2I3TA

Bub3 complex with mad3 (bubr1) glebs motif
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
340
structure length
334
Chain Sequence
b'MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell cycle arrest protein
publication title Structural analysis of Bub3 interactions in the mitotic spindle checkpoint.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 81
structure length 334
sequence length 340
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2006-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i3tA00
1XKSA 3N0EA 3I7NA 4I79A 2H9LA 4ERZA 3FGBA 4OZUA 2H47A 4JXMA 5FA5B 4FA9D 3DXMC 3EI4B 4AEZA 3OL2A 4O1QD 4J78A 3F3PA 4XYHA 3RSEC 3V9FA 1PBYB 2CE8A 4CC9A 2GC4A 5C2WB 3JAMg 3SHFA 4IA9A 4GM9A 1B9XA 4ESGA 3MXXA 3GREA 3AL8B 3IIWA 2OVPB 5KDOB 5FLXg 4PXWA 5GMKn 3RLMD 3IJ1A 3SVWD 3AFCA 5H14A 3SFZA 4PSWB 1MG2A 5EMJB 3PE7A 5HE1B 4CY5A 4L3HD 4JSVC 4CY1A 2HYEA 1NR0A 3MZLA 2I3SA 2H9NA 4ES0A 1XIPA 3EU7A 4A09A 3RMZD 2W18A 2XL2A 2IWFA 1Q47A 1TBGA 5HE0B 3UVNA 2PM9B 4E54B 2P9KC 3HFQA 4PSXB 1L0QA 5HE2B 1NEXB 5THAA 5B4WA 3SBQA 3A0FA 4NSXA 4CZYA 4CZXA 5HE3B 4A2LA 3EI4A 3C5MA 5EM2B 4GZ8A 2I0TA 1K32A 1S4UX 3EG6A 2OIZA 3FRXA 2P9NC 4N14A 4J86A 5H17A 4HDJA 2PM7B 2I0RA 4GM8A 2YMUA 3AL8A 2H9PA 2CE9A 3PXTD 5FKQA 4JD2C 2GNQA 2G99A 1VYHC 1JOFA 5K1CC 2AH0A 2P9PC 2UZYB 4JT6C 2Q7QA 2B5NA 1B9YA 1SQ9A 5EAMA 2OK4A 4J0XA 3JROA 3MMYA 3BWSA 3OTTA 3VA6A 2P9UC 3DWLC 4ZOZA 4GM3A 4O9DA 3J81g 2QXVA 2GC7A 5FXYA 3C9CA 3I8EA 5IJ8E 4E54A 3JB9L 2CO0C 3N0DA 4X3EA 5FQDA 2H13A 2CN2A 4CI8A 2XYIA 1GXRA 2H14A 5EM2A 4JSPC 4FA4D 3I7OA 1YFQA 2HKRA 4CI1A 5AJAA 2Z2PA 5EARA 3SBPA 4A11A 4J82A 2YNOA 4J81A 1PI6A 3EMHA 5EMKB 5K19A 2BBKH 4PBYA 3OW8A 2YBAA 4JSXC 2IUPA 4Z8LA 5EMMB 4GQ2P 4L1QD 5A2Qg 1JMZB 1OLZA 5EAPA 3ULEC 4QT8A 1PGUA 3W15A 4KFMB 4FA5D 2CO0A 1XHMA 4GGCA 4L9OA 4FA1D 5GSAA 1PEVA 5CXBA 4L3GD 3KRWB 4JSNC 2QC5A 5I5JA 3EI1A 5IGQA 3OKYA 3ODTA 1K8KC 3PVUB 1OMWB 3KRXB 4A0AB 2AGYA 3DSMA 3UVMA 4CI3A 2XU7A 1FWXA 2HKMA 3PSLA 1U2VC 1GG2B 2IAAA 5FKRA 3CIKB 2HXCA 3MZKA 4AOWA 3I89A 3SCYA 2O9KA 2PBIB 3RN0D 3I8CA 3JPXA 1GP2B 4ERQA 4GQ1A 4BH6A 5CYKA 4J87A 2G9AA 4J77A 5FKTA 3PXSD 4OWRA 2I0SA 3OKWA 3F3FA 3I2NA 4A11B 3BG0A 3BG1A 3UVLA 2YB8B 3V7DB 4CY3A 4PBZA 3V5WB 3AH8B 4Y7RA 3E0CA 3SJLD 3EWEA 3PVWB 4O3UB 3RFHA 4A2MA 2B4EA 3RFGA 1P22A 1A0RB 3C99A 4QRJA 4UI9R 5SXMA 4U7AA 4FAVD 3C75H 5JWZA 4BL0A 2P9SC 3K26A 3IJ0A 2H3XA 4GGAA 5CXCA 4CI2A 2B5LA 2P9IC 2YNPA 2MTAH 4IMMA 3P4FA 5CXBB 5AMSA 4A7JA 5GXIA 3VH0A 3UKUC 4A0AA 2BCJB 4K3JB 1ERJA 5TEFA 4TZ4A 3EI3B 2CN3A 3EI1B 3ZWLB 3SMRA 3OKYB 4J8GA 2EBSA 2P9LC 4PC0A 5EMLB 2H6QA 3J80g 1JJUB 3L4MD 2XL3A 4FHLA 5I5IA 2H6NA 3CFVA 4X60B 3UKRC 2AH1A 1U4CA 2HESX 4Y5RD 2AQ5A 3F3GA 4R7AB 4FAND 4GGDA 2OVQB 3SBRA 5CYKB 3SWSD 3IKOA 4H5JA 4ZOXA 4J84A 4X61B 5TF2A 4BUJC 5HQGA 2J57G 4A0BA 4J79A 4ERYA 5GXHA 5IJ7E 3I7LA 1QNIA 5AFU3 4JT5C 3U4YA 3L4OD 2J55H 3NVNA 5H1MA 5IGOA 3NVQA 3PXWD 2IURA 2CNXA 2HJ4A 1MG3A 1SQJA 2AGWA 3JZHA 5CXCB 1TYQC 3EI3A 3VGZA 2HJBA 3IIYA 4O45A 1N6DA 1JMXB 2IUVA 3JZNA 3EI2A 5FKSA 2TRCB 4XEIC 3UR4A 5C9ZB 3RRMC 4J8BA 4CY2A 4ZN4A 2OK6A 2Z2OA 4ZOVA 4A08A 2J56H 2OVRB 3I7PA 3PSCB 3I7HA 4E5ZA 2YNNA 3DM0A 1GOTB 3AL9A 3I7KA 3SN6B 3CFSB 4D6VA 4PNKB 2I3TA 3JRPA 4H5IA 4YVDA 4FWWA 1N6EA 2IWKA 2B5MA 5EALA 2PM6B 2AGLA 3SXTD 5I5MA 3UVKA 2H6KA 4X63B 4ZOYA 5HYNB 4QQEA 3K27A 1MDAH 4K3ID 1R5MA 4QL1A 4J0WA 4EWRA 4A0BB 3OL2B 3UVOA 2AGXA 4CZVA 3B7FA 2H9MA 2Z2NA 3JZGA 3RN1D 4GMBA 3ORVD 2H68A 4D0KA 5TDHB 2UZXB 1RI6A 4FB1D 3DXKC 2IUQA 4XYIA 5C2VB 4LGNA 5TEEA 3EI2B 3GFCA 4U1EI 4GQBB 4LG8A 3FM0A 2AGZA 4J73A 1SHYB 3MKQA 2PM9A 4A08B 3MKSB 4A09B 4MK0B 5IC7A 1N6FA 4E5ZB 3NVXA 5IT9g 4O3TB 3OKTA 4LG9A 3IJCA 2OJYA 3SLED 4G56B
chains in the Genus database with same CATH superfamily
1XKSA 1QFMA 3N0EA 4BP9A 3I7NA 4I79A 2H9LA 4ERZA 3FGBA 4OZUA 2H47A 4QAMA 3DDUA 4JXMA 5FA5B 4FA9D 2BKLA 3DXMC 3EI4B 4MMYA 4AEZA 5M5TA 3OL2A 2VDQA 4AMZA 4O1QD 2VDMA 3F3PA 4J78A 4XYHA 3RSEC 3V9FA 1PBYB 2CE8A 4CC9A 2GC4A 5C2WB 4WK0A 3JAMg 3SHFA 2VDKA 4IA9A 4GM9A 3O4GA 1B9XA 4ESGA 3MXXA 3GREA 3AL8B 3ZDYA 3IIWA 2OVPB 3NIFA 5KDOB 5FLXg 4PXWA 2XE4A 5C92A 5GMKn 3RLMD 4AX4A 3IJ1A 3SVWD 3AFCA 5M5UA 4JHNA 5H14A 3SFZA 4PSWB 1MG2A 5EMJB 3PE7A 5HE1B 4CY5A 2QZPA 4L3HD 4JSVC 4CY1A 2HYEA 1NR0A 3MZLA 4BCBA 2I3SA 2H9NA 4ES0A 1XIPA 3EU7A 3ZDXA 4A09A 3RMZD 2W18A 4UM9A 2XL2A 2IWFA 1Q47A 1TBGA 5HE0B 3UVNA 2PM9B 3NIDA 1T2XA 4E54B 2P9KC 3HFQA 3EQ7A 3IJEA 4PSXB 1L0QA 5HE2B 1NEXB 5THAA 5B4WA 3SBQA 2EIEA 3A0FA 4NSXA 4CZYA 4CZXA 5HE3B 3FCSA 3EI4A 4O2WA 4A2LA 3C5MA 5EM2B 4GZ8A 1YR2A 2I0TA 1K32A 1S4UX 3EG6A 2OIZA 5E6RA 2VDNA 3EQ9A 3FRXA 4AMYA 2P9NC 3IUNA 4N14A 4J86A 5H17A 2JKXA 4HDJA 2PM7B 2I0RA 4NAAA 1E5TA 4GM8A 2YMUA 3AL8A 2H9PA 3OF7A 2CE9A 4AN1A 3PXTD 5FKQA 4JD2C 2GNQA 2G99A 1H2XA 1VYHC 4BP8A 1JOFA 5K1CC 2AH0A 2P9PC 2UZYB 4JT6C 1JTDB 2Q7QA 3ZDZA 2B5NA 1B9YA 1K3IA 2VDLA 1SQ9A 5EAMA 2OK4A 4J0XA 3JROA 3MMYA 3BWSA 3OTTA 3VA6A 2P9UC 3DWLC 4ZOZA 4GM3A 4O9DA 3J81g 1H2YA 2QXVA 4L1MA 3IURA 1UOPA 4D9SA 4NBMA 2GC7A 5FXYA 3C9CA 3I8EA 5IJ8E 3K6SA 4E54A 3JB9L 2CO0C 3IUMA 3N0DA 4X3EA 4MMZA 5FQDA 2H13A 4DNVA 2CN2A 4CI8A 1GOFA 5FFOA 4WK4A 3GC3B 2XYIA 1GXRA 2H14A 5EM2A 4JSPC 4FA4D 2EIDA 3I7OA 1YFQA 1UOOA 2WQ8A 5M5RA 2HKRA 4CI1A 4WJKA 5AJAA 2Z2PA 5EARA 3SBPA 4A11A 3K72A 4J82A 3QHYB 2YNOA 3T3PA 3V4VA 4J81A 1PI6A 3EMHA 5EMKB 5K19A 3IUJA 2BBKH 4PBYA 3VI3A 1A12A 3OW8A 2YBAA 4JSXC 2IUPA 4Z8LA 3IVMA 2HU5A 5EMMB 4GQ2P 4L1QD 5A2Qg 1JMZB 1OLZA 3MUNA 5EAPA 3ULEC 4QT8A 2QR5A 1PGUA 3W15A 4KFMB 4FA5D 2CO0A 1VE7A 1XHMA 4GGCA 4L9OA 1I2MB 3IUQA 4FA1D 5GSAA 1PEVA 5CXBA 4L3GD 3KRWB 4JSNC 3V4PA 2HU7A 1O6FA 2QC5A 5I5JA 2VDPA 3EI1A 5IGQA 3OKYA 3ODTA 1K8KC 3PVUB 4NENA 1OMWB 3KRXB 3ZE1A 4A0AB 2AGYA 3DSMA 3UVMA 4CI3A 2XU7A 1FWXA 2HKMA 3PSLA 4UM8A 1U2VC 1GG2B 2IAAA 5FKRA 3CIKB 2HXCA 3MZKA 5FFGA 4AOWA 2VDRA 3I89A 3SCYA 2O9KA 2PBIB 3RN0D 3I8CA 1VZ2A 3JPXA 3K71A 1GP2B 4ERQA 4GQ1A 4BH6A 5CYKA 4J87A 5C86A 2G9AA 4J77A 2VZ3A 5FKTA 3PXSD 4OWRA 2I0SA 3OKWA 4Z7QA 3F3FA 3I2NA 4A11B 3BG0A 3BG1A 3UVLA 2YB8B 3V7DB 1UOQA 4CY3A 4NC4A 4PBZA 4BCCA 3V5WB 3AH8B 4Y7RA 3E0CA 3SJLD 3EWEA 3PVWB 3T3MA 4O3UB 3RFHA 4A2MA 2B4EA 3RFGA 1P22A 1A0RB 3C99A 4QRJA 4UI9R 5SXMA 4U7AA 4FAVD 2EIBA 5M61A 3C75H 5JWZA 4BL0A 2P9SC 3K26A 3IJ0A 2H3XA 4GGAA 5CXCA 4CI2A 2B5LA 2P9IC 1QFSA 2YNPA 5M5SA 2MTAH 4IMMA 3P4FA 5CXBB 5AMSA 4A7JA 3MVDK 5GXIA 3VH0A 3UKUC 4A0AA 2BCJB 4K3JB 1ERJA 5TEFA 3VI4A 4TZ4A 3EI3B 2CN3A 3EI1B 3ZWLB 1U8CA 3SMRA 3OKYB 4J8GA 2EBSA 2P9LC 4PC0A 5EMLB 2H6QA 4DNWA 3J80g 1JJUB 3L4MD 2VZ1A 2XL3A 4FHLA 3ZE0A 5I5IA 2H6NA 3CFVA 4X60B 3UKRC 4G1MA 2AH1A 1U4CA 2HESX 3FCUA 1E8NA 4Y5RD 2AQ5A 5E6SA 4DNUA 3F3GA 4R7AB 4FAND 4GGDA 2OVQB 3SBRA 2XDWA 5CYKB 1GOHA 3SWSD 1L5GA 2VC2A 3IKOA 4H5JA 4ZOXA 4J84A 3MUOA 4X61B 4JHPC 1E8MA 5TF2A 3KCIA 5HQGA 4BUJC 4MMXA 2J57G 1BPOA 4A0BA 4J79A 4WK2A 4ERYA 5GXHA 5IJ7E 4IRZA 3I7LA 1VE6A 1QNIA 5AFU3 2HU8A 4JT5C 1C9LA 1M1XA 3U4YA 3O4IA 3L4OD 2J55H 3NVNA 5H1MA 5IGOA 3NVQA 3PXWD 2IURA 2CNXA 2HJ4A 1MG3A 1SQJA 2AGWA 3JZHA 5CXCB 1TYQC 3EI3A 3VGZA 1UTCA 2HJBA 3IIYA 4O45A 1GOGA 1N6DA 1JMXB 2IUVA 3JZNA 3IULA 1H2ZA 3EI2A 5FKSA 2TRCB 4XEIC 3UR4A 2XZGA 5C9ZB 3RRMC 4J8BA 4CY2A 4ZN4A 2OK6A 2Z2OA 4ZOVA 4A08A 2J56H 2OVRB 3I7PA 3PSCB 3I7HA 4E5ZA 2YNNA 3DM0A 1GOTB 3AL9A 4AN0A 3I7KA 3SN6B 3CFSB 4D6VA 4PNKB 2I3TA 4G1EA 3JRPA 5HDBA 4H5IA 1TYEA 4YVDA 4FWWA 1O6GA 1N6EA 2IWKA 2B5MA 5EALA 2PM6B 2AGLA 3SXTD 5I5MA 4O02A 3UVKA 2H6KA 4X63B 4ZOYA 5HYNB 4RE5A 4QQEA 3K27A 1MDAH 1H2WA 4K3ID 5M5VA 1R5MA 4QL1A 4J0WA 1VZ3A 4EWRA 4A0BB 2VDOA 3OL2B 3UVOA 4BCDA 2AGXA 4CZVA 3B7FA 2H9MA 2Z2NA 3JZGA 3RN1D 4GMBA 3O4JA 3ORVD 2H68A 5E6UA 4D0KA 3EQ8A 5TDHB 2UZXB 1RI6A 4FB1D 3DXKC 4Z7OA 2IUQA 4XYIA 5C2VB 3O4HA 3NIGA 1JV2A 4LGNA 3GD1I 5TEEA 3EI2B 3GFCA 4RE6A 4U1EI 4GQBB 4LG8A 3FM0A 2AGZA 4J73A 4Z7NA 1SHYB 3ZE2A 3QI0A 3MKQA 2EICA 2PM9A 4A08B 3MKSB 4A09B 4MK0B 5IC7A 1N6FA 4E5ZB 3NVXA 5IT9g 4G55A 4O3TB 1C9IA 3OKTA 4LG9A 3IJCA 2OJYA 3SLED 4G56B
chains in the Genus database with same CATH topology
1XKSA 3N0EA 3I7NA 4I79A 2H9LA 4ERZA 3FGBA 4OZUA 2H47A 4JXMA 5FA5B 4FA9D 3DXMC 3EI4B 4AEZA 3OL2A 4O1QD 4J78A 3F3PA 4XYHA 3RSEC 3V9FA 1PBYB 2CE8A 4CC9A 2GC4A 5C2WB 3JAMg 3SHFA 4IA9A 4GM9A 1B9XA 4ESGA 3MXXA 3GREA 3AL8B 3IIWA 2OVPB 5KDOB 5FLXg 4PXWA 5GMKn 3RLMD 3IJ1A 3SVWD 3AFCA 5H14A 3SFZA 4PSWB 1MG2A 5EMJB 3PE7A 5HE1B 4CY5A 4L3HD 4JSVC 4CY1A 2HYEA 1NR0A 3MZLA 2I3SA 2H9NA 4ES0A 1XIPA 3EU7A 4A09A 3RMZD 2W18A 2XL2A 2IWFA 1Q47A 1TBGA 5HE0B 3UVNA 2PM9B 4E54B 2P9KC 3HFQA 4PSXB 1L0QA 5HE2B 1NEXB 5THAA 5B4WA 3SBQA 3A0FA 4NSXA 4CZYA 4CZXA 5HE3B 4A2LA 3EI4A 3C5MA 5EM2B 4GZ8A 2I0TA 1K32A 1S4UX 3EG6A 2OIZA 3FRXA 2P9NC 4N14A 4J86A 5H17A 4HDJA 2PM7B 2I0RA 4GM8A 2YMUA 3AL8A 2H9PA 2CE9A 3PXTD 5FKQA 4JD2C 2GNQA 2G99A 1VYHC 1JOFA 5K1CC 2AH0A 2P9PC 2UZYB 4JT6C 2Q7QA 2B5NA 1B9YA 1SQ9A 5EAMA 2OK4A 4J0XA 3JROA 3MMYA 3BWSA 3OTTA 3VA6A 2P9UC 3DWLC 4ZOZA 4GM3A 4O9DA 3J81g 2QXVA 2GC7A 5FXYA 3C9CA 3I8EA 5IJ8E 4E54A 3JB9L 2CO0C 3N0DA 4X3EA 5FQDA 2H13A 2CN2A 4CI8A 2XYIA 1GXRA 2H14A 5EM2A 4JSPC 4FA4D 3I7OA 1YFQA 2HKRA 4CI1A 5AJAA 2Z2PA 5EARA 3SBPA 4A11A 4J82A 2YNOA 4J81A 1PI6A 3EMHA 5EMKB 5K19A 2BBKH 4PBYA 3OW8A 2YBAA 4JSXC 2IUPA 4Z8LA 5EMMB 4GQ2P 4L1QD 5A2Qg 1JMZB 1OLZA 5EAPA 3ULEC 4QT8A 1PGUA 3W15A 4KFMB 4FA5D 2CO0A 1XHMA 4GGCA 4L9OA 4FA1D 5GSAA 1PEVA 5CXBA 4L3GD 3KRWB 4JSNC 2QC5A 5I5JA 3EI1A 5IGQA 3OKYA 3ODTA 1K8KC 3PVUB 1OMWB 3KRXB 4A0AB 2AGYA 3DSMA 3UVMA 4CI3A 2XU7A 1FWXA 2HKMA 3PSLA 1U2VC 1GG2B 2IAAA 5FKRA 3CIKB 2HXCA 3MZKA 4AOWA 3I89A 3SCYA 2O9KA 2PBIB 3RN0D 3I8CA 3JPXA 1GP2B 4ERQA 4GQ1A 4BH6A 5CYKA 4J87A 2G9AA 4J77A 5FKTA 3PXSD 4OWRA 2I0SA 3OKWA 3F3FA 3I2NA 4A11B 3BG0A 3BG1A 3UVLA 2YB8B 3V7DB 4CY3A 4PBZA 3V5WB 3AH8B 4Y7RA 3E0CA 3SJLD 3EWEA 3PVWB 4O3UB 3RFHA 4A2MA 2B4EA 3RFGA 1P22A 1A0RB 3C99A 4QRJA 4UI9R 5SXMA 4U7AA 4FAVD 3C75H 5JWZA 4BL0A 2P9SC 3K26A 3IJ0A 2H3XA 4GGAA 5CXCA 4CI2A 2B5LA 2P9IC 2YNPA 2MTAH 4IMMA 3P4FA 5CXBB 5AMSA 4A7JA 5GXIA 3VH0A 3UKUC 4A0AA 2BCJB 4K3JB 1ERJA 5TEFA 4TZ4A 3EI3B 2CN3A 3EI1B 3ZWLB 3SMRA 3OKYB 4J8GA 2EBSA 2P9LC 4PC0A 5EMLB 2H6QA 3J80g 1JJUB 3L4MD 2XL3A 4FHLA 5I5IA 2H6NA 3CFVA 4X60B 3UKRC 2AH1A 1U4CA 2HESX 4Y5RD 2AQ5A 3F3GA 4R7AB 4FAND 4GGDA 2OVQB 3SBRA 5CYKB 3SWSD 3IKOA 4H5JA 4ZOXA 4J84A 4X61B 5TF2A 4BUJC 5HQGA 2J57G 4A0BA 4J79A 4ERYA 5GXHA 5IJ7E 3I7LA 1QNIA 5AFU3 4JT5C 3U4YA 3L4OD 2J55H 3NVNA 5H1MA 5IGOA 3NVQA 3PXWD 2IURA 2CNXA 2HJ4A 1MG3A 1SQJA 2AGWA 3JZHA 5CXCB 1TYQC 3EI3A 3VGZA 2HJBA 3IIYA 4O45A 1N6DA 1JMXB 2IUVA 3JZNA 3EI2A 5FKSA 2TRCB 4XEIC 3UR4A 5C9ZB 3RRMC 4J8BA 4CY2A 4ZN4A 2OK6A 2Z2OA 4ZOVA 4A08A 2J56H 2OVRB 3I7PA 3PSCB 3I7HA 4E5ZA 2YNNA 3DM0A 1GOTB 3AL9A 3I7KA 3SN6B 3CFSB 4D6VA 4PNKB 2I3TA 3JRPA 4H5IA 4YVDA 4FWWA 1N6EA 2IWKA 2B5MA 5EALA 2PM6B 2AGLA 3SXTD 5I5MA 3UVKA 2H6KA 4X63B 4ZOYA 5HYNB 4QQEA 3K27A 1MDAH 4K3ID 1R5MA 4QL1A 4J0WA 4EWRA 4A0BB 3OL2B 3UVOA 2AGXA 4CZVA 3B7FA 2H9MA 2Z2NA 3JZGA 3RN1D 4GMBA 3ORVD 2H68A 4D0KA 5TDHB 2UZXB 1RI6A 4FB1D 3DXKC 2IUQA 4XYIA 5C2VB 4LGNA 5TEEA 3EI2B 3GFCA 4U1EI 4GQBB 4LG8A 3FM0A 2AGZA 4J73A 1SHYB 3MKQA 2PM9A 4A08B 3MKSB 4A09B 4MK0B 5IC7A 1N6FA 4E5ZB 3NVXA 5IT9g 4O3TB 3OKTA 4LG9A 3IJCA 2OJYA 3SLED 4G56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKS A;  3N0E A;  3I7N A;  4I79 A;  2H9L A;  4ERZ A;  3FGB A;  4OZU A;  2H47 A;  4JXM A;  5FA5 B;  4FA9 D;  3DXM C;  3EI4 B;  4AEZ A;  3OL2 A;  4O1Q D;  4J78 A;  3F3P A;  4XYH A;  3RSE C;  3V9F A;  1PBY B;  2CE8 A;  4CC9 A;  2GC4 A;  5C2W B;  3JAM g;  3SHF A;  4IA9 A;  4GM9 A;  1B9X A;  4ESG A;  3MXX A;  3GRE A;  3AL8 B;  3IIW A;  2OVP B;  5KDO B;  5FLX g;  4PXW A;  5GMK n;  3RLM D;  3IJ1 A;  3SVW D;  3AFC A;  5H14 A;  3SFZ A;  4PSW B;  1MG2 A;  5EMJ B;  3PE7 A;  5HE1 B;  4CY5 A;  4L3H D;  4JSV C;  4CY1 A;  2HYE A;  1NR0 A;  3MZL A;  2I3S A;  2H9N A;  4ES0 A;  1XIP A;  3EU7 A;  4A09 A;  3RMZ D;  2W18 A;  2XL2 A;  2IWF A;  1Q47 A;  1TBG A;  5HE0 B;  3UVN A;  2PM9 B;  4E54 B;  2P9K C;  3HFQ A;  4PSX B;  1L0Q A;  5HE2 B;  1NEX B;  5THA A;  5B4W A;  3SBQ A;  3A0F A;  4NSX A;  4CZY A;  4CZX A;  5HE3 B;  4A2L A;  3EI4 A;  3C5M A;  5EM2 B;  4GZ8 A;  2I0T A;  1K32 A;  1S4U X;  3EG6 A;  2OIZ A;  3FRX A;  2P9N C;  4N14 A;  4J86 A;  5H17 A;  4HDJ A;  2PM7 B;  2I0R A;  4GM8 A;  2YMU A;  3AL8 A;  2H9P A;  2CE9 A;  3PXT D;  5FKQ A;  4JD2 C;  2GNQ A;  2G99 A;  1VYH C;  1JOF A;  5K1C C;  2AH0 A;  2P9P C;  2UZY B;  4JT6 C;  2Q7Q A;  2B5N A;  1B9Y A;  1SQ9 A;  5EAM A;  2OK4 A;  4J0X A;  3JRO A;  3MMY A;  3BWS A;  3OTT A;  3VA6 A;  2P9U C;  3DWL C;  4ZOZ A;  4GM3 A;  4O9D A;  3J81 g;  2QXV A;  2GC7 A;  5FXY A;  3C9C A;  3I8E A;  5IJ8 E;  4E54 A;  3JB9 L;  2CO0 C;  3N0D A;  4X3E A;  5FQD A;  2H13 A;  2CN2 A;  4CI8 A;  2XYI A;  1GXR A;  2H14 A;  5EM2 A;  4JSP C;  4FA4 D;  3I7O A;  1YFQ A;  2HKR A;  4CI1 A;  5AJA A;  2Z2P A;  5EAR A;  3SBP A;  4A11 A;  4J82 A;  2YNO A;  4J81 A;  1PI6 A;  3EMH A;  5EMK B;  5K19 A;  2BBK H;  4PBY A;  3OW8 A;  2YBA A;  4JSX C;  2IUP A;  4Z8L A;  5EMM B;  4GQ2 P;  4L1Q D;  5A2Q g;  1JMZ B;  1OLZ A;  5EAP A;  3ULE C;  4QT8 A;  1PGU A;  3W15 A;  4KFM B;  4FA5 D;  2CO0 A;  1XHM A;  4GGC A;  4L9O A;  4FA1 D;  5GSA A;  1PEV A;  5CXB A;  4L3G D;  3KRW B;  4JSN C;  2QC5 A;  5I5J A;  3EI1 A;  5IGQ A;  3OKY A;  3ODT A;  1K8K C;  3PVU B;  1OMW B;  3KRX B;  4A0A B;  2AGY A;  3DSM A;  3UVM A;  4CI3 A;  2XU7 A;  1FWX A;  2HKM A;  3PSL A;  1U2V C;  1GG2 B;  2IAA A;  5FKR A;  3CIK B;  2HXC A;  3MZK A;  4AOW A;  3I89 A;  3SCY A;  2O9K A;  2PBI B;  3RN0 D;  3I8C A;  3JPX A;  1GP2 B;  4ERQ A;  4GQ1 A;  4BH6 A;  5CYK A;  4J87 A;  2G9A A;  4J77 A;  5FKT A;  3PXS D;  4OWR A;  2I0S A;  3OKW A;  3F3F A;  3I2N A;  4A11 B;  3BG0 A;  3BG1 A;  3UVL A;  2YB8 B;  3V7D B;  4CY3 A;  4PBZ A;  3V5W B;  3AH8 B;  4Y7R A;  3E0C A;  3SJL D;  3EWE A;  3PVW B;  4O3U B;  3RFH A;  4A2M A;  2B4E A;  3RFG A;  1P22 A;  1A0R B;  3C99 A;  4QRJ A;  4UI9 R;  5SXM A;  4U7A A;  4FAV D;  3C75 H;  5JWZ A;  4BL0 A;  2P9S C;  3K26 A;  3IJ0 A;  2H3X A;  4GGA A;  5CXC A;  4CI2 A;  2B5L A;  2P9I C;  2YNP A;  2MTA H;  4IMM A;  3P4F A;  5CXB B;  5AMS A;  4A7J A;  5GXI A;  3VH0 A;  3UKU C;  4A0A A;  2BCJ B;  4K3J B;  1ERJ A;  5TEF A;  4TZ4 A;  3EI3 B;  2CN3 A;  3EI1 B;  3ZWL B;  3SMR A;  3OKY B;  4J8G A;  2EBS A;  2P9L C;  4PC0 A;  5EML B;  2H6Q A;  3J80 g;  1JJU B;  3L4M D;  2XL3 A;  4FHL A;  5I5I A;  2H6N A;  3CFV A;  4X60 B;  3UKR C;  2AH1 A;  1U4C A;  2HES X;  4Y5R D;  2AQ5 A;  3F3G A;  4R7A B;  4FAN D;  4GGD A;  2OVQ B;  3SBR A;  5CYK B;  3SWS D;  3IKO A;  4H5J A;  4ZOX A;  4J84 A;  4X61 B;  5TF2 A;  4BUJ C;  5HQG A;  2J57 G;  4A0B A;  4J79 A;  4ERY A;  5GXH A;  5IJ7 E;  3I7L A;  1QNI A;  5AFU 3;  4JT5 C;  3U4Y A;  3L4O D;  2J55 H;  3NVN A;  5H1M A;  5IGO A;  3NVQ A;  3PXW D;  2IUR A;  2CNX A;  2HJ4 A;  1MG3 A;  1SQJ A;  2AGW A;  3JZH A;  5CXC B;  1TYQ C;  3EI3 A;  3VGZ A;  2HJB A;  3IIY A;  4O45 A;  1N6D A;  1JMX B;  2IUV A;  3JZN A;  3EI2 A;  5FKS A;  2TRC B;  4XEI C;  3UR4 A;  5C9Z B;  3RRM C;  4J8B A;  4CY2 A;  4ZN4 A;  2OK6 A;  2Z2O A;  4ZOV A;  4A08 A;  2J56 H;  2OVR B;  3I7P A;  3PSC B;  3I7H A;  4E5Z A;  2YNN A;  3DM0 A;  1GOT B;  3AL9 A;  3I7K A;  3SN6 B;  3CFS B;  4D6V A;  4PNK B;  2I3T A;  3JRP A;  4H5I A;  4YVD A;  4FWW A;  1N6E A;  2IWK A;  2B5M A;  5EAL A;  2PM6 B;  2AGL A;  3SXT D;  5I5M A;  3UVK A;  2H6K A;  4X63 B;  4ZOY A;  5HYN B;  4QQE A;  3K27 A;  1MDA H;  4K3I D;  1R5M A;  4QL1 A;  4J0W A;  4EWR A;  4A0B B;  3OL2 B;  3UVO A;  2AGX A;  4CZV A;  3B7F A;  2H9M A;  2Z2N A;  3JZG A;  3RN1 D;  4GMB A;  3ORV D;  2H68 A;  4D0K A;  5TDH B;  2UZX B;  1RI6 A;  4FB1 D;  3DXK C;  2IUQ A;  4XYI A;  5C2V B;  4LGN A;  5TEE A;  3EI2 B;  3GFC A;  4U1E I;  4GQB B;  4LG8 A;  3FM0 A;  2AGZ A;  4J73 A;  1SHY B;  3MKQ A;  2PM9 A;  4A08 B;  3MKS B;  4A09 B;  4MK0 B;  5IC7 A;  1N6F A;  4E5Z B;  3NVX A;  5IT9 g;  4O3T B;  3OKT A;  4LG9 A;  3IJC A;  2OJY A;  3SLE D;  4G56 B; 
#chains in the Genus database with same CATH topology
 1XKS A;  1QFM A;  3N0E A;  4BP9 A;  3I7N A;  4I79 A;  2H9L A;  4ERZ A;  3FGB A;  4OZU A;  2H47 A;  4QAM A;  3DDU A;  4JXM A;  5FA5 B;  4FA9 D;  2BKL A;  3DXM C;  3EI4 B;  4MMY A;  4AEZ A;  5M5T A;  3OL2 A;  2VDQ A;  4AMZ A;  4O1Q D;  2VDM A;  3F3P A;  4J78 A;  4XYH A;  3RSE C;  3V9F A;  1PBY B;  2CE8 A;  4CC9 A;  2GC4 A;  5C2W B;  4WK0 A;  3JAM g;  3SHF A;  2VDK A;  4IA9 A;  4GM9 A;  3O4G A;  1B9X A;  4ESG A;  3MXX A;  3GRE A;  3AL8 B;  3ZDY A;  3IIW A;  2OVP B;  3NIF A;  5KDO B;  5FLX g;  4PXW A;  2XE4 A;  5C92 A;  5GMK n;  3RLM D;  4AX4 A;  3IJ1 A;  3SVW D;  3AFC A;  5M5U A;  4JHN A;  5H14 A;  3SFZ A;  4PSW B;  1MG2 A;  5EMJ B;  3PE7 A;  5HE1 B;  4CY5 A;  2QZP A;  4L3H D;  4JSV C;  4CY1 A;  2HYE A;  1NR0 A;  3MZL A;  4BCB A;  2I3S A;  2H9N A;  4ES0 A;  1XIP A;  3EU7 A;  3ZDX A;  4A09 A;  3RMZ D;  2W18 A;  4UM9 A;  2XL2 A;  2IWF A;  1Q47 A;  1TBG A;  5HE0 B;  3UVN A;  2PM9 B;  3NID A;  1T2X A;  4E54 B;  2P9K C;  3HFQ A;  3EQ7 A;  3IJE A;  4PSX B;  1L0Q A;  5HE2 B;  1NEX B;  5THA A;  5B4W A;  3SBQ A;  2EIE A;  3A0F A;  4NSX A;  4CZY A;  4CZX A;  5HE3 B;  3FCS A;  3EI4 A;  4O2W A;  4A2L A;  3C5M A;  5EM2 B;  4GZ8 A;  1YR2 A;  2I0T A;  1K32 A;  1S4U X;  3EG6 A;  2OIZ A;  5E6R A;  2VDN A;  3EQ9 A;  3FRX A;  4AMY A;  2P9N C;  3IUN A;  4N14 A;  4J86 A;  5H17 A;  2JKX A;  4HDJ A;  2PM7 B;  2I0R A;  4NAA A;  1E5T A;  4GM8 A;  2YMU A;  3AL8 A;  2H9P A;  3OF7 A;  2CE9 A;  4AN1 A;  3PXT D;  5FKQ A;  4JD2 C;  2GNQ A;  2G99 A;  1H2X A;  1VYH C;  4BP8 A;  1JOF A;  5K1C C;  2AH0 A;  2P9P C;  2UZY B;  4JT6 C;  1JTD B;  2Q7Q A;  3ZDZ A;  2B5N A;  1B9Y A;  1K3I A;  2VDL A;  1SQ9 A;  5EAM A;  2OK4 A;  4J0X A;  3JRO A;  3MMY A;  3BWS A;  3OTT A;  3VA6 A;  2P9U C;  3DWL C;  4ZOZ A;  4GM3 A;  4O9D A;  3J81 g;  1H2Y A;  2QXV A;  4L1M A;  3IUR A;  1UOP A;  4D9S A;  4NBM A;  2GC7 A;  5FXY A;  3C9C A;  3I8E A;  5IJ8 E;  3K6S A;  4E54 A;  3JB9 L;  2CO0 C;  3IUM A;  3N0D A;  4X3E A;  4MMZ A;  5FQD A;  2H13 A;  4DNV A;  2CN2 A;  4CI8 A;  1GOF A;  5FFO A;  4WK4 A;  3GC3 B;  2XYI A;  1GXR A;  2H14 A;  5EM2 A;  4JSP C;  4FA4 D;  2EID A;  3I7O A;  1YFQ A;  1UOO A;  2WQ8 A;  5M5R A;  2HKR A;  4CI1 A;  4WJK A;  5AJA A;  2Z2P A;  5EAR A;  3SBP A;  4A11 A;  3K72 A;  4J82 A;  3QHY B;  2YNO A;  3T3P A;  3V4V A;  4J81 A;  1PI6 A;  3EMH A;  5EMK B;  5K19 A;  3IUJ A;  2BBK H;  4PBY A;  3VI3 A;  1A12 A;  3OW8 A;  2YBA A;  4JSX C;  2IUP A;  4Z8L A;  3IVM A;  2HU5 A;  5EMM B;  4GQ2 P;  4L1Q D;  5A2Q g;  1JMZ B;  1OLZ A;  3MUN A;  5EAP A;  3ULE C;  4QT8 A;  2QR5 A;  1PGU A;  3W15 A;  4KFM B;  4FA5 D;  2CO0 A;  1VE7 A;  1XHM A;  4GGC A;  4L9O A;  1I2M B;  3IUQ A;  4FA1 D;  5GSA A;  1PEV A;  5CXB A;  4L3G D;  3KRW B;  4JSN C;  3V4P A;  2HU7 A;  1O6F A;  2QC5 A;  5I5J A;  2VDP A;  3EI1 A;  5IGQ A;  3OKY A;  3ODT A;  1K8K C;  3PVU B;  4NEN A;  1OMW B;  3KRX B;  3ZE1 A;  4A0A B;  2AGY A;  3DSM A;  3UVM A;  4CI3 A;  2XU7 A;  1FWX A;  2HKM A;  3PSL A;  4UM8 A;  1U2V C;  1GG2 B;  2IAA A;  5FKR A;  3CIK B;  2HXC A;  3MZK A;  5FFG A;  4AOW A;  2VDR A;  3I89 A;  3SCY A;  2O9K A;  2PBI B;  3RN0 D;  3I8C A;  1VZ2 A;  3JPX A;  3K71 A;  1GP2 B;  4ERQ A;  4GQ1 A;  4BH6 A;  5CYK A;  4J87 A;  5C86 A;  2G9A A;  4J77 A;  2VZ3 A;  5FKT A;  3PXS D;  4OWR A;  2I0S A;  3OKW A;  4Z7Q A;  3F3F A;  3I2N A;  4A11 B;  3BG0 A;  3BG1 A;  3UVL A;  2YB8 B;  3V7D B;  1UOQ A;  4CY3 A;  4NC4 A;  4PBZ A;  4BCC A;  3V5W B;  3AH8 B;  4Y7R A;  3E0C A;  3SJL D;  3EWE A;  3PVW B;  3T3M A;  4O3U B;  3RFH A;  4A2M A;  2B4E A;  3RFG A;  1P22 A;  1A0R B;  3C99 A;  4QRJ A;  4UI9 R;  5SXM A;  4U7A A;  4FAV D;  2EIB A;  5M61 A;  3C75 H;  5JWZ A;  4BL0 A;  2P9S C;  3K26 A;  3IJ0 A;  2H3X A;  4GGA A;  5CXC A;  4CI2 A;  2B5L A;  2P9I C;  1QFS A;  2YNP A;  5M5S A;  2MTA H;  4IMM A;  3P4F A;  5CXB B;  5AMS A;  4A7J A;  3MVD K;  5GXI A;  3VH0 A;  3UKU C;  4A0A A;  2BCJ B;  4K3J B;  1ERJ A;  5TEF A;  3VI4 A;  4TZ4 A;  3EI3 B;  2CN3 A;  3EI1 B;  3ZWL B;  1U8C A;  3SMR A;  3OKY B;  4J8G A;  2EBS A;  2P9L C;  4PC0 A;  5EML B;  2H6Q A;  4DNW A;  3J80 g;  1JJU B;  3L4M D;  2VZ1 A;  2XL3 A;  4FHL A;  3ZE0 A;  5I5I A;  2H6N A;  3CFV A;  4X60 B;  3UKR C;  4G1M A;  2AH1 A;  1U4C A;  2HES X;  3FCU A;  1E8N A;  4Y5R D;  2AQ5 A;  5E6S A;  4DNU A;  3F3G A;  4R7A B;  4FAN D;  4GGD A;  2OVQ B;  3SBR A;  2XDW A;  5CYK B;  1GOH A;  3SWS D;  1L5G A;  2VC2 A;  3IKO A;  4H5J A;  4ZOX A;  4J84 A;  3MUO A;  4X61 B;  4JHP C;  1E8M A;  5TF2 A;  3KCI A;  5HQG A;  4BUJ C;  4MMX A;  2J57 G;  1BPO A;  4A0B A;  4J79 A;  4WK2 A;  4ERY A;  5GXH A;  5IJ7 E;  4IRZ A;  3I7L A;  1VE6 A;  1QNI A;  5AFU 3;  2HU8 A;  4JT5 C;  1C9L A;  1M1X A;  3U4Y A;  3O4I A;  3L4O D;  2J55 H;  3NVN A;  5H1M A;  5IGO A;  3NVQ A;  3PXW D;  2IUR A;  2CNX A;  2HJ4 A;  1MG3 A;  1SQJ A;  2AGW A;  3JZH A;  5CXC B;  1TYQ C;  3EI3 A;  3VGZ A;  1UTC A;  2HJB A;  3IIY A;  4O45 A;  1GOG A;  1N6D A;  1JMX B;  2IUV A;  3JZN A;  3IUL A;  1H2Z A;  3EI2 A;  5FKS A;  2TRC B;  4XEI C;  3UR4 A;  2XZG A;  5C9Z B;  3RRM C;  4J8B A;  4CY2 A;  4ZN4 A;  2OK6 A;  2Z2O A;  4ZOV A;  4A08 A;  2J56 H;  2OVR B;  3I7P A;  3PSC B;  3I7H A;  4E5Z A;  2YNN A;  3DM0 A;  1GOT B;  3AL9 A;  4AN0 A;  3I7K A;  3SN6 B;  3CFS B;  4D6V A;  4PNK B;  2I3T A;  4G1E A;  3JRP A;  5HDB A;  4H5I A;  1TYE A;  4YVD A;  4FWW A;  1O6G A;  1N6E A;  2IWK A;  2B5M A;  5EAL A;  2PM6 B;  2AGL A;  3SXT D;  5I5M A;  4O02 A;  3UVK A;  2H6K A;  4X63 B;  4ZOY A;  5HYN B;  4RE5 A;  4QQE A;  3K27 A;  1MDA H;  1H2W A;  4K3I D;  5M5V A;  1R5M A;  4QL1 A;  4J0W A;  1VZ3 A;  4EWR A;  4A0B B;  2VDO A;  3OL2 B;  3UVO A;  4BCD A;  2AGX A;  4CZV A;  3B7F A;  2H9M A;  2Z2N A;  3JZG A;  3RN1 D;  4GMB A;  3O4J A;  3ORV D;  2H68 A;  5E6U A;  4D0K A;  3EQ8 A;  5TDH B;  2UZX B;  1RI6 A;  4FB1 D;  3DXK C;  4Z7O A;  2IUQ A;  4XYI A;  5C2V B;  3O4H A;  3NIG A;  1JV2 A;  4LGN A;  3GD1 I;  5TEE A;  3EI2 B;  3GFC A;  4RE6 A;  4U1E I;  4GQB B;  4LG8 A;  3FM0 A;  2AGZ A;  4J73 A;  4Z7N A;  1SHY B;  3ZE2 A;  3QI0 A;  3MKQ A;  2EIC A;  2PM9 A;  4A08 B;  3MKS B;  4A09 B;  4MK0 B;  5IC7 A;  1N6F A;  4E5Z B;  3NVX A;  5IT9 g;  4G55 A;  4O3T B;  1C9I A;  3OKT A;  4LG9 A;  3IJC A;  2OJY A;  3SLE D;  4G56 B; 
#chains in the Genus database with same CATH homology
 1XKS A;  3N0E A;  3I7N A;  4I79 A;  2H9L A;  4ERZ A;  3FGB A;  4OZU A;  2H47 A;  4JXM A;  5FA5 B;  4FA9 D;  3DXM C;  3EI4 B;  4AEZ A;  3OL2 A;  4O1Q D;  4J78 A;  3F3P A;  4XYH A;  3RSE C;  3V9F A;  1PBY B;  2CE8 A;  4CC9 A;  2GC4 A;  5C2W B;  3JAM g;  3SHF A;  4IA9 A;  4GM9 A;  1B9X A;  4ESG A;  3MXX A;  3GRE A;  3AL8 B;  3IIW A;  2OVP B;  5KDO B;  5FLX g;  4PXW A;  5GMK n;  3RLM D;  3IJ1 A;  3SVW D;  3AFC A;  5H14 A;  3SFZ A;  4PSW B;  1MG2 A;  5EMJ B;  3PE7 A;  5HE1 B;  4CY5 A;  4L3H D;  4JSV C;  4CY1 A;  2HYE A;  1NR0 A;  3MZL A;  2I3S A;  2H9N A;  4ES0 A;  1XIP A;  3EU7 A;  4A09 A;  3RMZ D;  2W18 A;  2XL2 A;  2IWF A;  1Q47 A;  1TBG A;  5HE0 B;  3UVN A;  2PM9 B;  4E54 B;  2P9K C;  3HFQ A;  4PSX B;  1L0Q A;  5HE2 B;  1NEX B;  5THA A;  5B4W A;  3SBQ A;  3A0F A;  4NSX A;  4CZY A;  4CZX A;  5HE3 B;  4A2L A;  3EI4 A;  3C5M A;  5EM2 B;  4GZ8 A;  2I0T A;  1K32 A;  1S4U X;  3EG6 A;  2OIZ A;  3FRX A;  2P9N C;  4N14 A;  4J86 A;  5H17 A;  4HDJ A;  2PM7 B;  2I0R A;  4GM8 A;  2YMU A;  3AL8 A;  2H9P A;  2CE9 A;  3PXT D;  5FKQ A;  4JD2 C;  2GNQ A;  2G99 A;  1VYH C;  1JOF A;  5K1C C;  2AH0 A;  2P9P C;  2UZY B;  4JT6 C;  2Q7Q A;  2B5N A;  1B9Y A;  1SQ9 A;  5EAM A;  2OK4 A;  4J0X A;  3JRO A;  3MMY A;  3BWS A;  3OTT A;  3VA6 A;  2P9U C;  3DWL C;  4ZOZ A;  4GM3 A;  4O9D A;  3J81 g;  2QXV A;  2GC7 A;  5FXY A;  3C9C A;  3I8E A;  5IJ8 E;  4E54 A;  3JB9 L;  2CO0 C;  3N0D A;  4X3E A;  5FQD A;  2H13 A;  2CN2 A;  4CI8 A;  2XYI A;  1GXR A;  2H14 A;  5EM2 A;  4JSP C;  4FA4 D;  3I7O A;  1YFQ A;  2HKR A;  4CI1 A;  5AJA A;  2Z2P A;  5EAR A;  3SBP A;  4A11 A;  4J82 A;  2YNO A;  4J81 A;  1PI6 A;  3EMH A;  5EMK B;  5K19 A;  2BBK H;  4PBY A;  3OW8 A;  2YBA A;  4JSX C;  2IUP A;  4Z8L A;  5EMM B;  4GQ2 P;  4L1Q D;  5A2Q g;  1JMZ B;  1OLZ A;  5EAP A;  3ULE C;  4QT8 A;  1PGU A;  3W15 A;  4KFM B;  4FA5 D;  2CO0 A;  1XHM A;  4GGC A;  4L9O A;  4FA1 D;  5GSA A;  1PEV A;  5CXB A;  4L3G D;  3KRW B;  4JSN C;  2QC5 A;  5I5J A;  3EI1 A;  5IGQ A;  3OKY A;  3ODT A;  1K8K C;  3PVU B;  1OMW B;  3KRX B;  4A0A B;  2AGY A;  3DSM A;  3UVM A;  4CI3 A;  2XU7 A;  1FWX A;  2HKM A;  3PSL A;  1U2V C;  1GG2 B;  2IAA A;  5FKR A;  3CIK B;  2HXC A;  3MZK A;  4AOW A;  3I89 A;  3SCY A;  2O9K A;  2PBI B;  3RN0 D;  3I8C A;  3JPX A;  1GP2 B;  4ERQ A;  4GQ1 A;  4BH6 A;  5CYK A;  4J87 A;  2G9A A;  4J77 A;  5FKT A;  3PXS D;  4OWR A;  2I0S A;  3OKW A;  3F3F A;  3I2N A;  4A11 B;  3BG0 A;  3BG1 A;  3UVL A;  2YB8 B;  3V7D B;  4CY3 A;  4PBZ A;  3V5W B;  3AH8 B;  4Y7R A;  3E0C A;  3SJL D;  3EWE A;  3PVW B;  4O3U B;  3RFH A;  4A2M A;  2B4E A;  3RFG A;  1P22 A;  1A0R B;  3C99 A;  4QRJ A;  4UI9 R;  5SXM A;  4U7A A;  4FAV D;  3C75 H;  5JWZ A;  4BL0 A;  2P9S C;  3K26 A;  3IJ0 A;  2H3X A;  4GGA A;  5CXC A;  4CI2 A;  2B5L A;  2P9I C;  2YNP A;  2MTA H;  4IMM A;  3P4F A;  5CXB B;  5AMS A;  4A7J A;  5GXI A;  3VH0 A;  3UKU C;  4A0A A;  2BCJ B;  4K3J B;  1ERJ A;  5TEF A;  4TZ4 A;  3EI3 B;  2CN3 A;  3EI1 B;  3ZWL B;  3SMR A;  3OKY B;  4J8G A;  2EBS A;  2P9L C;  4PC0 A;  5EML B;  2H6Q A;  3J80 g;  1JJU B;  3L4M D;  2XL3 A;  4FHL A;  5I5I A;  2H6N A;  3CFV A;  4X60 B;  3UKR C;  2AH1 A;  1U4C A;  2HES X;  4Y5R D;  2AQ5 A;  3F3G A;  4R7A B;  4FAN D;  4GGD A;  2OVQ B;  3SBR A;  5CYK B;  3SWS D;  3IKO A;  4H5J A;  4ZOX A;  4J84 A;  4X61 B;  5TF2 A;  4BUJ C;  5HQG A;  2J57 G;  4A0B A;  4J79 A;  4ERY A;  5GXH A;  5IJ7 E;  3I7L A;  1QNI A;  5AFU 3;  4JT5 C;  3U4Y A;  3L4O D;  2J55 H;  3NVN A;  5H1M A;  5IGO A;  3NVQ A;  3PXW D;  2IUR A;  2CNX A;  2HJ4 A;  1MG3 A;  1SQJ A;  2AGW A;  3JZH A;  5CXC B;  1TYQ C;  3EI3 A;  3VGZ A;  2HJB A;  3IIY A;  4O45 A;  1N6D A;  1JMX B;  2IUV A;  3JZN A;  3EI2 A;  5FKS A;  2TRC B;  4XEI C;  3UR4 A;  5C9Z B;  3RRM C;  4J8B A;  4CY2 A;  4ZN4 A;  2OK6 A;  2Z2O A;  4ZOV A;  4A08 A;  2J56 H;  2OVR B;  3I7P A;  3PSC B;  3I7H A;  4E5Z A;  2YNN A;  3DM0 A;  1GOT B;  3AL9 A;  3I7K A;  3SN6 B;  3CFS B;  4D6V A;  4PNK B;  2I3T A;  3JRP A;  4H5I A;  4YVD A;  4FWW A;  1N6E A;  2IWK A;  2B5M A;  5EAL A;  2PM6 B;  2AGL A;  3SXT D;  5I5M A;  3UVK A;  2H6K A;  4X63 B;  4ZOY A;  5HYN B;  4QQE A;  3K27 A;  1MDA H;  4K3I D;  1R5M A;  4QL1 A;  4J0W A;  4EWR A;  4A0B B;  3OL2 B;  3UVO A;  2AGX A;  4CZV A;  3B7F A;  2H9M A;  2Z2N A;  3JZG A;  3RN1 D;  4GMB A;  3ORV D;  2H68 A;  4D0K A;  5TDH B;  2UZX B;  1RI6 A;  4FB1 D;  3DXK C;  2IUQ A;  4XYI A;  5C2V B;  4LGN A;  5TEE A;  3EI2 B;  3GFC A;  4U1E I;  4GQB B;  4LG8 A;  3FM0 A;  2AGZ A;  4J73 A;  1SHY B;  3MKQ A;  2PM9 A;  4A08 B;  3MKS B;  4A09 B;  4MK0 B;  5IC7 A;  1N6F A;  4E5Z B;  3NVX A;  5IT9 g;  4O3T B;  3OKT A;  4LG9 A;  3IJC A;  2OJY A;  3SLE D;  4G56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...