3ZE0A 1PBYB 3JPXA 4WK4A 2YNNA 4GMBA 4J73A 5M5RA 4J78A 3UVNA 5M5TA 5HE1B 4AMYA 3UKRC 3MUOA 3PXSD 2IWKA 4BUJC 4JHNA 4K3JB 5I5JA 4CI2A 4DNWA 5JWZA 4L3GD 1A0RB 3IURA 4A0AB 3SBQA 1QFMA 4CY2A 2AGZA 4A11A 4FAND 2XL2A 1U4CA 4I79A 4L1QD 3U4YA 2HESX 5KDOB 2VZ1A 1NR0A 3C9CA 5EAPA 2IAAA 3RSEC 1VE6A 4G1EA 4PC0A 3NIDA 5HDBA 1GG2B 2B5NA 4CI1A 4J8GA 4J79A 2P9KC 1JOFA 3PVWB 4X63B 3IVMA 4IMMA 4AN0A 2CE9A 2HXCA 3L4OD 3ORVD 5IGOA 2I3TA 1K3IA 5FKQA 5FKSA 3JZNA 1JTDB 3CFSB 1K32A 3OL2B 5IJ7E 4JSPC 4BCDA 3SVWD 5M61A 2I3SA 4QAMA 3OF7A 3MKQA 2VDNA 3K26A 2GC7A 2VDKA 4ERYA 4A08B 3ZWLB 4O1QD 3EI3A 1SHYB 4BH6A 3PSLA 2EICA 3FM0A 4BCCA 3IKOA 3IJEA 2CE8A 3MZLA 2QR5A 3RMZD 3J81g 4PSWB 4X60B 3OKTA 4MMYA 4WJKA 2GC4A 2TRCB 3V4PA 4J77A 2WQ8A 5CYKB 4XYIA 3FCSA 3KRWB 5EMKB 4CY5A 4D9SA 1VE7A 2H9LA 3AL8A 3IULA 3NIFA 4G55A 3T3MA 1GOFA 4CI8A 1GXRA 1P22A 5B4WA 1O6FA 4J84A 3SJLD 5A2Qg 3IJ0A 3I7OA 2YNOA 3UVOA 1E8NA 4JXMA 1UOPA 3SBPA 3KCIA 4FHLA 4A2MA 2HJBA 1U2VC 2HU8A 3GD1I 1PEVA 4JSXC 1MG2A 1NEXB 3FRXA 1I2MB 4BP8A 4RE6A 4CZXA 3OTTA 4DNVA 4A0BB 2BCJB 2AH0A 1RI6A 4D0KA 5IT9g 2CN2A 4A0AA 4J8BA 3UKUC 5HE2B 1H2ZA 3EI4B 3V5WB 1SQ9A 1K8KC 1N6EA 3AH8B 3SWSD 2XU7A 4H5IA 4O3UB 2OVRB 2IWFA 5HE0B 3NVXA 4Y7RA 3VH0A 5TF2A 1BPOA 3UR4A 1C9LA 2W18A 1MDAH 2YNPA 2XE4A 5M5UA 3EI1B 4ZOVA 4O02A 2H68A 3SFZA 3NVQA 4PBYA 2OVPB 2HYEA 3V9FA 4K3ID 1U8CA 3I7LA 5AMSA 1N6DA 1ERJA 5FKRA 4YVDA 3V7DB 4OWRA 2XYIA 2XL3A 4J82A 3DWLC 1GOTB 5FA5B 1N6FA 3UVKA 5EM2B 2J57G 2I0TA 3MXXA 4WK2A 1L5GA 3EQ9A 1UOOA 5AFU3 4FB1D 3BWSA 3O4HA 5AJAA 4PNKB 3I89A 3DXMC 1JJUB 1UTCA 3I2NA 4GGAA 2GNQA 2Z2NA 5M5VA 2G99A 2H6NA 1H2YA 1S4UX 4IA9A 3PSCB 4HDJA 5H1MA 3MZKA 3I7HA 3I7NA 5CXCA 2YMUA 4QRJA 1VZ3A 4O45A 4L9OA 4FWWA 4E5ZB 3IJCA 2VZ3A 3L4MD 3MUNA 1R5MA 2CO0A 2Z2OA 3GFCA 4J0XA 5CYKA 3EU7A 3V4VA 3QI0A 3ZDYA 4GGCA 5TEFA 4FA4D 1T2XA 4A09B 4AMZA 2H6QA 4FA1D 5CXBB 1OMWB 4AEZA 3RFGA 3C5MA 5K19A 4CY3A 2B5LA 3O4IA 3OKYB 3F3PA 4EWRA 2AQ5A 4XEIC 3JB9L 2P9IC 3RFHA 5GMKn 3ZDXA 4MMXA 2I0SA 2H47A 3IUMA 3IIWA 3I7KA 5FFGA 4CY1A 4UM9A 4ZOXA 4LG8A 4AX4A 4L3HD 2BBKH 1XIPA 2VC2A 4XYHA 3IUJA 4A11B 1O6GA 3F3FA 5FXYA 5C86A 1E5TA 3EI4A 1C9IA 3CFVA 3FCUA 4ERQA 4Z8LA 3JAMg 5GXHA 3UVMA 3O4GA 3MVDK 4LG9A 2QZPA 3SMRA 2P9SC 4UM8A 5I5MA 4E54A 2QXVA 4FAVD 5GXIA 5C2WB 4J0WA 2AGLA 1JMXB 1PI6A 1SQJA 4ESGA 3OKWA 4J81A 5E6RA 4G1MA 1JMZB 3MKSB 3GC3B 5E6UA 1TYQC 3JZGA 4X61B 4JT6C 3N0DA 2I0RA 2XDWA 5HE3B 2CNXA 4GM3A 4O9DA 3VI4A 4JD2C 4ES0A 2HU5A 2OVQB 2PM9B 2H3XA 2YBAA 3GREA 2J56H 4IRZA 3ULEC 5EM2A 2CO0C 3P4FA 3N0EA 4AN1A 4KFMB 2VDRA 3O4JA 4PSXB 2VDPA 5EAMA 4A7JA 3EI3B 4JHPC 3PVUB 1UOQA 3E0CA 3I7PA 2P9PC 4N14A 3AFCA 2VDQA 1H2WA 3SHFA 1B9XA 3OW8A 3F3GA 4U1EI 4GQBB 5I5IA 4JSNC 2OK6A 4QQEA 4ZN4A 5SXMA 2EBSA 3PXWD 4A2LA 3RN0D 1TBGA 4CZYA 2CN3A 1A12A 3EI2B 4ERZA 4CI3A 2AGYA 3PE7A 2OK4A 3DSMA 3DM0A 4BCBA 2HU7A 4MMZA 2H9NA 5FQDA 3OL2A 5EMJB 4A09A 4X3EA 3K27A 2HJ4A 5CXBA 5EALA 1H2XA 4FA5D 3BG1A 2G9AA 3IUQA 3ODTA 1GOHA 1XHMA 4Z7QA 3OKYA 5TDHB 3K72A 3ZDZA 4UI9R 2P9UC 4WK0A 4A08A 3EMHA 3FGBA 3I8CA 2AGWA 2HKRA 5M5SA 4NBMA 4AOWA 3B7FA 4JSVC 1E8MA 2EIDA 4L1MA 4DNUA 4MK0B 4NSXA 2H13A 2H9PA 4GQ1A 1QNIA 4GM8A 4GZ8A 4CZVA 1VYHC 4FA9D 5GSAA 4O2WA 2P9LC 4H5JA 3A0FA 3JRPA 5EARA 5E6SA 5C92A 2Q7QA 5H17A 3VI3A 2IUQA 4GQ2P 2OIZA 3DXKC 3ZE1A 3RLMD 2B4EA
chains in the Genus database with same CATH topology
5HQGA 4Y5RD 5THAA 4ZOZA 4JT5C 5EMMB 3RN1D 1YFQA 1FWXA 2YB8B 4O3TB 3EG6A 5IGQA 2IURA 2H14A 2UZXB 2PM9A 1PGUA 4PBZA 3SN6B 1XKSA 4A0BA 5K1CC 5FLXg 2HKMA 1OLZA 4QL1A 5C2VB 2MTAH 3SXTD 3C75H 5HYNB 3VA6A 4J87A 3SBRA 2QC5A 5CXCB 4GGDA 5EMLB 5IJ8E 5C9ZB 3EI1A 2AGXA 2OJYA 4OZUA 3NVNA 2UZYB 3HFQA 2IUVA 3EI2A 3PXTD 3JZHA 4U7AA 2PM6B 4PXWA 1L0QA 3CIKB 5FKTA 2Z2PA 4TZ4A 3MMYA 2IUPA 3W15A 4G56B 2PBIB 4ZOYA 2J55H 3BG0A 4CC9A 4BL0A 2O9KA 4LGNA 4J86A 3VGZA 3RRMC 2AH1A 4QT8A 3I8EA 3JROA 5IC7A 4R7AB 3EWEA 3IIYA 3KRXB 1GP2B 4E5ZA 3C99A 1Q47A 3SLED 5TEEA 2P9NC 1B9YA 3AL8B 3AL9A 3J80g 2H6KA 4D6VA 2H9MA 4GM9A 1MG3A 3UVLA 2PM7B 4E54B 5H14A 3IJ1A 2B5MA 3SCYA 1PBYB 3JPXA 2YNNA 4GMBA 4J73A 4J78A 3UVNA 5HE1B 3UKRC 3PXSD 2IWKA 4BUJC 4K3JB 5I5JA 4CI2A 5JWZA 4L3GD 1A0RB 4A0AB 3SBQA 4CY2A 2AGZA 4A11A 4FAND 2XL2A 1U4CA 4I79A 4L1QD 3U4YA 2HESX 5KDOB 1NR0A 3C9CA 5EAPA 2IAAA 3RSEC 4PC0A 1GG2B 2B5NA 4CI1A 4J8GA 4J79A 2P9KC 1JOFA 3PVWB 4X63B 4IMMA 2CE9A 2HXCA 3L4OD 3ORVD 5IGOA 2I3TA 5FKQA 5FKSA 3JZNA 3CFSB 3OL2B 1K32A 5IJ7E 4JSPC 3SVWD 2I3SA 3MKQA 3K26A 2GC7A 4ERYA 4A08B 3ZWLB 4O1QD 3EI3A 1SHYB 4BH6A 3PSLA 3FM0A 3IKOA 2CE8A 3MZLA 3RMZD 3J81g 4PSWB 4X60B 3OKTA 2GC4A 2TRCB 4J77A 5CYKB 4XYIA 3KRWB 5EMKB 4CY5A 2H9LA 3AL8A 4CI8A 1GXRA 1P22A 5B4WA 4J84A 3SJLD 5A2Qg 3IJ0A 3I7OA 2YNOA 3UVOA 4JXMA 3SBPA 4FHLA 4A2MA 2HJBA 1U2VC 1PEVA 4JSXC 1MG2A 1NEXB 3FRXA 4CZXA 3OTTA 4A0BB 2BCJB 2AH0A 1RI6A 4D0KA 5IT9g 2CN2A 4A0AA 4J8BA 3UKUC 5HE2B 3EI4B 3V5WB 1SQ9A 1K8KC 1N6EA 3AH8B 3SWSD 2XU7A 4H5IA 4O3UB 2OVRB 2IWFA 5HE0B 3NVXA 4Y7RA 3VH0A 5TF2A 3UR4A 2W18A 1MDAH 2YNPA 3EI1B 4ZOVA 2H68A 3SFZA 3NVQA 4PBYA 2OVPB 2HYEA 3V9FA 4K3ID 3I7LA 5AMSA 1N6DA 1ERJA 5FKRA 4YVDA 3V7DB 4OWRA 2XYIA 2XL3A 4J82A 3DWLC 1GOTB 5FA5B 1N6FA 3UVKA 5EM2B 2J57G 2I0TA 3MXXA 5AFU3 4FB1D 3BWSA 5AJAA 4PNKB 3I89A 3DXMC 1JJUB 3I2NA 4GGAA 2GNQA 2Z2NA 2G99A 2H6NA 1S4UX 4IA9A 3PSCB 4HDJA 5H1MA 3MZKA 3I7HA 3I7NA 5CXCA 2YMUA 4QRJA 4O45A 4L9OA 4FWWA 4E5ZB 3IJCA 3L4MD 1R5MA 2CO0A 2Z2OA 3GFCA 4J0XA 5CYKA 3EU7A 4GGCA 5TEFA 4FA4D 4A09B 2H6QA 4FA1D 5CXBB 1OMWB 4AEZA 3RFGA 3C5MA 5K19A 4CY3A 2B5LA 3OKYB 3F3PA 4EWRA 2AQ5A 4XEIC 3JB9L 2P9IC 3RFHA 5GMKn 2I0SA 2H47A 3IIWA 3I7KA 4CY1A 4ZOXA 4LG8A 4L3HD 2BBKH 1XIPA 4XYHA 4A11B 5FXYA 3F3FA 3EI4A 3CFVA 4ERQA 4Z8LA 3JAMg 5GXHA 3UVMA 4LG9A 3SMRA 2P9SC 5I5MA 4E54A 2QXVA 4FAVD 5GXIA 5C2WB 4J0WA 2AGLA 1JMXB 1PI6A 1SQJA 4ESGA 3OKWA 4J81A 1JMZB 3MKSB 1TYQC 3JZGA 4X61B 4JT6C 3N0DA 2I0RA 5HE3B 2CNXA 4GM3A 4O9DA 4JD2C 4ES0A 2OVQB 2PM9B 2H3XA 2YBAA 3GREA 2J56H 3ULEC 5EM2A 2CO0C 3P4FA 3N0EA 4KFMB 4PSXB 5EAMA 4A7JA 3EI3B 3PVUB 3E0CA 3I7PA 2P9PC 4N14A 3AFCA 3SHFA 1B9XA 3OW8A 3F3GA 4U1EI 4GQBB 5I5IA 4JSNC 2OK6A 4QQEA 4ZN4A 5SXMA 2EBSA 3PXWD 4A2LA 3RN0D 1TBGA 4CZYA 2CN3A 3EI2B 4ERZA 4CI3A 2AGYA 3PE7A 2OK4A 3DSMA 3DM0A 2H9NA 5FQDA 3OL2A 5EMJB 4A09A 4X3EA 3K27A 2HJ4A 5CXBA 5EALA 4FA5D 3BG1A 2G9AA 3ODTA 1XHMA 3OKYA 5TDHB 4UI9R 2P9UC 4A08A 3EMHA 3FGBA 3I8CA 2AGWA 2HKRA 4AOWA 3B7FA 4JSVC 4MK0B 4NSXA 2H13A 2H9PA 4GQ1A 1QNIA 4GM8A 4GZ8A 4CZVA 1VYHC 4FA9D 5GSAA 2P9LC 4H5JA 3A0FA 3JRPA 5EARA 2Q7QA 5H17A 2IUQA 4GQ2P 2OIZA 3DXKC 3RLMD 2B4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQG A;  4Y5R D;  5THA A;  4ZOZ A;  4JT5 C;  5EMM B;  3RN1 D;  1YFQ A;  1FWX A;  2YB8 B;  4O3T B;  3EG6 A;  5IGQ A;  2IUR A;  2H14 A;  2UZX B;  2PM9 A;  1PGU A;  4PBZ A;  3SN6 B;  1XKS A;  4A0B A;  5K1C C;  5FLX g;  2HKM A;  1OLZ A;  4QL1 A;  5C2V B;  2MTA H;  3SXT D;  3C75 H;  5HYN B;  3VA6 A;  4J87 A;  3SBR A;  2QC5 A;  5CXC B;  4GGD A;  5EML B;  5IJ8 E;  5C9Z B;  3EI1 A;  2AGX A;  2OJY A;  4OZU A;  3NVN A;  2UZY B;  3HFQ A;  2IUV A;  3EI2 A;  3PXT D;  3JZH A;  4U7A A;  2PM6 B;  4PXW A;  1L0Q A;  3CIK B;  5FKT A;  2Z2P A;  4TZ4 A;  3MMY A;  2IUP A;  3W15 A;  4G56 B;  2PBI B;  4ZOY A;  2J55 H;  3BG0 A;  4CC9 A;  4BL0 A;  2O9K A;  4LGN A;  4J86 A;  3VGZ A;  3RRM C;  2AH1 A;  4QT8 A;  3I8E A;  3JRO A;  5IC7 A;  4R7A B;  3EWE A;  3IIY A;  3KRX B;  1GP2 B;  4E5Z A;  3C99 A;  1Q47 A;  3SLE D;  5TEE A;  2P9N C;  1B9Y A;  3AL8 B;  3AL9 A;  3J80 g;  2H6K A;  4D6V A;  2H9M A;  4GM9 A;  1MG3 A;  3UVL A;  2PM7 B;  4E54 B;  5H14 A;  3IJ1 A;  2B5M A;  3SCY A;  1PBY B;  3JPX A;  2YNN A;  4GMB A;  4J73 A;  4J78 A;  3UVN A;  5HE1 B;  3UKR C;  3PXS D;  2IWK A;  4BUJ C;  4K3J B;  5I5J A;  4CI2 A;  5JWZ A;  4L3G D;  1A0R B;  4A0A B;  3SBQ A;  4CY2 A;  2AGZ A;  4A11 A;  4FAN D;  2XL2 A;  1U4C A;  4I79 A;  4L1Q D;  3U4Y A;  2HES X;  5KDO B;  1NR0 A;  3C9C A;  5EAP A;  2IAA A;  3RSE C;  4PC0 A;  1GG2 B;  2B5N A;  4CI1 A;  4J8G A;  4J79 A;  2P9K C;  1JOF A;  3PVW B;  4X63 B;  4IMM A;  2CE9 A;  2HXC A;  3L4O D;  3ORV D;  5IGO A;  2I3T A;  5FKQ A;  5FKS A;  3JZN A;  3CFS B;  3OL2 B;  1K32 A;  5IJ7 E;  4JSP C;  3SVW D;  2I3S A;  3MKQ A;  3K26 A;  2GC7 A;  4ERY A;  4A08 B;  3ZWL B;  4O1Q D;  3EI3 A;  1SHY B;  4BH6 A;  3PSL A;  3FM0 A;  3IKO A;  2CE8 A;  3MZL A;  3RMZ D;  3J81 g;  4PSW B;  4X60 B;  3OKT A;  2GC4 A;  2TRC B;  4J77 A;  5CYK B;  4XYI A;  3KRW B;  5EMK B;  4CY5 A;  2H9L A;  3AL8 A;  4CI8 A;  1GXR A;  1P22 A;  5B4W A;  4J84 A;  3SJL D;  5A2Q g;  3IJ0 A;  3I7O A;  2YNO A;  3UVO A;  4JXM A;  3SBP A;  4FHL A;  4A2M A;  2HJB A;  1U2V C;  1PEV A;  4JSX C;  1MG2 A;  1NEX B;  3FRX A;  4CZX A;  3OTT A;  4A0B B;  2BCJ B;  2AH0 A;  1RI6 A;  4D0K A;  5IT9 g;  2CN2 A;  4A0A A;  4J8B A;  3UKU C;  5HE2 B;  3EI4 B;  3V5W B;  1SQ9 A;  1K8K C;  1N6E A;  3AH8 B;  3SWS D;  2XU7 A;  4H5I A;  4O3U B;  2OVR B;  2IWF A;  5HE0 B;  3NVX A;  4Y7R A;  3VH0 A;  5TF2 A;  3UR4 A;  2W18 A;  1MDA H;  2YNP A;  3EI1 B;  4ZOV A;  2H68 A;  3SFZ A;  3NVQ A;  4PBY A;  2OVP B;  2HYE A;  3V9F A;  4K3I D;  3I7L A;  5AMS A;  1N6D A;  1ERJ A;  5FKR A;  4YVD A;  3V7D B;  4OWR A;  2XYI A;  2XL3 A;  4J82 A;  3DWL C;  1GOT B;  5FA5 B;  1N6F A;  3UVK A;  5EM2 B;  2J57 G;  2I0T A;  3MXX A;  5AFU 3;  4FB1 D;  3BWS A;  5AJA A;  4PNK B;  3I89 A;  3DXM C;  1JJU B;  3I2N A;  4GGA A;  2GNQ A;  2Z2N A;  2G99 A;  2H6N A;  1S4U X;  4IA9 A;  3PSC B;  4HDJ A;  5H1M A;  3MZK A;  3I7H A;  3I7N A;  5CXC A;  2YMU A;  4QRJ A;  4O45 A;  4L9O A;  4FWW A;  4E5Z B;  3IJC A;  3L4M D;  1R5M A;  2CO0 A;  2Z2O A;  3GFC A;  4J0X A;  5CYK A;  3EU7 A;  4GGC A;  5TEF A;  4FA4 D;  4A09 B;  2H6Q A;  4FA1 D;  5CXB B;  1OMW B;  4AEZ A;  3RFG A;  3C5M A;  5K19 A;  4CY3 A;  2B5L A;  3OKY B;  3F3P A;  4EWR A;  2AQ5 A;  4XEI C;  3JB9 L;  2P9I C;  3RFH A;  5GMK n;  2I0S A;  2H47 A;  3IIW A;  3I7K A;  4CY1 A;  4ZOX A;  4LG8 A;  4L3H D;  2BBK H;  1XIP A;  4XYH A;  4A11 B;  5FXY A;  3F3F A;  3EI4 A;  3CFV A;  4ERQ A;  4Z8L A;  3JAM g;  5GXH A;  3UVM A;  4LG9 A;  3SMR A;  2P9S C;  5I5M A;  4E54 A;  2QXV A;  4FAV D;  5GXI A;  5C2W B;  4J0W A;  2AGL A;  1JMX B;  1PI6 A;  1SQJ A;  4ESG A;  3OKW A;  4J81 A;  1JMZ B;  3MKS B;  1TYQ C;  3JZG A;  4X61 B;  4JT6 C;  3N0D A;  2I0R A;  5HE3 B;  2CNX A;  4GM3 A;  4O9D A;  4JD2 C;  4ES0 A;  2OVQ B;  2PM9 B;  2H3X A;  2YBA A;  3GRE A;  2J56 H;  3ULE C;  5EM2 A;  2CO0 C;  3P4F A;  3N0E A;  4KFM B;  4PSX B;  5EAM A;  4A7J A;  3EI3 B;  3PVU B;  3E0C A;  3I7P A;  2P9P C;  4N14 A;  3AFC A;  3SHF A;  1B9X A;  3OW8 A;  3F3G A;  4U1E I;  4GQB B;  5I5I A;  4JSN C;  2OK6 A;  4QQE A;  4ZN4 A;  5SXM A;  2EBS A;  3PXW D;  4A2L A;  3RN0 D;  1TBG A;  4CZY A;  2CN3 A;  3EI2 B;  4ERZ A;  4CI3 A;  2AGY A;  3PE7 A;  2OK4 A;  3DSM A;  3DM0 A;  2H9N A;  5FQD A;  3OL2 A;  5EMJ B;  4A09 A;  4X3E A;  3K27 A;  2HJ4 A;  5CXB A;  5EAL A;  4FA5 D;  3BG1 A;  2G9A A;  3ODT A;  1XHM A;  3OKY A;  5TDH B;  4UI9 R;  2P9U C;  4A08 A;  3EMH A;  3FGB A;  3I8C A;  2AGW A;  2HKR A;  4AOW A;  3B7F A;  4JSV C;  4MK0 B;  4NSX A;  2H13 A;  2H9P A;  4GQ1 A;  1QNI A;  4GM8 A;  4GZ8 A;  4CZV A;  1VYH C;  4FA9 D;  5GSA A;  2P9L C;  4H5J A;  3A0F A;  3JRP A;  5EAR A;  2Q7Q A;  5H17 A;  2IUQ A;  4GQ2 P;  2OIZ A;  3DXK C;  3RLM D;  2B4E A; 
#chains in the Genus database with same CATH topology
 5HQG A;  4Y5R D;  5THA A;  4ZOZ A;  4JT5 C;  5EMM B;  3RN1 D;  3T3P A;  1YFQ A;  1FWX A;  2YB8 B;  4O3T B;  5FFO A;  3EG6 A;  5IGQ A;  2IUR A;  2H14 A;  2UZX B;  2PM9 A;  1PGU A;  4PBZ A;  3SN6 B;  1XKS A;  4A0B A;  1GOG A;  5K1C C;  5FLX g;  2HKM A;  1OLZ A;  4QL1 A;  5C2V B;  1YR2 A;  2MTA H;  3SXT D;  1QFS A;  3C75 H;  4NEN A;  5HYN B;  3EQ7 A;  3VA6 A;  1JV2 A;  4J87 A;  3SBR A;  1TYE A;  2QC5 A;  1M1X A;  2XZG A;  4GGD A;  5CXC B;  3ZE2 A;  5EML B;  5IJ8 E;  3K6S A;  5C9Z B;  3EI1 A;  2AGX A;  2OJY A;  4OZU A;  3NVN A;  2UZY B;  3HFQ A;  2EIB A;  2IUV A;  2JKX A;  3EI2 A;  4BP9 A;  3PXT D;  3JZH A;  4U7A A;  2PM6 B;  2VDM A;  4Z7O A;  4PXW A;  2EIE A;  1L0Q A;  3CIK B;  4NAA A;  5FKT A;  3IUN A;  2Z2P A;  4TZ4 A;  3MMY A;  2IUP A;  3W15 A;  4G56 B;  2PBI B;  4ZOY A;  2J55 H;  3BG0 A;  4CC9 A;  3K71 A;  4BL0 A;  2O9K A;  4LGN A;  4NC4 A;  4J86 A;  3VGZ A;  3RRM C;  2AH1 A;  4QT8 A;  3I8E A;  3JRO A;  5IC7 A;  4R7A B;  3QHY B;  3EWE A;  3IIY A;  3KRX B;  1GP2 B;  3EQ8 A;  4E5Z A;  3C99 A;  1Q47 A;  3SLE D;  5TEE A;  2BKL A;  2P9N C;  3NIG A;  2VDO A;  3DDU A;  1B9Y A;  3AL8 B;  3AL9 A;  3J80 g;  2H6K A;  4D6V A;  2H9M A;  2VDL A;  4GM9 A;  4Z7N A;  1MG3 A;  3UVL A;  2PM7 B;  4E54 B;  5H14 A;  3IJ1 A;  4RE5 A;  1VZ2 A;  2B5M A;  3SCY A;  3ZE0 A;  1PBY B;  3JPX A;  4WK4 A;  2YNN A;  4GMB A;  4J73 A;  5M5R A;  4J78 A;  3UVN A;  5M5T A;  5HE1 B;  4AMY A;  3UKR C;  3MUO A;  3PXS D;  2IWK A;  4BUJ C;  4JHN A;  4K3J B;  5I5J A;  4CI2 A;  4DNW A;  5JWZ A;  4L3G D;  1A0R B;  3IUR A;  4A0A B;  3SBQ A;  1QFM A;  4CY2 A;  2AGZ A;  4A11 A;  4FAN D;  2XL2 A;  1U4C A;  4I79 A;  4L1Q D;  3U4Y A;  2HES X;  5KDO B;  2VZ1 A;  1NR0 A;  3C9C A;  5EAP A;  2IAA A;  3RSE C;  1VE6 A;  4G1E A;  4PC0 A;  3NID A;  5HDB A;  1GG2 B;  2B5N A;  4CI1 A;  4J8G A;  4J79 A;  2P9K C;  1JOF A;  3PVW B;  4X63 B;  3IVM A;  4IMM A;  4AN0 A;  2CE9 A;  2HXC A;  3L4O D;  3ORV D;  5IGO A;  2I3T A;  1K3I A;  5FKQ A;  5FKS A;  3JZN A;  1JTD B;  3CFS B;  1K32 A;  3OL2 B;  5IJ7 E;  4JSP C;  4BCD A;  3SVW D;  5M61 A;  2I3S A;  4QAM A;  3OF7 A;  3MKQ A;  2VDN A;  3K26 A;  2GC7 A;  2VDK A;  4ERY A;  4A08 B;  3ZWL B;  4O1Q D;  3EI3 A;  1SHY B;  4BH6 A;  3PSL A;  2EIC A;  3FM0 A;  4BCC A;  3IKO A;  3IJE A;  2CE8 A;  3MZL A;  2QR5 A;  3RMZ D;  3J81 g;  4PSW B;  4X60 B;  3OKT A;  4MMY A;  4WJK A;  2GC4 A;  2TRC B;  3V4P A;  4J77 A;  2WQ8 A;  5CYK B;  4XYI A;  3FCS A;  3KRW B;  5EMK B;  4CY5 A;  4D9S A;  1VE7 A;  2H9L A;  3AL8 A;  3IUL A;  3NIF A;  4G55 A;  3T3M A;  1GOF A;  4CI8 A;  1GXR A;  1P22 A;  5B4W A;  1O6F A;  4J84 A;  3SJL D;  5A2Q g;  3IJ0 A;  3I7O A;  2YNO A;  3UVO A;  1E8N A;  4JXM A;  1UOP A;  3SBP A;  3KCI A;  4FHL A;  4A2M A;  2HJB A;  1U2V C;  2HU8 A;  3GD1 I;  1PEV A;  4JSX C;  1MG2 A;  1NEX B;  3FRX A;  1I2M B;  4BP8 A;  4RE6 A;  4CZX A;  3OTT A;  4DNV A;  4A0B B;  2BCJ B;  2AH0 A;  1RI6 A;  4D0K A;  5IT9 g;  2CN2 A;  4A0A A;  4J8B A;  3UKU C;  5HE2 B;  1H2Z A;  3EI4 B;  3V5W B;  1SQ9 A;  1K8K C;  1N6E A;  3AH8 B;  3SWS D;  2XU7 A;  4H5I A;  4O3U B;  2OVR B;  2IWF A;  5HE0 B;  3NVX A;  4Y7R A;  3VH0 A;  5TF2 A;  1BPO A;  3UR4 A;  1C9L A;  2W18 A;  1MDA H;  2YNP A;  2XE4 A;  5M5U A;  3EI1 B;  4ZOV A;  4O02 A;  2H68 A;  3SFZ A;  3NVQ A;  4PBY A;  2OVP B;  2HYE A;  3V9F A;  4K3I D;  1U8C A;  3I7L A;  5AMS A;  1N6D A;  1ERJ A;  5FKR A;  4YVD A;  3V7D B;  4OWR A;  2XYI A;  2XL3 A;  4J82 A;  3DWL C;  1GOT B;  5FA5 B;  1N6F A;  3UVK A;  5EM2 B;  2J57 G;  2I0T A;  3MXX A;  4WK2 A;  1L5G A;  3EQ9 A;  1UOO A;  5AFU 3;  4FB1 D;  3BWS A;  3O4H A;  5AJA A;  4PNK B;  3I89 A;  3DXM C;  1JJU B;  1UTC A;  3I2N A;  4GGA A;  2GNQ A;  2Z2N A;  5M5V A;  2G99 A;  2H6N A;  1H2Y A;  1S4U X;  4IA9 A;  3PSC B;  4HDJ A;  5H1M A;  3MZK A;  3I7H A;  3I7N A;  5CXC A;  2YMU A;  4QRJ A;  1VZ3 A;  4O45 A;  4L9O A;  4FWW A;  4E5Z B;  3IJC A;  2VZ3 A;  3L4M D;  3MUN A;  1R5M A;  2CO0 A;  2Z2O A;  3GFC A;  4J0X A;  5CYK A;  3EU7 A;  3V4V A;  3QI0 A;  3ZDY A;  4GGC A;  5TEF A;  4FA4 D;  1T2X A;  4A09 B;  4AMZ A;  2H6Q A;  4FA1 D;  5CXB B;  1OMW B;  4AEZ A;  3RFG A;  3C5M A;  5K19 A;  4CY3 A;  2B5L A;  3O4I A;  3OKY B;  3F3P A;  4EWR A;  2AQ5 A;  4XEI C;  3JB9 L;  2P9I C;  3RFH A;  5GMK n;  3ZDX A;  4MMX A;  2I0S A;  2H47 A;  3IUM A;  3IIW A;  3I7K A;  5FFG A;  4CY1 A;  4UM9 A;  4ZOX A;  4LG8 A;  4AX4 A;  4L3H D;  2BBK H;  1XIP A;  2VC2 A;  4XYH A;  3IUJ A;  4A11 B;  1O6G A;  3F3F A;  5FXY A;  5C86 A;  1E5T A;  3EI4 A;  1C9I A;  3CFV A;  3FCU A;  4ERQ A;  4Z8L A;  3JAM g;  5GXH A;  3UVM A;  3O4G A;  3MVD K;  4LG9 A;  2QZP A;  3SMR A;  2P9S C;  4UM8 A;  5I5M A;  4E54 A;  2QXV A;  4FAV D;  5GXI A;  5C2W B;  4J0W A;  2AGL A;  1JMX B;  1PI6 A;  1SQJ A;  4ESG A;  3OKW A;  4J81 A;  5E6R A;  4G1M A;  1JMZ B;  3MKS B;  3GC3 B;  5E6U A;  1TYQ C;  3JZG A;  4X61 B;  4JT6 C;  3N0D A;  2I0R A;  2XDW A;  5HE3 B;  2CNX A;  4GM3 A;  4O9D A;  3VI4 A;  4JD2 C;  4ES0 A;  2HU5 A;  2OVQ B;  2PM9 B;  2H3X A;  2YBA A;  3GRE A;  2J56 H;  4IRZ A;  3ULE C;  5EM2 A;  2CO0 C;  3P4F A;  3N0E A;  4AN1 A;  4KFM B;  2VDR A;  3O4J A;  4PSX B;  2VDP A;  5EAM A;  4A7J A;  3EI3 B;  4JHP C;  3PVU B;  1UOQ A;  3E0C A;  3I7P A;  2P9P C;  4N14 A;  3AFC A;  2VDQ A;  1H2W A;  3SHF A;  1B9X A;  3OW8 A;  3F3G A;  4U1E I;  4GQB B;  5I5I A;  4JSN C;  2OK6 A;  4QQE A;  4ZN4 A;  5SXM A;  2EBS A;  3PXW D;  4A2L A;  3RN0 D;  1TBG A;  4CZY A;  2CN3 A;  1A12 A;  3EI2 B;  4ERZ A;  4CI3 A;  2AGY A;  3PE7 A;  2OK4 A;  3DSM A;  3DM0 A;  4BCB A;  2HU7 A;  4MMZ A;  2H9N A;  5FQD A;  3OL2 A;  5EMJ B;  4A09 A;  4X3E A;  3K27 A;  2HJ4 A;  5CXB A;  5EAL A;  1H2X A;  4FA5 D;  3BG1 A;  2G9A A;  3IUQ A;  3ODT A;  1GOH A;  1XHM A;  4Z7Q A;  3OKY A;  5TDH B;  3K72 A;  3ZDZ A;  4UI9 R;  2P9U C;  4WK0 A;  4A08 A;  3EMH A;  3FGB A;  3I8C A;  2AGW A;  2HKR A;  5M5S A;  4NBM A;  4AOW A;  3B7F A;  4JSV C;  1E8M A;  2EID A;  4L1M A;  4DNU A;  4MK0 B;  4NSX A;  2H13 A;  2H9P A;  4GQ1 A;  1QNI A;  4GM8 A;  4GZ8 A;  4CZV A;  1VYH C;  4FA9 D;  5GSA A;  4O2W A;  2P9L C;  4H5J A;  3A0F A;  3JRP A;  5EAR A;  5E6S A;  5C92 A;  2Q7Q A;  5H17 A;  3VI3 A;  2IUQ A;  4GQ2 P;  2OIZ A;  3DXK C;  3ZE1 A;  3RLM D;  2B4E A; 
#chains in the Genus database with same CATH homology
 5HQG A;  4Y5R D;  5THA A;  4ZOZ A;  4JT5 C;  5EMM B;  3RN1 D;  1YFQ A;  1FWX A;  2YB8 B;  4O3T B;  3EG6 A;  5IGQ A;  2IUR A;  2H14 A;  2UZX B;  2PM9 A;  1PGU A;  4PBZ A;  3SN6 B;  1XKS A;  4A0B A;  5K1C C;  5FLX g;  2HKM A;  1OLZ A;  4QL1 A;  5C2V B;  2MTA H;  3SXT D;  3C75 H;  5HYN B;  3VA6 A;  4J87 A;  3SBR A;  2QC5 A;  5CXC B;  4GGD A;  5EML B;  5IJ8 E;  5C9Z B;  3EI1 A;  2AGX A;  2OJY A;  4OZU A;  3NVN A;  2UZY B;  3HFQ A;  2IUV A;  3EI2 A;  3PXT D;  3JZH A;  4U7A A;  2PM6 B;  4PXW A;  1L0Q A;  3CIK B;  5FKT A;  2Z2P A;  4TZ4 A;  3MMY A;  2IUP A;  3W15 A;  4G56 B;  2PBI B;  4ZOY A;  2J55 H;  3BG0 A;  4CC9 A;  4BL0 A;  2O9K A;  4LGN A;  4J86 A;  3VGZ A;  3RRM C;  2AH1 A;  4QT8 A;  3I8E A;  3JRO A;  5IC7 A;  4R7A B;  3EWE A;  3IIY A;  3KRX B;  1GP2 B;  4E5Z A;  3C99 A;  1Q47 A;  3SLE D;  5TEE A;  2P9N C;  1B9Y A;  3AL8 B;  3AL9 A;  3J80 g;  2H6K A;  4D6V A;  2H9M A;  4GM9 A;  1MG3 A;  3UVL A;  2PM7 B;  4E54 B;  5H14 A;  3IJ1 A;  2B5M A;  3SCY A;  1PBY B;  3JPX A;  2YNN A;  4GMB A;  4J73 A;  4J78 A;  3UVN A;  5HE1 B;  3UKR C;  3PXS D;  2IWK A;  4BUJ C;  4K3J B;  5I5J A;  4CI2 A;  5JWZ A;  4L3G D;  1A0R B;  4A0A B;  3SBQ A;  4CY2 A;  2AGZ A;  4A11 A;  4FAN D;  2XL2 A;  1U4C A;  4I79 A;  4L1Q D;  3U4Y A;  2HES X;  5KDO B;  1NR0 A;  3C9C A;  5EAP A;  2IAA A;  3RSE C;  4PC0 A;  1GG2 B;  2B5N A;  4CI1 A;  4J8G A;  4J79 A;  2P9K C;  1JOF A;  3PVW B;  4X63 B;  4IMM A;  2CE9 A;  2HXC A;  3L4O D;  3ORV D;  5IGO A;  2I3T A;  5FKQ A;  5FKS A;  3JZN A;  3CFS B;  3OL2 B;  1K32 A;  5IJ7 E;  4JSP C;  3SVW D;  2I3S A;  3MKQ A;  3K26 A;  2GC7 A;  4ERY A;  4A08 B;  3ZWL B;  4O1Q D;  3EI3 A;  1SHY B;  4BH6 A;  3PSL A;  3FM0 A;  3IKO A;  2CE8 A;  3MZL A;  3RMZ D;  3J81 g;  4PSW B;  4X60 B;  3OKT A;  2GC4 A;  2TRC B;  4J77 A;  5CYK B;  4XYI A;  3KRW B;  5EMK B;  4CY5 A;  2H9L A;  3AL8 A;  4CI8 A;  1GXR A;  1P22 A;  5B4W A;  4J84 A;  3SJL D;  5A2Q g;  3IJ0 A;  3I7O A;  2YNO A;  3UVO A;  4JXM A;  3SBP A;  4FHL A;  4A2M A;  2HJB A;  1U2V C;  1PEV A;  4JSX C;  1MG2 A;  1NEX B;  3FRX A;  4CZX A;  3OTT A;  4A0B B;  2BCJ B;  2AH0 A;  1RI6 A;  4D0K A;  5IT9 g;  2CN2 A;  4A0A A;  4J8B A;  3UKU C;  5HE2 B;  3EI4 B;  3V5W B;  1SQ9 A;  1K8K C;  1N6E A;  3AH8 B;  3SWS D;  2XU7 A;  4H5I A;  4O3U B;  2OVR B;  2IWF A;  5HE0 B;  3NVX A;  4Y7R A;  3VH0 A;  5TF2 A;  3UR4 A;  2W18 A;  1MDA H;  2YNP A;  3EI1 B;  4ZOV A;  2H68 A;  3SFZ A;  3NVQ A;  4PBY A;  2OVP B;  2HYE A;  3V9F A;  4K3I D;  3I7L A;  5AMS A;  1N6D A;  1ERJ A;  5FKR A;  4YVD A;  3V7D B;  4OWR A;  2XYI A;  2XL3 A;  4J82 A;  3DWL C;  1GOT B;  5FA5 B;  1N6F A;  3UVK A;  5EM2 B;  2J57 G;  2I0T A;  3MXX A;  5AFU 3;  4FB1 D;  3BWS A;  5AJA A;  4PNK B;  3I89 A;  3DXM C;  1JJU B;  3I2N A;  4GGA A;  2GNQ A;  2Z2N A;  2G99 A;  2H6N A;  1S4U X;  4IA9 A;  3PSC B;  4HDJ A;  5H1M A;  3MZK A;  3I7H A;  3I7N A;  5CXC A;  2YMU A;  4QRJ A;  4O45 A;  4L9O A;  4FWW A;  4E5Z B;  3IJC A;  3L4M D;  1R5M A;  2CO0 A;  2Z2O A;  3GFC A;  4J0X A;  5CYK A;  3EU7 A;  4GGC A;  5TEF A;  4FA4 D;  4A09 B;  2H6Q A;  4FA1 D;  5CXB B;  1OMW B;  4AEZ A;  3RFG A;  3C5M A;  5K19 A;  4CY3 A;  2B5L A;  3OKY B;  3F3P A;  4EWR A;  2AQ5 A;  4XEI C;  3JB9 L;  2P9I C;  3RFH A;  5GMK n;  2I0S A;  2H47 A;  3IIW A;  3I7K A;  4CY1 A;  4ZOX A;  4LG8 A;  4L3H D;  2BBK H;  1XIP A;  4XYH A;  4A11 B;  5FXY A;  3F3F A;  3EI4 A;  3CFV A;  4ERQ A;  4Z8L A;  3JAM g;  5GXH A;  3UVM A;  4LG9 A;  3SMR A;  2P9S C;  5I5M A;  4E54 A;  2QXV A;  4FAV D;  5GXI A;  5C2W B;  4J0W A;  2AGL A;  1JMX B;  1PI6 A;  1SQJ A;  4ESG A;  3OKW A;  4J81 A;  1JMZ B;  3MKS B;  1TYQ C;  3JZG A;  4X61 B;  4JT6 C;  3N0D A;  2I0R A;  5HE3 B;  2CNX A;  4GM3 A;  4O9D A;  4JD2 C;  4ES0 A;  2OVQ B;  2PM9 B;  2H3X A;  2YBA A;  3GRE A;  2J56 H;  3ULE C;  5EM2 A;  2CO0 C;  3P4F A;  3N0E A;  4KFM B;  4PSX B;  5EAM A;  4A7J A;  3EI3 B;  3PVU B;  3E0C A;  3I7P A;  2P9P C;  4N14 A;  3AFC A;  3SHF A;  1B9X A;  3OW8 A;  3F3G A;  4U1E I;  4GQB B;  5I5I A;  4JSN C;  2OK6 A;  4QQE A;  4ZN4 A;  5SXM A;  2EBS A;  3PXW D;  4A2L A;  3RN0 D;  1TBG A;  4CZY A;  2CN3 A;  3EI2 B;  4ERZ A;  4CI3 A;  2AGY A;  3PE7 A;  2OK4 A;  3DSM A;  3DM0 A;  2H9N A;  5FQD A;  3OL2 A;  5EMJ B;  4A09 A;  4X3E A;  3K27 A;  2HJ4 A;  5CXB A;  5EAL A;  4FA5 D;  3BG1 A;  2G9A A;  3ODT A;  1XHM A;  3OKY A;  5TDH B;  4UI9 R;  2P9U C;  4A08 A;  3EMH A;  3FGB A;  3I8C A;  2AGW A;  2HKR A;  4AOW A;  3B7F A;  4JSV C;  4MK0 B;  4NSX A;  2H13 A;  2H9P A;  4GQ1 A;  1QNI A;  4GM8 A;  4GZ8 A;  4CZV A;  1VYH C;  4FA9 D;  5GSA A;  2P9L C;  4H5J A;  3A0F A;  3JRP A;  5EAR A;  2Q7Q A;  5H17 A;  2IUQ A;  4GQ2 P;  2OIZ A;  3DXK C;  3RLM D;  2B4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...