2I3TA

Bub3 complex with mad3 (bubr1) glebs motif
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
340
structure length
334
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Cell cycle arrest protein
total genus 81
structure length 334
sequence length 340
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3tA00
3PVUB 4O3UB 4JSNC 4XYHA 2XL2A 5THAA 3I7PA 3FRXA 3JB9L 4J84A 1L0QA 3FGBA 4FAND 5SXMA 3NVNA 2PM9B 3PE7A 4L3HD 3DWLC 4J8BA 3RLMD 3F3GA 3DM0A 4FA1D 4LG9A 3I7NA 5IJ7E 4GMBA 3AL8A 3C5MA 2XYIA 1SHYB 2GC4A 3SBRA 3EI1A 1GXRA 4ZN4A 1FWXA 2YMUA 4ZOXA 3C9CA 5HE3B 4QQEA 5C2WB 2AGZA 2AGWA 3ODTA 4D0KA 4X60B 4A09B 4BUJC 3EI4A 2Z2OA 3SN6B 5FXYA 2EBSA 2OVQB 5A2Qg 4FA9D 2I0SA 5H14A 2H9NA 3K27A 1GG2B 1PGUA 4J79A 3IIWA 1B9YA 4BH6A 3OKYA 2CE8A 2OK4A 4GQBB 5EAMA 4QT8A 5GXIA 3U4YA 5H17A 4LG8A 2J56H 4CY2A 3I7HA 4A0BB 5EMLB 3KRWB 3EI2B 4OWRA 4KFMB 2H6KA 3ZWLB 5FKRA 1A0RB 2AGXA 3ORVD 3BG1A 5HE1B 3RFGA 3HFQA 3OKWA 4FHLA 3VH0A 3J80g 5EM2B 2Q7QA 5KDOB 5FKSA 1XHMA 4Z8LA 4A0BA 4NSXA 3E0CA 3C75H 3SWSD 1PI6A 2YBAA 2XL3A 2I0RA 3FM0A 3N0EA 3UKRC 2XU7A 1JMXB 2CO0C 3I8EA 2PM6B 2YB8B 4O45A 4J0XA 2HKRA 1U4CA 1N6FA 2J55H 1N6DA 1SQJA 4J86A 2IWKA 1QNIA 2PBIB 5H1MA 4N14A 2IWFA 4X3EA 5GMKn 5TEFA 1GP2B 5AFU3 5C9ZB 3MZKA 2H3XA 4CI2A 4L1QD 3V5WB 4OZUA 4E54B 3EI4B 4CI3A 3JROA 2B5MA 4UI9R 5EALA 4CY5A 5AJAA 1YFQA 2OIZA 5EMKB 5AMSA 5FLXg 4GM3A 2HXCA 4E5ZB 3I2NA 4AOWA 2HYEA 3JZHA 4TZ4A 5EMJB 2PM7B 3F3PA 1S4UX 1MG3A 3EMHA 4FWWA 5HE2B 3V9FA 2OK6A 3KRXB 5FKTA 1SQ9A 3OKTA 3AH8B 4JSPC 4LGNA 4PBYA 4A0AA 3PSLA 1MG2A 2AH1A 3EI2A 4A7JA 2B4EA 3I7OA 4ZOZA 5HQGA 3RN1D 2MTAH 3CFVA 1U2VC 4A0AB 3RSEC 1Q47A 2OVRB 2B5NA 4E5ZA 3EWEA 1NEXB 2P9NC 2YNOA 3PSCB 3BG0A 2Z2PA 4GQ1A 2Z2NA 5CXCA 2H13A 2P9KC 3PXTD 3IJCA 3OL2A 4CI1A 2P9UC 2G99A 2TRCB 2BBKH 2GNQA 3A0FA 5TDHB 4JSXC 3V7DB 5CYKB 3SJLD 2HJBA 4J78A 4X63B 2H6NA 4Y5RD 3EI1B 4U1EI 2AGLA 3UVOA 1R5MA 2CN2A 2IUPA 3IJ1A 2AQ5A 2H47A 3PVWB 4ERQA 5FA5B 4CZYA 1TYQC 3I7LA 4A2MA 5C2VB 2YNPA 4XEIC 3SXTD 3N0DA 3GFCA 3MKSB 2IAAA 5FQDA 4A2LA 2P9LC 3UKUC 5B4WA 4JT5C 1PBYB 3CIKB 3MZLA 3JRPA 4JXMA 2HJ4A 4U7AA 4GQ2P 1NR0A 3SMRA 3B7FA 3SFZA 3SVWD 4AEZA 4ESGA 3J81g 5IGQA 3L4MD 4GGDA 4J73A 3JPXA 4A08A 5I5IA 1GOTB 4CI8A 5IJ8E 4PC0A 3RN0D 3IIYA 2O9KA 3I7KA 3EI3A 4J77A 3L4OD 1K8KC 2QC5A 3UVMA 4J0WA 3SLED 4CY1A 2H14A 1VYHC 3JZGA 2I3SA 2AH0A 2UZYB 4GM8A 2H9PA 2IUVA 2GC7A 4A08B 3I89A 4E54A 3BWSA 1JJUB 3SCYA 3MKQA 4PXWA 1P22A 1PEVA 5CXCB 3P4FA 3EU7A 2I3TA 3MXXA 2H6QA 2AGYA 2CE9A 4JD2C 4G56B 5IC7A 5I5MA 2HESX 5EM2A 3SBPA 3IJ0A 4J8GA 2IUQA 4HDJA 3UR4A 5I5JA 4ZOYA 3OW8A 5EAPA 2I0TA 3RRMC 1XKSA 3SHFA 1N6EA 4Y7RA 5EMMB 4H5IA 2P9PC 5GXHA 3OL2B 1JMZB 1OLZA 1OMWB 4IMMA 4CZVA 5FKQA 2QXVA 2IURA 4QL1A 4FB1D 5EARA 4A11A 3VGZA 1K32A 1TBGA 3DSMA 3PXSD 5JWZA 5HYNB 3F3FA 5TF2A 1ERJA 3C99A 2UZXB 5K1CC 3NVXA 2B5LA 4L9OA 5CYKA 4X61B 4K3JB 4PSWB 4MK0B 3AL8B 2G9AA 4GM9A 3AL9A 4A11B 2CO0A 4GGAA 5CXBA 4JT6C 3K26A 4FA4D 4JSVC 5TEEA 2BCJB 2HKMA 3OTTA 3MMYA 4K3ID 4GGCA 1RI6A 2H9MA 4R7AB 4ERYA 4QRJA 5IGOA 3OKYB 2YNNA 4YVDA 3PXWD 3CFSB 3IKOA 3ULEC 2P9IC 4O9DA 4CZXA 3EI3B 4FA5D 5HE0B 4L3GD 3VA6A 3JZNA 3RFHA 4XYIA 3GREA 3NVQA 4CY3A 4A09A 4H5JA 4D6VA 3SBQA 4J87A 2OJYA 4PNKB 3W15A 5K19A 2P9SC 4ES0A 4ZOVA 4BL0A 3JAMg 2CN3A 4O1QD 3UVNA 4FAVD 4PSXB 3AFCA 2W18A 4ERZA 4PBZA 3DXMC 2OVPB 4GZ8A 1B9XA 1JOFA 3I8CA 2H9LA 3RMZD 2CNXA 4O3TB 4CC9A 5CXBB 1MDAH 4J82A 3UVLA 4EWRA 2J57G 3DXKC 1XIPA 5IT9g 4IA9A 5GSAA 3EG6A 2H68A 3UVKA 2PM9A 4I79A 4J81A
chains in the Genus database with same CATH superfamily
3PVUB 4O3UB 4JSNC 4XYHA 2XL2A 5THAA 3O4HA 2HU7A 3I7PA 3T3MA 3FRXA 3JB9L 3NIDA 4J84A 1L0QA 1C9LA 3FGBA 4NAAA 4FAND 5SXMA 2VZ3A 3NVNA 3V4VA 2PM9B 3PE7A 4L3HD 3DWLC 4J8BA 3RLMD 5FFOA 3F3GA 3DM0A 4FA1D 4LG9A 3I7NA 5IJ7E 4GMBA 3AL8A 3C5MA 2XYIA 1SHYB 2GC4A 2VDLA 4MMXA 3SBRA 5M5RA 3EI1A 1GXRA 4ZN4A 3OF7A 1FWXA 2YMUA 4ZOXA 3C9CA 5HE3B 4QQEA 5C2WB 2XE4A 2AGZA 2AGWA 3ODTA 4IRZA 4D0KA 4X60B 1T2XA 4A09B 4BUJC 4G1EA 3EI4A 2Z2OA 3SN6B 2BKLA 2EBSA 5FXYA 2OVQB 5A2Qg 5E6RA 4FA9D 2I0SA 5H14A 2H9NA 3DDUA 3K27A 1GG2B 5E6UA 1PGUA 4J79A 3IIWA 1B9YA 1JTDB 3OKYA 1O6FA 4BH6A 3K71A 2CE8A 2OK4A 4GQBB 5EAMA 3VI4A 4QT8A 5GXIA 3U4YA 2EICA 3IUNA 5H17A 4LG8A 2J56H 4CY2A 3I7HA 1BPOA 4A0BB 5EMLB 3KRWB 3EI2B 4OWRA 1L5GA 4KFMB 2H6KA 3ZWLB 4DNUA 5FKRA 1A0RB 4WK2A 2AGXA 3ORVD 3BG1A 5HE1B 3RFGA 3HFQA 3OKWA 4BP9A 4FHLA 3VH0A 3ZE2A 3J80g 5EM2B 2Q7QA 5KDOB 5FKSA 1XHMA 4Z8LA 4A0BA 2VDQA 4NSXA 1GOGA 3E0CA 3C75H 3SWSD 1PI6A 4BCBA 2YBAA 3EQ8A 2XL3A 3GD1I 2I0RA 3FM0A 3N0EA 3UKRC 2XU7A 1JMXB 2CO0C 3I8EA 3K6SA 2PM6B 2YB8B 4O45A 4J0XA 2HKRA 1U4CA 1N6FA 2J55H 1N6DA 1SQJA 4BP8A 4J86A 2IWKA 1QNIA 2PBIB 3FCSA 5H1MA 4N14A 2IWFA 4X3EA 5GMKn 5TEFA 4Z7NA 1GP2B 4NBMA 2HU8A 5AFU3 5C9ZB 3MZKA 2H3XA 4CI2A 4L1QD 2JKXA 3V5WB 3KCIA 4DNWA 4OZUA 4E54B 3EI4B 3IUJA 4CI3A 2VDMA 1VE6A 1I2MB 1U8CA 3JROA 2B5MA 4UI9R 5EALA 5E6SA 4CY5A 5AJAA 1YFQA 2OIZA 1VE7A 5EMKB 5AMSA 5FLXg 4GM3A 2HXCA 4E5ZB 3I2NA 4AOWA 2HYEA 3IVMA 1VZ2A 3JZHA 4TZ4A 2XDWA 5EMJB 2PM7B 3F3PA 1S4UX 1MG3A 2EIDA 2QR5A 3EMHA 4FWWA 5HE2B 2OK6A 3KRXB 3V9FA 5FKTA 3ZE0A 1SQ9A 1YR2A 3OKTA 4Z7QA 3AH8B 3EQ7A 4JSPC 4L1MA 3IURA 4LGNA 4PBYA 4A0AA 3PSLA 1MG2A 2AH1A 1TYEA 3EI2A 4A7JA 2B4EA 3I7OA 4ZOZA 5HQGA 3RN1D 2MTAH 3IJEA 3CFVA 1U2VC 4A0AB 5HDBA 2QZPA 1Q47A 3RSEC 3GC3B 2OVRB 2B5NA 4E5ZA 3EWEA 1NEXB 2P9NC 2YNOA 3FCUA 3PSCB 3QI0A 3BG0A 2VDPA 2Z2PA 4GQ1A 2Z2NA 5CXCA 2H13A 1O6GA 1JV2A 2P9KC 3PXTD 4RE5A 3IJCA 3OL2A 4CI1A 2P9UC 2G99A 2TRCB 4DNVA 2BBKH 2GNQA 3A0FA 5TDHB 4JSXC 3V7DB 5CYKB 3SJLD 2HJBA 3MUNA 4J78A 4X63B 2H6NA 4Y5RD 4G55A 1UOOA 3EI1B 4U1EI 5M5UA 2AGLA 1M1XA 3UVOA 4JHPC 1R5MA 2CN2A 2IUPA 3IJ1A 2AQ5A 2H47A 3PVWB 4ERQA 5FA5B 4CZYA 1H2YA 1TYQC 3I7LA 4A2MA 5C2VB 2YNPA 4XEIC 3SXTD 3N0DA 4WK4A 3GFCA 3MKSB 2IAAA 5FQDA 4A2LA 2P9LC 3UKUC 3O4JA 4JT5C 2VDRA 5B4WA 1PBYB 3CIKB 3MZLA 3JRPA 4JXMA 2HJ4A 4QAMA 4U7AA 4GQ2P 1NR0A 3SMRA 3B7FA 3SFZA 3MVDK 3SVWD 4AEZA 4ESGA 3J81g 1C9IA 5IGQA 3L4MD 4GGDA 4J73A 2EIEA 3JPXA 4A08A 5M5TA 5I5IA 1GOTB 4CI8A 5IJ8E 4PC0A 3EQ9A 5FFGA 3RN0D 3IIYA 4JHNA 1UOPA 2O9KA 4UM9A 3I7KA 3EI3A 4J77A 3L4OD 4WJKA 1K8KC 2QC5A 3UVMA 4J0WA 3SLED 2VDNA 4CY1A 2H14A 1VYHC 3V4PA 4AN1A 3JZGA 1E8NA 2I3SA 2AH0A 2UZYB 4GM8A 2H9PA 2IUVA 2GC7A 4A08B 3I89A 3ZDYA 3O4IA 4E54A 3BWSA 1JJUB 3SCYA 3MKQA 4PXWA 1P22A 3ZDZA 1PEVA 5CXCB 3P4FA 3EU7A 5M5SA 2I3TA 3MXXA 2H6QA 3NIGA 2AGYA 2CE9A 4RE6A 4JD2C 4G56B 5IC7A 1H2WA 5I5MA 2HESX 5EM2A 4G1MA 3SBPA 1GOFA 3IJ0A 4J8GA 2IUQA 4HDJA 3UR4A 5I5JA 4ZOYA 3OW8A 2VC2A 5EAPA 2I0TA 3RRMC 5M5VA 2VDOA 1XKSA 3SHFA 3NIFA 1N6EA 4Y7RA 5EMMB 4H5IA 2P9PC 5GXHA 3OL2B 4AX4A 1JMZB 1OLZA 1H2ZA 1OMWB 4IMMA 4CZVA 5FKQA 1H2XA 2QXVA 2IURA 4QL1A 4FB1D 5EARA 4A11A 3VGZA 3IULA 1K32A 2HU5A 1TBGA 2VZ1A 3DSMA 1A12A 3PXSD 5JWZA 5HYNB 3K72A 3F3FA 5TF2A 1ERJA 3C99A 3MUOA 2UZXB 5K1CC 1E5TA 3NVXA 2B5LA 4BCCA 4L9OA 4X61B 5CYKA 4K3JB 4PSWB 4MK0B 3ZE1A 1GOHA 3AL8B 4MMZA 2G9AA 4GM9A 3AL9A 3VI3A 4A11B 2CO0A 5M61A 4GGAA 5CXBA 4JT6C 3K26A 4FA4D 5C92A 4JSVC 5TEEA 2BCJB 2HKMA 3OTTA 3MMYA 1QFMA 4K3ID 1K3IA 4GGCA 1RI6A 2H9MA 4R7AB 4ERYA 4QRJA 5IGOA 3OKYB 4O2WA 2YNNA 4YVDA 1VZ3A 3PXWD 4NC4A 3CFSB 4UM8A 1E8MA 4MMYA 3IKOA 1UTCA 2P9IC 3ULEC 4O9DA 4CZXA 3EI3B 4FA5D 5HE0B 4WK0A 4L3GD 3VA6A 3JZNA 3RFHA 4XYIA 4AN0A 3GREA 3NVQA 4CY3A 4A09A 4H5JA 4D6VA 3SBQA 4J87A 2OJYA 4D9SA 4NENA 4PNKB 3W15A 1UOQA 4O02A 4AMZA 5K19A 2P9SC 4ES0A 4ZOVA 3ZDXA 2XZGA 4BL0A 3JAMg 2CN3A 4O1QD 3UVNA 4FAVD 4Z7OA 4PSXB 2EIBA 3AFCA 2W18A 4AMYA 4ERZA 4PBZA 3DXMC 2OVPB 4GZ8A 1B9XA 1JOFA 3I8CA 2WQ8A 2VDKA 2H9LA 3RMZD 2CNXA 4O3TB 3QHYB 4CC9A 5CXBB 1MDAH 4J82A 3UVLA 4EWRA 4BCDA 2J57G 3DXKC 3IUMA 1XIPA 5IT9g 4IA9A 5GSAA 3EG6A 3T3PA 3IUQA 2H68A 3UVKA 2PM9A 4I79A 5C86A 1QFSA 3O4GA 4J81A
chains in the Genus database with same CATH topology
3PVUB 4O3UB 4JSNC 4XYHA 2XL2A 5THAA 3I7PA 3FRXA 3JB9L 4J84A 1L0QA 3FGBA 4FAND 5SXMA 3NVNA 2PM9B 3PE7A 4L3HD 3DWLC 4J8BA 3RLMD 3F3GA 3DM0A 4FA1D 4LG9A 3I7NA 5IJ7E 4GMBA 3AL8A 3C5MA 2XYIA 1SHYB 2GC4A 3SBRA 3EI1A 1GXRA 4ZN4A 1FWXA 2YMUA 4ZOXA 3C9CA 5HE3B 4QQEA 5C2WB 2AGZA 2AGWA 3ODTA 4D0KA 4X60B 4A09B 4BUJC 3EI4A 2Z2OA 3SN6B 5FXYA 2EBSA 2OVQB 5A2Qg 4FA9D 2I0SA 5H14A 2H9NA 3K27A 1GG2B 1PGUA 4J79A 3IIWA 1B9YA 4BH6A 3OKYA 2CE8A 2OK4A 4GQBB 5EAMA 4QT8A 5GXIA 3U4YA 5H17A 4LG8A 2J56H 4CY2A 3I7HA 4A0BB 5EMLB 3KRWB 3EI2B 4OWRA 4KFMB 2H6KA 3ZWLB 5FKRA 1A0RB 2AGXA 3ORVD 3BG1A 5HE1B 3RFGA 3HFQA 3OKWA 4FHLA 3VH0A 3J80g 5EM2B 2Q7QA 5KDOB 5FKSA 1XHMA 4Z8LA 4A0BA 4NSXA 3E0CA 3C75H 3SWSD 1PI6A 2YBAA 2XL3A 2I0RA 3FM0A 3N0EA 3UKRC 2XU7A 1JMXB 2CO0C 3I8EA 2PM6B 2YB8B 4O45A 4J0XA 2HKRA 1U4CA 1N6FA 2J55H 1N6DA 1SQJA 4J86A 2IWKA 1QNIA 2PBIB 5H1MA 4N14A 2IWFA 4X3EA 5GMKn 5TEFA 1GP2B 5AFU3 5C9ZB 3MZKA 2H3XA 4CI2A 4L1QD 3V5WB 4OZUA 4E54B 3EI4B 4CI3A 3JROA 2B5MA 4UI9R 5EALA 4CY5A 5AJAA 1YFQA 2OIZA 5EMKB 5AMSA 5FLXg 4GM3A 2HXCA 4E5ZB 3I2NA 4AOWA 2HYEA 3JZHA 4TZ4A 5EMJB 2PM7B 3F3PA 1S4UX 1MG3A 3EMHA 4FWWA 5HE2B 3V9FA 2OK6A 3KRXB 5FKTA 1SQ9A 3OKTA 3AH8B 4JSPC 4LGNA 4PBYA 4A0AA 3PSLA 1MG2A 2AH1A 3EI2A 4A7JA 2B4EA 3I7OA 4ZOZA 5HQGA 3RN1D 2MTAH 3CFVA 1U2VC 4A0AB 3RSEC 1Q47A 2OVRB 2B5NA 4E5ZA 3EWEA 1NEXB 2P9NC 2YNOA 3PSCB 3BG0A 2Z2PA 4GQ1A 2Z2NA 5CXCA 2H13A 2P9KC 3PXTD 3IJCA 3OL2A 4CI1A 2P9UC 2G99A 2TRCB 2BBKH 2GNQA 3A0FA 5TDHB 4JSXC 3V7DB 5CYKB 3SJLD 2HJBA 4J78A 4X63B 2H6NA 4Y5RD 3EI1B 4U1EI 2AGLA 3UVOA 1R5MA 2CN2A 2IUPA 3IJ1A 2AQ5A 2H47A 3PVWB 4ERQA 5FA5B 4CZYA 1TYQC 3I7LA 4A2MA 5C2VB 2YNPA 4XEIC 3SXTD 3N0DA 3GFCA 3MKSB 2IAAA 5FQDA 4A2LA 2P9LC 3UKUC 5B4WA 4JT5C 1PBYB 3CIKB 3MZLA 3JRPA 4JXMA 2HJ4A 4U7AA 4GQ2P 1NR0A 3SMRA 3B7FA 3SFZA 3SVWD 4AEZA 4ESGA 3J81g 5IGQA 3L4MD 4GGDA 4J73A 3JPXA 4A08A 5I5IA 1GOTB 4CI8A 5IJ8E 4PC0A 3RN0D 3IIYA 2O9KA 3I7KA 3EI3A 4J77A 3L4OD 1K8KC 2QC5A 3UVMA 4J0WA 3SLED 4CY1A 2H14A 1VYHC 3JZGA 2I3SA 2AH0A 2UZYB 4GM8A 2H9PA 2IUVA 2GC7A 4A08B 3I89A 4E54A 3BWSA 1JJUB 3SCYA 3MKQA 4PXWA 1P22A 1PEVA 5CXCB 3P4FA 3EU7A 2I3TA 3MXXA 2H6QA 2AGYA 2CE9A 4JD2C 4G56B 5IC7A 5I5MA 2HESX 5EM2A 3SBPA 3IJ0A 4J8GA 2IUQA 4HDJA 3UR4A 5I5JA 4ZOYA 3OW8A 5EAPA 2I0TA 3RRMC 1XKSA 3SHFA 1N6EA 4Y7RA 5EMMB 4H5IA 2P9PC 5GXHA 3OL2B 1JMZB 1OLZA 1OMWB 4IMMA 4CZVA 5FKQA 2QXVA 2IURA 4QL1A 4FB1D 5EARA 4A11A 3VGZA 1K32A 1TBGA 3DSMA 3PXSD 5JWZA 5HYNB 3F3FA 5TF2A 1ERJA 3C99A 2UZXB 5K1CC 3NVXA 2B5LA 4L9OA 5CYKA 4X61B 4K3JB 4PSWB 4MK0B 3AL8B 2G9AA 4GM9A 3AL9A 4A11B 2CO0A 4GGAA 5CXBA 4JT6C 3K26A 4FA4D 4JSVC 5TEEA 2BCJB 2HKMA 3OTTA 3MMYA 4K3ID 4GGCA 1RI6A 2H9MA 4R7AB 4ERYA 4QRJA 5IGOA 3OKYB 2YNNA 4YVDA 3PXWD 3CFSB 3IKOA 3ULEC 2P9IC 4O9DA 4CZXA 3EI3B 4FA5D 5HE0B 4L3GD 3VA6A 3JZNA 3RFHA 4XYIA 3GREA 3NVQA 4CY3A 4A09A 4H5JA 4D6VA 3SBQA 4J87A 2OJYA 4PNKB 3W15A 5K19A 2P9SC 4ES0A 4ZOVA 4BL0A 3JAMg 2CN3A 4O1QD 3UVNA 4FAVD 4PSXB 3AFCA 2W18A 4ERZA 4PBZA 3DXMC 2OVPB 4GZ8A 1B9XA 1JOFA 3I8CA 2H9LA 3RMZD 2CNXA 4O3TB 4CC9A 5CXBB 1MDAH 4J82A 3UVLA 4EWRA 2J57G 3DXKC 1XIPA 5IT9g 4IA9A 5GSAA 3EG6A 2H68A 3UVKA 2PM9A 4I79A 4J81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVU B;  4O3U B;  4JSN C;  4XYH A;  2XL2 A;  5THA A;  3I7P A;  3FRX A;  3JB9 L;  4J84 A;  1L0Q A;  3FGB A;  4FAN D;  5SXM A;  3NVN A;  2PM9 B;  3PE7 A;  4L3H D;  3DWL C;  4J8B A;  3RLM D;  3F3G A;  3DM0 A;  4FA1 D;  4LG9 A;  3I7N A;  5IJ7 E;  4GMB A;  3AL8 A;  3C5M A;  2XYI A;  1SHY B;  2GC4 A;  3SBR A;  3EI1 A;  1GXR A;  4ZN4 A;  1FWX A;  2YMU A;  4ZOX A;  3C9C A;  5HE3 B;  4QQE A;  5C2W B;  2AGZ A;  2AGW A;  3ODT A;  4D0K A;  4X60 B;  4A09 B;  4BUJ C;  3EI4 A;  2Z2O A;  3SN6 B;  5FXY A;  2EBS A;  2OVQ B;  5A2Q g;  4FA9 D;  2I0S A;  5H14 A;  2H9N A;  3K27 A;  1GG2 B;  1PGU A;  4J79 A;  3IIW A;  1B9Y A;  4BH6 A;  3OKY A;  2CE8 A;  2OK4 A;  4GQB B;  5EAM A;  4QT8 A;  5GXI A;  3U4Y A;  5H17 A;  4LG8 A;  2J56 H;  4CY2 A;  3I7H A;  4A0B B;  5EML B;  3KRW B;  3EI2 B;  4OWR A;  4KFM B;  2H6K A;  3ZWL B;  5FKR A;  1A0R B;  2AGX A;  3ORV D;  3BG1 A;  5HE1 B;  3RFG A;  3HFQ A;  3OKW A;  4FHL A;  3VH0 A;  3J80 g;  5EM2 B;  2Q7Q A;  5KDO B;  5FKS A;  1XHM A;  4Z8L A;  4A0B A;  4NSX A;  3E0C A;  3C75 H;  3SWS D;  1PI6 A;  2YBA A;  2XL3 A;  2I0R A;  3FM0 A;  3N0E A;  3UKR C;  2XU7 A;  1JMX B;  2CO0 C;  3I8E A;  2PM6 B;  2YB8 B;  4O45 A;  4J0X A;  2HKR A;  1U4C A;  1N6F A;  2J55 H;  1N6D A;  1SQJ A;  4J86 A;  2IWK A;  1QNI A;  2PBI B;  5H1M A;  4N14 A;  2IWF A;  4X3E A;  5GMK n;  5TEF A;  1GP2 B;  5AFU 3;  5C9Z B;  3MZK A;  2H3X A;  4CI2 A;  4L1Q D;  3V5W B;  4OZU A;  4E54 B;  3EI4 B;  4CI3 A;  3JRO A;  2B5M A;  4UI9 R;  5EAL A;  4CY5 A;  5AJA A;  1YFQ A;  2OIZ A;  5EMK B;  5AMS A;  5FLX g;  4GM3 A;  2HXC A;  4E5Z B;  3I2N A;  4AOW A;  2HYE A;  3JZH A;  4TZ4 A;  5EMJ B;  2PM7 B;  3F3P A;  1S4U X;  1MG3 A;  3EMH A;  4FWW A;  5HE2 B;  3V9F A;  2OK6 A;  3KRX B;  5FKT A;  1SQ9 A;  3OKT A;  3AH8 B;  4JSP C;  4LGN A;  4PBY A;  4A0A A;  3PSL A;  1MG2 A;  2AH1 A;  3EI2 A;  4A7J A;  2B4E A;  3I7O A;  4ZOZ A;  5HQG A;  3RN1 D;  2MTA H;  3CFV A;  1U2V C;  4A0A B;  3RSE C;  1Q47 A;  2OVR B;  2B5N A;  4E5Z A;  3EWE A;  1NEX B;  2P9N C;  2YNO A;  3PSC B;  3BG0 A;  2Z2P A;  4GQ1 A;  2Z2N A;  5CXC A;  2H13 A;  2P9K C;  3PXT D;  3IJC A;  3OL2 A;  4CI1 A;  2P9U C;  2G99 A;  2TRC B;  2BBK H;  2GNQ A;  3A0F A;  5TDH B;  4JSX C;  3V7D B;  5CYK B;  3SJL D;  2HJB A;  4J78 A;  4X63 B;  2H6N A;  4Y5R D;  3EI1 B;  4U1E I;  2AGL A;  3UVO A;  1R5M A;  2CN2 A;  2IUP A;  3IJ1 A;  2AQ5 A;  2H47 A;  3PVW B;  4ERQ A;  5FA5 B;  4CZY A;  1TYQ C;  3I7L A;  4A2M A;  5C2V B;  2YNP A;  4XEI C;  3SXT D;  3N0D A;  3GFC A;  3MKS B;  2IAA A;  5FQD A;  4A2L A;  2P9L C;  3UKU C;  5B4W A;  4JT5 C;  1PBY B;  3CIK B;  3MZL A;  3JRP A;  4JXM A;  2HJ4 A;  4U7A A;  4GQ2 P;  1NR0 A;  3SMR A;  3B7F A;  3SFZ A;  3SVW D;  4AEZ A;  4ESG A;  3J81 g;  5IGQ A;  3L4M D;  4GGD A;  4J73 A;  3JPX A;  4A08 A;  5I5I A;  1GOT B;  4CI8 A;  5IJ8 E;  4PC0 A;  3RN0 D;  3IIY A;  2O9K A;  3I7K A;  3EI3 A;  4J77 A;  3L4O D;  1K8K C;  2QC5 A;  3UVM A;  4J0W A;  3SLE D;  4CY1 A;  2H14 A;  1VYH C;  3JZG A;  2I3S A;  2AH0 A;  2UZY B;  4GM8 A;  2H9P A;  2IUV A;  2GC7 A;  4A08 B;  3I89 A;  4E54 A;  3BWS A;  1JJU B;  3SCY A;  3MKQ A;  4PXW A;  1P22 A;  1PEV A;  5CXC B;  3P4F A;  3EU7 A;  2I3T A;  3MXX A;  2H6Q A;  2AGY A;  2CE9 A;  4JD2 C;  4G56 B;  5IC7 A;  5I5M A;  2HES X;  5EM2 A;  3SBP A;  3IJ0 A;  4J8G A;  2IUQ A;  4HDJ A;  3UR4 A;  5I5J A;  4ZOY A;  3OW8 A;  5EAP A;  2I0T A;  3RRM C;  1XKS A;  3SHF A;  1N6E A;  4Y7R A;  5EMM B;  4H5I A;  2P9P C;  5GXH A;  3OL2 B;  1JMZ B;  1OLZ A;  1OMW B;  4IMM A;  4CZV A;  5FKQ A;  2QXV A;  2IUR A;  4QL1 A;  4FB1 D;  5EAR A;  4A11 A;  3VGZ A;  1K32 A;  1TBG A;  3DSM A;  3PXS D;  5JWZ A;  5HYN B;  3F3F A;  5TF2 A;  1ERJ A;  3C99 A;  2UZX B;  5K1C C;  3NVX A;  2B5L A;  4L9O A;  5CYK A;  4X61 B;  4K3J B;  4PSW B;  4MK0 B;  3AL8 B;  2G9A A;  4GM9 A;  3AL9 A;  4A11 B;  2CO0 A;  4GGA A;  5CXB A;  4JT6 C;  3K26 A;  4FA4 D;  4JSV C;  5TEE A;  2BCJ B;  2HKM A;  3OTT A;  3MMY A;  4K3I D;  4GGC A;  1RI6 A;  2H9M A;  4R7A B;  4ERY A;  4QRJ A;  5IGO A;  3OKY B;  2YNN A;  4YVD A;  3PXW D;  3CFS B;  3IKO A;  3ULE C;  2P9I C;  4O9D A;  4CZX A;  3EI3 B;  4FA5 D;  5HE0 B;  4L3G D;  3VA6 A;  3JZN A;  3RFH A;  4XYI A;  3GRE A;  3NVQ A;  4CY3 A;  4A09 A;  4H5J A;  4D6V A;  3SBQ A;  4J87 A;  2OJY A;  4PNK B;  3W15 A;  5K19 A;  2P9S C;  4ES0 A;  4ZOV A;  4BL0 A;  3JAM g;  2CN3 A;  4O1Q D;  3UVN A;  4FAV D;  4PSX B;  3AFC A;  2W18 A;  4ERZ A;  4PBZ A;  3DXM C;  2OVP B;  4GZ8 A;  1B9X A;  1JOF A;  3I8C A;  2H9L A;  3RMZ D;  2CNX A;  4O3T B;  4CC9 A;  5CXB B;  1MDA H;  4J82 A;  3UVL A;  4EWR A;  2J57 G;  3DXK C;  1XIP A;  5IT9 g;  4IA9 A;  5GSA A;  3EG6 A;  2H68 A;  3UVK A;  2PM9 A;  4I79 A;  4J81 A; 
#chains in the Genus database with same CATH topology
 3PVU B;  4O3U B;  4JSN C;  4XYH A;  2XL2 A;  5THA A;  3O4H A;  2HU7 A;  3I7P A;  3T3M A;  3FRX A;  3JB9 L;  3NID A;  4J84 A;  1L0Q A;  1C9L A;  3FGB A;  4NAA A;  4FAN D;  5SXM A;  2VZ3 A;  3NVN A;  3V4V A;  2PM9 B;  3PE7 A;  4L3H D;  3DWL C;  4J8B A;  3RLM D;  5FFO A;  3F3G A;  3DM0 A;  4FA1 D;  4LG9 A;  3I7N A;  5IJ7 E;  4GMB A;  3AL8 A;  3C5M A;  2XYI A;  1SHY B;  2GC4 A;  2VDL A;  4MMX A;  3SBR A;  5M5R A;  3EI1 A;  1GXR A;  4ZN4 A;  3OF7 A;  1FWX A;  2YMU A;  4ZOX A;  3C9C A;  5HE3 B;  4QQE A;  5C2W B;  2XE4 A;  2AGZ A;  2AGW A;  3ODT A;  4IRZ A;  4D0K A;  4X60 B;  1T2X A;  4A09 B;  4BUJ C;  4G1E A;  3EI4 A;  2Z2O A;  3SN6 B;  2BKL A;  2EBS A;  5FXY A;  2OVQ B;  5A2Q g;  5E6R A;  4FA9 D;  2I0S A;  5H14 A;  2H9N A;  3DDU A;  3K27 A;  1GG2 B;  5E6U A;  1PGU A;  4J79 A;  3IIW A;  1B9Y A;  1JTD B;  3OKY A;  1O6F A;  4BH6 A;  3K71 A;  2CE8 A;  2OK4 A;  4GQB B;  5EAM A;  3VI4 A;  4QT8 A;  5GXI A;  3U4Y A;  2EIC A;  3IUN A;  5H17 A;  4LG8 A;  2J56 H;  4CY2 A;  3I7H A;  1BPO A;  4A0B B;  5EML B;  3KRW B;  3EI2 B;  4OWR A;  1L5G A;  4KFM B;  2H6K A;  3ZWL B;  4DNU A;  5FKR A;  1A0R B;  4WK2 A;  2AGX A;  3ORV D;  3BG1 A;  5HE1 B;  3RFG A;  3HFQ A;  3OKW A;  4BP9 A;  4FHL A;  3VH0 A;  3ZE2 A;  3J80 g;  5EM2 B;  2Q7Q A;  5KDO B;  5FKS A;  1XHM A;  4Z8L A;  4A0B A;  2VDQ A;  4NSX A;  1GOG A;  3E0C A;  3C75 H;  3SWS D;  1PI6 A;  4BCB A;  2YBA A;  3EQ8 A;  2XL3 A;  3GD1 I;  2I0R A;  3FM0 A;  3N0E A;  3UKR C;  2XU7 A;  1JMX B;  2CO0 C;  3I8E A;  3K6S A;  2PM6 B;  2YB8 B;  4O45 A;  4J0X A;  2HKR A;  1U4C A;  1N6F A;  2J55 H;  1N6D A;  1SQJ A;  4BP8 A;  4J86 A;  2IWK A;  1QNI A;  2PBI B;  3FCS A;  5H1M A;  4N14 A;  2IWF A;  4X3E A;  5GMK n;  5TEF A;  4Z7N A;  1GP2 B;  4NBM A;  2HU8 A;  5AFU 3;  5C9Z B;  3MZK A;  2H3X A;  4CI2 A;  4L1Q D;  2JKX A;  3V5W B;  3KCI A;  4DNW A;  4OZU A;  4E54 B;  3EI4 B;  3IUJ A;  4CI3 A;  2VDM A;  1VE6 A;  1I2M B;  1U8C A;  3JRO A;  2B5M A;  4UI9 R;  5EAL A;  5E6S A;  4CY5 A;  5AJA A;  1YFQ A;  2OIZ A;  1VE7 A;  5EMK B;  5AMS A;  5FLX g;  4GM3 A;  2HXC A;  4E5Z B;  3I2N A;  4AOW A;  2HYE A;  3IVM A;  1VZ2 A;  3JZH A;  4TZ4 A;  2XDW A;  5EMJ B;  2PM7 B;  3F3P A;  1S4U X;  1MG3 A;  2EID A;  2QR5 A;  3EMH A;  4FWW A;  5HE2 B;  2OK6 A;  3KRX B;  3V9F A;  5FKT A;  3ZE0 A;  1SQ9 A;  1YR2 A;  3OKT A;  4Z7Q A;  3AH8 B;  3EQ7 A;  4JSP C;  4L1M A;  3IUR A;  4LGN A;  4PBY A;  4A0A A;  3PSL A;  1MG2 A;  2AH1 A;  1TYE A;  3EI2 A;  4A7J A;  2B4E A;  3I7O A;  4ZOZ A;  5HQG A;  3RN1 D;  2MTA H;  3IJE A;  3CFV A;  1U2V C;  4A0A B;  5HDB A;  2QZP A;  1Q47 A;  3RSE C;  3GC3 B;  2OVR B;  2B5N A;  4E5Z A;  3EWE A;  1NEX B;  2P9N C;  2YNO A;  3FCU A;  3PSC B;  3QI0 A;  3BG0 A;  2VDP A;  2Z2P A;  4GQ1 A;  2Z2N A;  5CXC A;  2H13 A;  1O6G A;  1JV2 A;  2P9K C;  3PXT D;  4RE5 A;  3IJC A;  3OL2 A;  4CI1 A;  2P9U C;  2G99 A;  2TRC B;  4DNV A;  2BBK H;  2GNQ A;  3A0F A;  5TDH B;  4JSX C;  3V7D B;  5CYK B;  3SJL D;  2HJB A;  3MUN A;  4J78 A;  4X63 B;  2H6N A;  4Y5R D;  4G55 A;  1UOO A;  3EI1 B;  4U1E I;  5M5U A;  2AGL A;  1M1X A;  3UVO A;  4JHP C;  1R5M A;  2CN2 A;  2IUP A;  3IJ1 A;  2AQ5 A;  2H47 A;  3PVW B;  4ERQ A;  5FA5 B;  4CZY A;  1H2Y A;  1TYQ C;  3I7L A;  4A2M A;  5C2V B;  2YNP A;  4XEI C;  3SXT D;  3N0D A;  4WK4 A;  3GFC A;  3MKS B;  2IAA A;  5FQD A;  4A2L A;  2P9L C;  3UKU C;  3O4J A;  4JT5 C;  2VDR A;  5B4W A;  1PBY B;  3CIK B;  3MZL A;  3JRP A;  4JXM A;  2HJ4 A;  4QAM A;  4U7A A;  4GQ2 P;  1NR0 A;  3SMR A;  3B7F A;  3SFZ A;  3MVD K;  3SVW D;  4AEZ A;  4ESG A;  3J81 g;  1C9I A;  5IGQ A;  3L4M D;  4GGD A;  4J73 A;  2EIE A;  3JPX A;  4A08 A;  5M5T A;  5I5I A;  1GOT B;  4CI8 A;  5IJ8 E;  4PC0 A;  3EQ9 A;  5FFG A;  3RN0 D;  3IIY A;  4JHN A;  1UOP A;  2O9K A;  4UM9 A;  3I7K A;  3EI3 A;  4J77 A;  3L4O D;  4WJK A;  1K8K C;  2QC5 A;  3UVM A;  4J0W A;  3SLE D;  2VDN A;  4CY1 A;  2H14 A;  1VYH C;  3V4P A;  4AN1 A;  3JZG A;  1E8N A;  2I3S A;  2AH0 A;  2UZY B;  4GM8 A;  2H9P A;  2IUV A;  2GC7 A;  4A08 B;  3I89 A;  3ZDY A;  3O4I A;  4E54 A;  3BWS A;  1JJU B;  3SCY A;  3MKQ A;  4PXW A;  1P22 A;  3ZDZ A;  1PEV A;  5CXC B;  3P4F A;  3EU7 A;  5M5S A;  2I3T A;  3MXX A;  2H6Q A;  3NIG A;  2AGY A;  2CE9 A;  4RE6 A;  4JD2 C;  4G56 B;  5IC7 A;  1H2W A;  5I5M A;  2HES X;  5EM2 A;  4G1M A;  3SBP A;  1GOF A;  3IJ0 A;  4J8G A;  2IUQ A;  4HDJ A;  3UR4 A;  5I5J A;  4ZOY A;  3OW8 A;  2VC2 A;  5EAP A;  2I0T A;  3RRM C;  5M5V A;  2VDO A;  1XKS A;  3SHF A;  3NIF A;  1N6E A;  4Y7R A;  5EMM B;  4H5I A;  2P9P C;  5GXH A;  3OL2 B;  4AX4 A;  1JMZ B;  1OLZ A;  1H2Z A;  1OMW B;  4IMM A;  4CZV A;  5FKQ A;  1H2X A;  2QXV A;  2IUR A;  4QL1 A;  4FB1 D;  5EAR A;  4A11 A;  3VGZ A;  3IUL A;  1K32 A;  2HU5 A;  1TBG A;  2VZ1 A;  3DSM A;  1A12 A;  3PXS D;  5JWZ A;  5HYN B;  3K72 A;  3F3F A;  5TF2 A;  1ERJ A;  3C99 A;  3MUO A;  2UZX B;  5K1C C;  1E5T A;  3NVX A;  2B5L A;  4BCC A;  4L9O A;  4X61 B;  5CYK A;  4K3J B;  4PSW B;  4MK0 B;  3ZE1 A;  1GOH A;  3AL8 B;  4MMZ A;  2G9A A;  4GM9 A;  3AL9 A;  3VI3 A;  4A11 B;  2CO0 A;  5M61 A;  4GGA A;  5CXB A;  4JT6 C;  3K26 A;  4FA4 D;  5C92 A;  4JSV C;  5TEE A;  2BCJ B;  2HKM A;  3OTT A;  3MMY A;  1QFM A;  4K3I D;  1K3I A;  4GGC A;  1RI6 A;  2H9M A;  4R7A B;  4ERY A;  4QRJ A;  5IGO A;  3OKY B;  4O2W A;  2YNN A;  4YVD A;  1VZ3 A;  3PXW D;  4NC4 A;  3CFS B;  4UM8 A;  1E8M A;  4MMY A;  3IKO A;  1UTC A;  2P9I C;  3ULE C;  4O9D A;  4CZX A;  3EI3 B;  4FA5 D;  5HE0 B;  4WK0 A;  4L3G D;  3VA6 A;  3JZN A;  3RFH A;  4XYI A;  4AN0 A;  3GRE A;  3NVQ A;  4CY3 A;  4A09 A;  4H5J A;  4D6V A;  3SBQ A;  4J87 A;  2OJY A;  4D9S A;  4NEN A;  4PNK B;  3W15 A;  1UOQ A;  4O02 A;  4AMZ A;  5K19 A;  2P9S C;  4ES0 A;  4ZOV A;  3ZDX A;  2XZG A;  4BL0 A;  3JAM g;  2CN3 A;  4O1Q D;  3UVN A;  4FAV D;  4Z7O A;  4PSX B;  2EIB A;  3AFC A;  2W18 A;  4AMY A;  4ERZ A;  4PBZ A;  3DXM C;  2OVP B;  4GZ8 A;  1B9X A;  1JOF A;  3I8C A;  2WQ8 A;  2VDK A;  2H9L A;  3RMZ D;  2CNX A;  4O3T B;  3QHY B;  4CC9 A;  5CXB B;  1MDA H;  4J82 A;  3UVL A;  4EWR A;  4BCD A;  2J57 G;  3DXK C;  3IUM A;  1XIP A;  5IT9 g;  4IA9 A;  5GSA A;  3EG6 A;  3T3P A;  3IUQ A;  2H68 A;  3UVK A;  2PM9 A;  4I79 A;  5C86 A;  1QFS A;  3O4G A;  4J81 A; 
#chains in the Genus database with same CATH homology
 3PVU B;  4O3U B;  4JSN C;  4XYH A;  2XL2 A;  5THA A;  3I7P A;  3FRX A;  3JB9 L;  4J84 A;  1L0Q A;  3FGB A;  4FAN D;  5SXM A;  3NVN A;  2PM9 B;  3PE7 A;  4L3H D;  3DWL C;  4J8B A;  3RLM D;  3F3G A;  3DM0 A;  4FA1 D;  4LG9 A;  3I7N A;  5IJ7 E;  4GMB A;  3AL8 A;  3C5M A;  2XYI A;  1SHY B;  2GC4 A;  3SBR A;  3EI1 A;  1GXR A;  4ZN4 A;  1FWX A;  2YMU A;  4ZOX A;  3C9C A;  5HE3 B;  4QQE A;  5C2W B;  2AGZ A;  2AGW A;  3ODT A;  4D0K A;  4X60 B;  4A09 B;  4BUJ C;  3EI4 A;  2Z2O A;  3SN6 B;  5FXY A;  2EBS A;  2OVQ B;  5A2Q g;  4FA9 D;  2I0S A;  5H14 A;  2H9N A;  3K27 A;  1GG2 B;  1PGU A;  4J79 A;  3IIW A;  1B9Y A;  4BH6 A;  3OKY A;  2CE8 A;  2OK4 A;  4GQB B;  5EAM A;  4QT8 A;  5GXI A;  3U4Y A;  5H17 A;  4LG8 A;  2J56 H;  4CY2 A;  3I7H A;  4A0B B;  5EML B;  3KRW B;  3EI2 B;  4OWR A;  4KFM B;  2H6K A;  3ZWL B;  5FKR A;  1A0R B;  2AGX A;  3ORV D;  3BG1 A;  5HE1 B;  3RFG A;  3HFQ A;  3OKW A;  4FHL A;  3VH0 A;  3J80 g;  5EM2 B;  2Q7Q A;  5KDO B;  5FKS A;  1XHM A;  4Z8L A;  4A0B A;  4NSX A;  3E0C A;  3C75 H;  3SWS D;  1PI6 A;  2YBA A;  2XL3 A;  2I0R A;  3FM0 A;  3N0E A;  3UKR C;  2XU7 A;  1JMX B;  2CO0 C;  3I8E A;  2PM6 B;  2YB8 B;  4O45 A;  4J0X A;  2HKR A;  1U4C A;  1N6F A;  2J55 H;  1N6D A;  1SQJ A;  4J86 A;  2IWK A;  1QNI A;  2PBI B;  5H1M A;  4N14 A;  2IWF A;  4X3E A;  5GMK n;  5TEF A;  1GP2 B;  5AFU 3;  5C9Z B;  3MZK A;  2H3X A;  4CI2 A;  4L1Q D;  3V5W B;  4OZU A;  4E54 B;  3EI4 B;  4CI3 A;  3JRO A;  2B5M A;  4UI9 R;  5EAL A;  4CY5 A;  5AJA A;  1YFQ A;  2OIZ A;  5EMK B;  5AMS A;  5FLX g;  4GM3 A;  2HXC A;  4E5Z B;  3I2N A;  4AOW A;  2HYE A;  3JZH A;  4TZ4 A;  5EMJ B;  2PM7 B;  3F3P A;  1S4U X;  1MG3 A;  3EMH A;  4FWW A;  5HE2 B;  3V9F A;  2OK6 A;  3KRX B;  5FKT A;  1SQ9 A;  3OKT A;  3AH8 B;  4JSP C;  4LGN A;  4PBY A;  4A0A A;  3PSL A;  1MG2 A;  2AH1 A;  3EI2 A;  4A7J A;  2B4E A;  3I7O A;  4ZOZ A;  5HQG A;  3RN1 D;  2MTA H;  3CFV A;  1U2V C;  4A0A B;  3RSE C;  1Q47 A;  2OVR B;  2B5N A;  4E5Z A;  3EWE A;  1NEX B;  2P9N C;  2YNO A;  3PSC B;  3BG0 A;  2Z2P A;  4GQ1 A;  2Z2N A;  5CXC A;  2H13 A;  2P9K C;  3PXT D;  3IJC A;  3OL2 A;  4CI1 A;  2P9U C;  2G99 A;  2TRC B;  2BBK H;  2GNQ A;  3A0F A;  5TDH B;  4JSX C;  3V7D B;  5CYK B;  3SJL D;  2HJB A;  4J78 A;  4X63 B;  2H6N A;  4Y5R D;  3EI1 B;  4U1E I;  2AGL A;  3UVO A;  1R5M A;  2CN2 A;  2IUP A;  3IJ1 A;  2AQ5 A;  2H47 A;  3PVW B;  4ERQ A;  5FA5 B;  4CZY A;  1TYQ C;  3I7L A;  4A2M A;  5C2V B;  2YNP A;  4XEI C;  3SXT D;  3N0D A;  3GFC A;  3MKS B;  2IAA A;  5FQD A;  4A2L A;  2P9L C;  3UKU C;  5B4W A;  4JT5 C;  1PBY B;  3CIK B;  3MZL A;  3JRP A;  4JXM A;  2HJ4 A;  4U7A A;  4GQ2 P;  1NR0 A;  3SMR A;  3B7F A;  3SFZ A;  3SVW D;  4AEZ A;  4ESG A;  3J81 g;  5IGQ A;  3L4M D;  4GGD A;  4J73 A;  3JPX A;  4A08 A;  5I5I A;  1GOT B;  4CI8 A;  5IJ8 E;  4PC0 A;  3RN0 D;  3IIY A;  2O9K A;  3I7K A;  3EI3 A;  4J77 A;  3L4O D;  1K8K C;  2QC5 A;  3UVM A;  4J0W A;  3SLE D;  4CY1 A;  2H14 A;  1VYH C;  3JZG A;  2I3S A;  2AH0 A;  2UZY B;  4GM8 A;  2H9P A;  2IUV A;  2GC7 A;  4A08 B;  3I89 A;  4E54 A;  3BWS A;  1JJU B;  3SCY A;  3MKQ A;  4PXW A;  1P22 A;  1PEV A;  5CXC B;  3P4F A;  3EU7 A;  2I3T A;  3MXX A;  2H6Q A;  2AGY A;  2CE9 A;  4JD2 C;  4G56 B;  5IC7 A;  5I5M A;  2HES X;  5EM2 A;  3SBP A;  3IJ0 A;  4J8G A;  2IUQ A;  4HDJ A;  3UR4 A;  5I5J A;  4ZOY A;  3OW8 A;  5EAP A;  2I0T A;  3RRM C;  1XKS A;  3SHF A;  1N6E A;  4Y7R A;  5EMM B;  4H5I A;  2P9P C;  5GXH A;  3OL2 B;  1JMZ B;  1OLZ A;  1OMW B;  4IMM A;  4CZV A;  5FKQ A;  2QXV A;  2IUR A;  4QL1 A;  4FB1 D;  5EAR A;  4A11 A;  3VGZ A;  1K32 A;  1TBG A;  3DSM A;  3PXS D;  5JWZ A;  5HYN B;  3F3F A;  5TF2 A;  1ERJ A;  3C99 A;  2UZX B;  5K1C C;  3NVX A;  2B5L A;  4L9O A;  5CYK A;  4X61 B;  4K3J B;  4PSW B;  4MK0 B;  3AL8 B;  2G9A A;  4GM9 A;  3AL9 A;  4A11 B;  2CO0 A;  4GGA A;  5CXB A;  4JT6 C;  3K26 A;  4FA4 D;  4JSV C;  5TEE A;  2BCJ B;  2HKM A;  3OTT A;  3MMY A;  4K3I D;  4GGC A;  1RI6 A;  2H9M A;  4R7A B;  4ERY A;  4QRJ A;  5IGO A;  3OKY B;  2YNN A;  4YVD A;  3PXW D;  3CFS B;  3IKO A;  3ULE C;  2P9I C;  4O9D A;  4CZX A;  3EI3 B;  4FA5 D;  5HE0 B;  4L3G D;  3VA6 A;  3JZN A;  3RFH A;  4XYI A;  3GRE A;  3NVQ A;  4CY3 A;  4A09 A;  4H5J A;  4D6V A;  3SBQ A;  4J87 A;  2OJY A;  4PNK B;  3W15 A;  5K19 A;  2P9S C;  4ES0 A;  4ZOV A;  4BL0 A;  3JAM g;  2CN3 A;  4O1Q D;  3UVN A;  4FAV D;  4PSX B;  3AFC A;  2W18 A;  4ERZ A;  4PBZ A;  3DXM C;  2OVP B;  4GZ8 A;  1B9X A;  1JOF A;  3I8C A;  2H9L A;  3RMZ D;  2CNX A;  4O3T B;  4CC9 A;  5CXB B;  1MDA H;  4J82 A;  3UVL A;  4EWR A;  2J57 G;  3DXK C;  1XIP A;  5IT9 g;  4IA9 A;  5GSA A;  3EG6 A;  2H68 A;  3UVK A;  2PM9 A;  4I79 A;  4J81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...