3IUJA

Appep_wt2 opened state
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
684
structure length
670
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
molecule tags Hydrolase
total genus 200
structure length 670
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iujA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iujA01
5JZSA 1MN6A 4UBMA 3B3QA 2ZYSA 4UBLA 1DU4A 4UBNA 1IZ7A 4NS4A 1MX5A 2PU5A 3WJ2A 2HHAA 3H19A 3I2FA 2WKWA 1P0IA 4CIBA 5JARA 1A88A 5AKIA 4UFOA 5DLPA 2HU7A 5H3HA 1DX6A 1ORWA 1QIFA 3W06A 4X94A 3WL6A 4DSZA 1JJBA 1UWCA 4J0DA 2PVSA 4KAAA 4HXEB 1HQDA 5AKKA 2VAVA 2YYSA 2BKLA 1XKTA 4BTLA 1WB5A 3C45A 5ALQA 4NMWA 5AP9A 5E4TA 5HFNA 5JADA 3D2BA 1BN6A 3GZJA 5HZGA 3C6BA 2WTMA 4B6GA 4ZV9A 3OG9A 5JASA 1CIJA 3IUMA 2BUBA 2QZPA 3I1IA 3VKFA 5DTIA 4X97A 3IUQA 1LBSA 4NZZA 4YX9A 5HKAA 3ANTA 4G8CA 4E46A 4DYHA 1Z68A 3EBLA 4JEIA 2VJBA 1AMNA 3GELA 3R3XA 2O7RA 3STVA 3ICVA 3WA6A 5CMLA 2V97A 2H1IA 4EY7A 4KEAA 1LPBB 3G02A 3WKEA 4PV7A 3D4LA 3E4DA 4HXGA 3KXPA 2ZSIA 5EGNA 4JH0A 3V48A 5EHXA 4BVJA 4QEKA 2X76A 1EHYA 3I1YA 1GPLA 2O7VA 4GWLA 2IIVA 3JWEA 1N5MA 2PU7A 2HA3A 2WG1A 3O4GA 1Q84A 2Y1KA 4X71A 5K3FB 4F0JA 3EQ9A 2EEPA 5K5EA 4UBKA 2OGSA 2YASA 5CXXA 2V96A 4RGYA 4X92A 4ZV7A 1XZLA 2WIDA 2ZYRA 5T4EA 2VEOA 3SWWA 3AILA 4N5IX 2B4KA 1KU6A 1QOZA 3AZPA 3RKSA 2JBWA 1ZD5A 2UZ0A 2VATA 3ESDA 4G4JA 5ALGA 2WIFA 3UUFA 2X5XA 3CCCA 4U2FA 1B41A 4G9EA 4BCCA 3KWFA 3ZLVA 5LZ9A 1XRLA 3G0CA 3OM8A 4QLAA 2OG1A 4OSEA 2XMBA 3K2IA 1WOMA 4Y2SA 4B83A 3WKAA 2JGEA 4OPMA 5HF5A 1XRRA 3G0GA 4ARBA 4EB0A 5LZ5A 2WHRA 5K3EA 5HK8A 1CUCA 4BZZA 3KOOA 2ES4A 3S8YA 3SK0A 5A6VA 4H7FA 4MWTA 5ALKA 2BUAA 4KACA 3BJRA 3STWA 1Y7IA 2CKMA 4B82A 4Q05A 1WPRA 3WLAA 3B5EA 1CUVA 3HC7A 3FCXA 5SYMA 4W9RA 1QIGA 4ETWA 1BCRA 4E15A 1TIBA 5CH5A 3G9TA 4N8SA 1CUFA 5T4HA 5ALSA 3EQ7A 4HXFB 1XRPA 4LXGA 4Y2QA 1W52X 2G63A 4FNMA 5JD4A 5AM4A 2WUEA 1GPKA 5CTAA 3O0DA 4UFNA 1ETHA 1QJ4A 4PQEA 4BC0A 4C01A 4H7KA 1UZAA 4AZ0A 2WFZA 3O4HA 4C4XA 3FWHA 1UOOA 4AX4A 5IVHA 3QYJA 3G0DA 1MT3A 4DTCA 3D0KA 3TRDA 2C0QA 1UKAA 2CJPA 3F98A 3TGLA 4EY6A 5JIBA 1DINA 1F6WA 1XZCA 2JEZA 4FWBA 5IH7A 5AIBA 1PJAA 2WG0A 1HLGA 1QTIA 4EY5A 4FTWA 3ZPXA 2Z3ZA 4KAJA 1XZAA 1BE0A 2VTVA 2XUDA 1LPNA 2H7YA 3M83A 4XJVA 3RM3A 1E8DA 3W04A 5AH0A 1L7QA 3M3DA 4HRXA 4AB1A 1P0QA 1UKCA 2VAXA 4DM7A 1EVEA 1DT3A 3FLEA 5K3FA 3HYSA 3QBJA 3PE6A 1Y37A 1BEEA 4MEBA 2FX5A 3H1AA 5DJ5A 3VJKA 4ZI5A 2YXPX 1JMKC 5K3CA 5EHQA 1QONA 5ALWA 4DSAA 4LXHA 1ZJ5A 4IH4A 5D3ZA 2XUQA 4TVKA 4D9JA 4EUSA 1QO7A 1AX9A 2GYVA 1E8NA 1TQHA 4P9NA 1WCYA 1MAHA 3H04A 4OCZA 2RGUA 3C43A 1N8SA 1WPXA 2GYWA 3AIKA 5FP0A 1BS9A 2Z3WA 3PI6A 4RNCA 5HCUA 5ALRA 3ESBA 2HA7A 4FFVA 1M33A 4FLEA 3ZLTA 1LPAB 5BWBA 3STUA 4U2BA 4QLOA 2WLSA 2QOEA 1ZD3A 5F4ZA 1DWPA 3ZLUA 1XLWA 1UKBA 3WWOA 3PUHA 5HQ3B 2PPLA 1XZFA 4CCYB 1LPMA 3WZMA 4GW3A 2QR5A 4X95A 2PSEA 3N0TA 2O2HA 4RE6A 3RLIA 2WG2A 5JAOA 1OCEA 3BWXA 3R3YA 5AK4A 3H2JA 1EINA 3H2IA 2BJHA 3QPAA 5AIAA 4HVTA 3AZOA 1XZGA 2C5GA 2PBLA 2RHTA 1LZKA 3D2AA 3Q8WA 3DS8A 3U1TA 2QVBA 3G0IA 1QIEA 5AKJA 4G8DA 1P0PA 5DYWA 3BDIA 5LZ8A 3QPDA 5ISMA 3I28A 1LBTA 4ZGBA 4GLBA 3WK6A 3I2JA 4S0XA 1QIKA 4C87A 4G1FA 2WJ4A 4TPKA 1YS1X 4BRZA 2ORYA 4E14A 3H2GA 2JIDA 4AXBA 4IH9A 5ALEA 3WK8A 3WK5A 3O4IA 5ALLA 1YA8A 1VA4A 4J0JA 4ZRDA 4AMYA 5K3AA 1ZICA 2QXUA 1TKRA 1U8EA 1ZIYA 5A62A 2XUJA 4C88A 5LP1A 3WJ1A 1H2XA 4BE4A 1R9NA 4L72A 4WFIA 3DEAA 1JJIA 3WK7A 3QVMA 4GHWA 2AJCA 4KJXA 1JFRA 5HF8A 1CFJA 2WFLB 1CUWA 2WIGA 3UUEA 3G9UA 2QKYA 3M81A 3G8YA 3HZOA 3WWCA 1VJ5A 2QT9A 4JNCA 1XKLA 3C6YA 3FVTA 2AJ8A 2XMZA 1YA4A 1TRHA 2EDAA 3IB3A 5HF9A 1D07A 2B9VA 5KWJA 2WQZA 1XQVA 4MYDA 3PFBA 1TCCA 1LPSA 4MWSA 3STXA 1F0PA 4BE9A 4CG2A 2CZQA 4N8DA 3K6KA 1EDBA 5T4FA 3H2KA 5AKYA 1K6EA 1BN7A 3ILSA 2QMQA 4X3CA 3WL5A 2HA6A 2HU5A 1MX1A 1VKHA 4B0PA 1EA5A 4CI9A 1Q83A 2PX6A 4E11A 2DHDA 2H7XA 2XMDA 3JYHA 4FBLA 5AKEA 2WUDA 4QE3A 4B80A 4LKOA 1ISPA 2AJDA 3UMJA 4CCYA 1X2BA 2I3ZA 1CUEA 4DMKA 5KBYA 2GBIA 2XMCA 1UFOA 3H17A 4Y2TA 1RP1A 1QIDA 2JGIA 1FFCA 3F67A 3WK9A 4B9AA 4Q1VA 1HPLA 3G7NA 4Y7DA 1E5TA 1O6FA 3F8SA 3ZI7A 1A8SA 3DL7A 1CQZA 2WU4A 5AKHA 2VT6A 4UHEA 3V9AA 1QE3A 4G5XA 3WKDA 1UOPA 5HF6A 4A5SA 1T2NA 1F8UA 4ZXFA 1MTZA 1QZ3A 3C8HA 2OCLA 5AM1A 1CQWA 4QDZA 1VZ2A 4XVCA 2GZRA 3IUJA 4K6HA 2GYUA 3E3AA 4PO3X 5BWCA 1GT6A 1GXSA 5CURA 1ZD4A 3FBWA 3DOHA 3LIIA 1R3DA 1B6GA 4X85A 5JAHA 3PUIA 5LZ2A 2BGRA 1IUOA 2PKYX 4CG3A 2H7CA 2XUHA 1SFRA 3IBTA 4GEGA 1SOMA 3F97A 4WFJA 2DR0A 2XQKA 4P08A 1LLFA 1K63A 1BROA 4LIPD 4JUIA 3BL8A 4QWMA 1CUSA 1H23A 3GBSA 1AZWA 3WIBA 5I9IA 4ZWNA 4B7ZA 3A2NA 4Q34A 4PSCA 2ACEA 1HDEA 3FYUC 4AQDA 2XI4A 3WWPA 4DMCA 4BCBA 5ALNA 3QPCA 2LIPA 4UBIA 5ALMA 3IVMA 2XLBA 5AM0A 4BATA 2OAEA 1MJ5A 1XRMA 5ALIA 3CCBA 5AK3A 4BAUA 2DFPA 3BF8A 4ITVA 3WKCA 1CUXA 2BUCA 4EA6A 1VA5A 4IH1A 5AI4A 3DDUA 2W22A 4PF1A 2WILA 1K5PA 4DNOA 2YH2A 2HL6A 4IQ4A 1H22A 2QRUA 5C81A 5AICA 1XRNA 4CFSA 4FLFA 4PSDA 3CXUA 1I6WA 4B9EA 2XDWA 4BP8A 1AC5A 4ARAA 3H2HA 2NW6A 2XQJA 4BRSA 4WFKA 3LIPA 1GGVA 1N1MA 4OU5A 5E2IA 1H2YA 1SCQA 1W76A 1CPYA 1G42A 4W63A 4MQMA 3KSRA 2AJBA 1U2EA 2P8SA 1UK7A 1YS2X 4KE7A 3GA7A 3ESAA 1UT6A 4PW0A 1UK9A 2CMFA 2FJPA 1ZIXA 2WM2A 1MAAA 1VE6A 5HK9A 1XZKA 3KWJA 3VISA 2QJWA 5JZBA 4UHHA 4W1RA 1QO9A 3G9XA 4J0HA 1E66A 5D3KA 4QDTA 3BIXA 2C4HA 3T52A 4RE5A 4A16A 2GBFA 4X00A 1L7RA 4Y2PA 4PSUA 2XUOA 5JYCA 1ZGBA 5AOAA 3FCYA 1JT2A 1TK3A 4UBOA 1H2ZA 3TJMA 1AGYA 3WZLA 3O9MA 4OU4A 1EH5A 3KDAA 2JGJA 4QWWA 4AO6A 2HRQA 5AI9A 3C5VA 5HFAA 3LLCA 4NVRA 4WDQA 4C4ZA 1ZGCA 4LYDA 2XMGA 1WB6A 3ICWA 3X3HA 1LGYA 3A70A 5DTJA 4XWGA 5AJHA 3ESCA 5JAUA 1C7JA 2OAGA 2VA9A 1AKNA 1F0NA 1JI3A 4QZVA 3DCNA 3T4UA 1QIJA 4OYYA 1ZD2P 4X6XA 1R88A 5AKGA 4KYVA 1HL7A 1VLQA 2W6CX 2JGFA 2QM0A 4ROTA 3VJLA 1MPXA 1Y7HA 1EB8A 1XFDA 1ODTC 4UUQA 2ZYIA 5CT4A 2GBGA 4BDSA 4FDMA 3GFFA 4UHDA 1CUDA 4X6YA 4AMZA 2WUGA 2OCIA 3PF9A 4FMPA 2OXEA 2OCKA 1BCSA 4CG1A 4H7JA 5AI8A 2RAUA 4W1QA 3DJYA 4M0FA 3K9BA 3FNBA 3H18A 4KRYA 3C6ZA 2QJRA 5K3DA 1PV1A 4JYPA 1W4LA 3WIOA 5AKZA 2G5TA 3DOIA 5BV7A 3M82A 5YASA 2C7BA 2VJDA 5AI5A 1J07A 1EK2A 2XUPA 3H1BA 5CBKA 1WHSA 1IUPA 1DQYA 2GZSA 1N5RA 5FKJA 1J1IA 1G66A 2Z8XA 1OILA 3R3WA 1DT5A 3NGMA 4I3FA 1CVLA 4M0MA 4Q3OA 4Z49A 1LPOA 1Q0RA 4K6KA 5LLSA 4PNZA 1FFEA 4H18A 2WIKA 1G4HA 1UOQA 3OOSA 2GBCA 2PSFA 1CUHA 4L0CA 3WWDA 1LNSA 3W9UA 4J7AA 2Z5GA 2Y2VA 4EBBA 5ALHA 2IX9A 5FOQA 3MUOA 4UHBA 3OURA 4WY8A 5C8XA 4BB0A 4INZA 4AN1A 2VQ6A 5AM2A 4KRXA 4W1PA 2BFNA 1FFAA 5J3JA 4EHBA 3NUZA 5AKXA 3JW8A 4AO8A 1E3QA 3DD5A 1IMJA 4H35A 2Z8ZA 1QGED 5D7BA 5AI0A 1FFDA 5JD6A 5A7GA 1W1IA 1GQSA 3V1KA 4W1SA 1AQLA 4G9GA 4FHZA 2ZJFA 1XZBA 3NOXA 1BRTA 5FUMA 3OTQA 3S2ZA 3AIOA 3RARA 4BCDA 3WKBA 5JZ9A 5DYTA 1E89A 1C4XA 4FLMA 5JAPA 1XZJA 3C8DA 5AM3A 1DTEA 4OUKX 1A8UA 1JJFA 1KEZA 3Q0TA 2DSNA 2XQGA 2ZJ7A 4O08A 2HA0A 4C6HA 5C7YA 4L9AA 2VT7A 2H9YA 1ACLA 2HFKA 5IVDA 1XRQA 5FPPA 3EF3A 1XZEA 1YCDA 3MUNA 4GI1A 3CN7A 3DKRA 5CRIA 1E8MA 3PFCA 5AOCA 1XZMA 3AUKA 2O2IA 5AHXA 1THTA 2CB9A 4KE9A 2PL5A 4X7BA 4FFWA 3PICA 3YASA 1ZI6A 4Y2JA 4UHFA 3TEJA 3VVMA 1USWA 1TAHA 5EHNA 4DNPA 4J03A 4J3JA 3V1NA 4B85A 3A2LA 1SC9A 2DHCA 3FSGD 4P93A 5AK5A 5IVKA 3ZWQA 4H0CA 3WWEA 4Y2UA 4B84A 5KREA 2XT0A 3HABA 1K8QA 5CXUA 3QMMA 4HTAA 5ALYA 2E3JA 4QDOA 4M0EA 5HKBA 1R50A 1CLEA 3I2IA 3FAKA 5ALDA 1H2WA 1DQZA 1JU3A 3H0CA 1WM1A 3DYIA 5ALUA 5LZ4A 2JGLA 7YASA 1FJ2A 2PM8A 5HQ3A 4BDTA 1CUAA 1XLUA 4KAFA 5LYYA 3L1HA 4KE8A 4K6GA 1NU8A 3C5WP 2I3DA 1JU4A 4IHAA 4U2GA 1XQYA 1MU0A 2WUFA 1VXRA 4DMFA 2HM7A 2Q0XA 2VJCA 4QDXA 2XMQA 3WL7A 2V98A 1GKLA 3QM1A 3I2GA 1JMYA 2J3QA 4LHEA 4Q3KA 5ALXA 4B81A 2O2GA 3R41A 4OB8A 2HRRA 3WK4A 4Y2VA 1XQWA 3R3ZA 5SYNA 3I6MA 1YR2A 1K4YA 3D5EA 1UK6A 1ODSA 4H7HA 4BBZA 1GKKA 3MGAA 1GPNA 1ACJA 2X8BA 3BJMA 2XUIA 3IUNA 4IO0A 1J2EA 1S8OA 2J4FA 3VJMA 4JYMA 2XQFA 4QDUA 5CT8A 4DGQA 5FLKA 4LXIA 4K2AA 2JEYA 5AOBA 1W75A 4J0GA 2WFMA 4K5QA 4N5HX 3WL8A 2VF2A 4H7IA 3EQ8A 4F60A 2B61A 1EK1A 5CH3A 4BVLA 3BF7A 1Q0ZA 1DWOA 2OCGA 3A6ZA 1ORVA 1A7UA 5KWIA 3O9VA 4BZWA 2XMSA 3IIIA 4BYMA 1CUGA 5D6OA 1AUOA 4BAZA 2WIJA 4WDRA 5IVIA 3WYDA 5IKXA 1QIHA 1QIMA 2WFLA 3L1IA 3I6YA 1ZJ4A 2WHPB 4WJLA 1CUBA 3O4JA 3V1MA 3VDXA 1TCAA 3AJAA 3E0XA 5CW2A 2HFJA 2XUKA 3OPMA 3SC2A 4V2IA 2V9ZA 3FYUB 4CCWA 5JANA 3QH4A 5AI6A 5CT6A 4BP9A 4BAGA 1GZ7A 3AIMA 2ECFA 3DQZA 1MX9A 5JALA 2FUKA 1T4MA 3QITA 3FSGA 2G4LA 4MYSA 2QXTA 4HAIA 2HADA 1IZ8A 2ROQA 5A71A 1A8QA 4KR0A 1HKHA 5DNVA 5FRDA 1YAJA 2ZVDA 4FBMA 1L7AA 4EZIA 3D3NA 4A23A 1NX9A 1QFSA 4U2EA 4FNGA 4QA9A 3DL4A 3ED1A 3BIWA 1AURA 1U65A 1HBJA 3WYNA 1TCBA 2PSJA 5EFZA 5A7HA 2B20A 6YASA 2WHQA 5CT9A 2RIPA 3FLAA 4EY4A 5AO9A 3N2ZB 1XLVA 4X91A 2JGMA 5I8PA 3STYA 1DX4A 1THGA 1R1DA 1EX9A 3LS2A 5CH8A 3DLTA 3IULA 2OGTA 4KE6A 5I7UA 3SX4A 5C8VA 3BDVA 4OB7A 3AZQA 3I2HA 5EI5A 3V1LA 2DCMA 1CUIA 4EY8A 1FSSA 5ALZA 4X90A 4WCVA 3CN9A 2WTNA 3P2MA 1C7IA 2WU3A 1QTRA 4X93A 2HDWA 5FV4A 2C5FA 1CUJA 5LZ7A 5ALPA 2K2QB 2G5PA 1VZ3A 3ANSA 3LCRA 3IA2A 2BCEA 3FOBA 4DNQA 4I4CA 3HSSA 2QUBA 5DYYA 3D7RA 2C0PA 4CIAA 4FKBA 1KU0A 5A7FA 4LYEA 5DWDA 3IDAA 2ONCA 3BE8A 3WA7A 4H7DA 1J06A 2OQIA 4YPVA 3C6XA 1QLWA 2J4CA 4UHCA 2WHPA 4TGLA 4BVKA 4C4YA 3HACA 1GQRA 2QTBA 3HJUA 2ACKA 4BC1A 2D5LA 5C8ZA 3FLBA 4YK7A 1BU8A 5AM5A 2JF0A 2XE4A 1VOTA 1LPPA 3B12A 2Y6VA 1ODCA 3VXKA 1CV2A 2XUFA 4Y9SA 3FYUA 1CUZA 2OPHA 2R11A 3D2CA 1UK8A 5EIAA 1OXMA 1CUUA 1FFBA 1MO2A 1XZIA 2FJ0A 4DIUA 2DHEA 2OLEA 3FYTA 1CR6A 1UXOA 1R4ZA 1RWQA 3HLKA 3W2TA 4L3WA 4F5ZA 1WB4A 1MNAA 2QS9A 1SCKA 2C58A 5LKAA 1U4NA 1W6RA 3WMRA 2HIHA 5AK6A 5JATA 5LKRA 2BAGA 4Y2XA 4ZREA 5FXMA 1SCIA 4G8BA 2HA2A 4X6UA 5K3BA 1YB7A 3R0VA 3I6ZA 3HRHA 3U0VA 2HU8A 3VVLA 4Q3LA 1YSCA 4J0IA 2HA4A 1IUNA 1QIIA 4DLNA 1XZHA 2OQVA 3MVEA 5T4BA 2CUTA 5EIEA 3WQHA 2ZSHA 1XZDA 4MEAA 2BGNA 5EHZA 4H7EA 3R40A 3G9ZA 3D59A 4HS9A 2WSLA 5ESRA 2RHWA 4MQLA 4OD0A 2IITA 1EVQA 1EB9A 3NWOA 3F9CA 1R9MA 4AO7A 4FOLA 2EDCA 1PFQA 1XQXA 3OC0A 3PDCA 2XUAA 2PSDA 2QUAA 1ZI8A 3E1GA 3BXPA 1X70A 3LP5A 1EI9A 4I19A 2WJ6A 4DNFA 4YASA 1DWQA 3QMWA 3AINA 2HA5A 2VSQA 1YASA 3O95A 3G0BA 1VXOA 4BTVA 1YB6A 3QZUA 3R3UA 4HRYA 5E4JA 3L1JA 4P92A 3W9BA 5E4YA 3W05A 2DQYA 4WY5A 4GDMA 3QMVA 3DYVA 2PUHA 4N8EA 1WHTA 5DNWA 5EIHA 1O6GA 4OYLA 1YAHA 4UPDA 5JD5A 2Y2UA 4F21A 2ZYHA 3RK4A 4Y2YA 1VE7A 2XLCA 4B0OA 3PF8A 2RONA 2XB6A 1BEZA 1G5FA 5CT5A 1EXWA 1XROA 1CEXA 1QFMA 1EDDA 2PUJA 5LIPA 5ALFA 4MJ3A 4H77A 1P0MA 1LZLA 3DKKA 4UBJA 4GXNA 4UFPA 2JGKA 3WI7A 2XUGA 1NU6A 3GUUA 3IURA 2Y6UA 3AFIA 1CRLA 4Q82A 3F96A 2WJ3A 4Y2RA 3ZV7A 5AKLA 5FPQA 4GECA 2AXEA 4AN0A 4U2CA 4XX1A 1X2EA 5FDFA 3FVRA 1EDEA 2XQIA 1MNQA 4HZGA 2ZJ6A 2RI6A 1ZOIA 3C70A 3HXKA 2XMRA 3R3VA 3A2MA 4DMHA 4RPCA 4U2DA 1CUYA 3STTA 5ALVA 2J3DA 3HEAA 5BOVA 2I03A 3KD2A 4AZ3A 2DQZA 1ZI9A 1RYYA 5A2GA 4G4IA 3EIOA 4MXDA 4J0KA 2OGZA 2R8BA 3C87A 2AJLI 3GROA 3I2KA 4QNNA 3HI4A 4XIIA 2CEKA 3DNMA 2VJAA 4OB6A 5DNUA 2CBGA 1JKMA 1IVYA 4J0CA 5ALTA 5ALOA 4GBGA 4G4GA 2I78A 2D0DA 2PSHA 4C89A 5ALJA
chains in the Genus database with same CATH superfamily
5JZSA 4QYXA 2HZ7A 3DP7A 4PAWA 5EL0A 1DQRA 2VDVE 3GRPA 3I2FA 1RFGE 3DLIA 4LSMA 3ZW8A 1JHMA 1A88A 3HPRA 3TKYA 4HDKB 4K26A 4FSHA 4AX8A 1Y1QA 2GSWA 2R62A 4HB3A 1QYWA 1W4BA 5F3RA 1MKYA 5DWQA 2CLHB 4ZZ0A 3VU3A 3VUEA 1AKTA 4YP0A 5AP9A 3UMCA 4IJ5A 4IJWA 4EFNA 4MUEA 1YIAA 2AFRA 3A0FA 1IK4A 4YROA 3RUFA 3SCYA 5HKAA 4XPIB 5HBRA 3KQWA 4TLAA 2NO0A 3VR6D 3C3BA 1CLUA 2VDMB 3E84A 4HO1X 2AD1A 1LTKA 3KT6A 4MMXB 3VR5H 4LBYA 4OMUA 3NEPX 5H83A 1WF3A 3RRFA 4Y30A 3KB1A 4TLEA 2Q0SA 5FWXA 3M5PA 1SBQA 3JRXA 4R5MA 1JMZB 4ZCPA 4B74A 1OJLA 5F12A 5BSWA 2A1IA 3GD5A 3O21A 1ST2A 4PGGA 1N4DA 3MOGA 5AVRA 4EM6A 4UJ3A 4KO3S 2I3GA 3HKBB 2XKJE 1OGIA 1F3OA 3EEOA 4EG0A 3OM8A 3T9FA 3DFUA 2ZIAA 4P8RA 3K0FA 4Y2SA 3QE3A 1B42A 1T3ZA 4NNOA 2H18A 1Z4LA 2WJWA 3WKAA 1T3LA 1GP2A 1LJLA 3ZZTA 3JYOA 3NP9A 4LVOA 4NAVA 3KOOA 2EJVA 3L40A 4PZPA 1Q20A 4TXHA 3U7RA 1QKKA 3MBOA 2IEAA 3GMDA 1P9OA 3UBTA 5K8UA 1Y3DE 4RY0A 3AESA 4GM1A 3ITDA 3KJXA 4UTZA 4E15A 2C29D 1O5IA 3DDOA 3ONFA 4KPUA 4P7FA 2GM3A 4W6ZA 5AM4A 4UFNA 5T7BA 3QFSA 3K70C 4AZ0A 3C3JA 3FDZA 2JASA 2JLBA 3AL0C 2B1GA 2FEWB 3EASA 3GA0A 1UKAA 3UC5A 4ITUA 4IIGA 2NYAA 1W581 1SELA 4QU8A 3PB3A 1PJAA 2YJ5A 4QG3A 2W90A 3KT0A 1RJGA 2VJOA 1P0FA 2H7YA 1M2JA 4US1R 4UULA 3H6HA 1T1JA 1AKQA 3RIGA 3CBQA 1XR3A 3GLHA 1WSDA 3ZX5A 2EGHA 1SEPA 3NOVA 2Z1MA 1XAJA 2QL9A 4XA8A 3LGSA 4GM8A 1J7KA 3BXGA 3JZNA 1NQUA 5D3ZA 4C0BA 4TVKA 2A8YA 2I5PO 3R6LA 2YNMD 1G2IA 1KEKA 1WCYA 4GM9A 1MAHA 1MEJA 2JBHA 2R00C 1N8SA 1S3IA 4A5OA 4JZKA 5HCUA 1S9HA 4WXYB 3O8DA 4ZQFA 2ON6A 2XPCA 4ODIA 3ORFA 1R27A 2XSZA 5GM1A 1SPBS 3QF4A 4BOYA 3PYLA 1T13A 4G5FA 5C8YA 3E05A 2BBKH 4AY2A 3GC6A 3G6WA 3IO5A 3ICQB 3WXMA 2AGWA 1PP4A 5GY7A 1JG2A 2YXBA 4OQYA 3OPYI 5L51A 2PA0A 5EZSA 3OKTA 4P32A 2XQVA 4F04A 3SC4A 3MQ4A 1AQUA 5CDFE 1CCWA 5C86A 4IKEA 3B1XA 3KKNA 2XR1A 4B3RB 2WWFA 1Y8AA 1B43A 3AFHA 2H4HA 3AHFA 4M0PA 5EP2A 4S1VA 3FKSA 2HIAA 2FVYA 4DV6B 4LI3X 4C76A 3B3JA 3MRXA 3OMLA 5IFLA 1Y7PA 2EFJA 5IULC 1VFNA 3NDIA 4YBRA 2D0IA 5KNDA 2R1ZA 3NHSA 4WASA 1EFDN 4QO8A 3Q3JB 5JAMA 1D09A 3IMGA 5E1MA 2ZKIA 1JVSA 3TM4A 3WJAA 2E9SA 4AICA 5BN3A 3F73A 4YJFB 1XQ6A 5JS7A 3L8DA 4CDNA 4HX2A 4BMZA 3M5DA 4KMMA 4L1KA 4O59O 1VPWA 1TCCA 4ZVPA 5ED0A 2DJIA 2R87A 2FZ4A 5HX7A 3SMRA 2DX7A 4X3CA 3PDHA 2HA6A 4IDOA 3OQPA 1L5LA 3UM9A 1GGKA 3D6TB 5KQLA 2A67A 4FHEA 1KOGA 1YVPA 4RETA 2PZJA 4CY1A 1EHIA 3NGLA 3FNGA 3RIYA 3VZDA 2W0MA 5J4HA 4WZBE 1V2HE 1S01A 1N0UA 2FSSA 4DA0A 1ISPA 4P5DA 3GEDA 2CWWA 1QOQB 5JWHA 1J97A 3LVQE 3DTVA 1NGSA 5K1CC 1HDGO 4NSNA 4HPJB 1Z88A 3D8NA 1SO8A 2XTZA 4NK5A 3K9QO 2QW1A 1OXBB 4RZUA 3NT4A 4BFZA 3O2NA 3Q5EA 2JH8A 2WOJA 2XMPA 1BKSB 5AKHA 4RSHA 3QKSA 1Z0SA 1QFXA 5IC4A 2WD8A 4TZ4A 3CLTC 3K3PA 5FNVF 4PSXB 4ZI2A 2OK8A 2XHEA 1MVOA 1FVFA 3COPA 2VDKB 1NULA 1YI0A 4K6HA 1QK5A 5AESA 4IQGA 1GXSA 3B8HA 4JLDA 4MSUA 2D2IA 3T4XA 4EVIA 5KVCA 4KXLA 4LJKA 2P9SC 4HUTA 4DQXA 1WJGA 5JAHA 5LZ2A 1FFGA 4D6PA 2GPWA 3HV2A 3F97A 3L1UA 2MCFA 3KEQA 2ORED 1SBZA 1QGZA 5EM2B 4PO1A 2WWHA 1L9XA 4OA5A 2I8LA 2Y1LA 4K03A 4JUIA 3F3MA 4HGOA 3ZVMA 2WSSA 3HKEA 4L95C 4JBXA 3T5DA 5CDYA 4ZGGA 4F2HA 1C1DB 3RH0A 4JY7A 2AFHB 2QX8A 5REQB 4DMCA 1HDZA 3O26A 2Q4RA 1X8KA 3NBMA 3QPCA 1QGUA 5JTUA 1JT9A 3JVIA 4A4DA 4NRDA 3AR7A 2DFPA 1EA7A 4CR8A 4I55F 4ARUA 1F7UA 3IJ1A 1LH0A 1K75A 4KXVA 4R3WA 3L0YA 1PBTA 1JS1X 4RK6A 3L05A 1RYNA 1OWPA 3H8JA 5CUQA 4EA7A 3G0HA 2B4RO 1GARA 4WBSA 1JSLA 3H2HA 5THAA 4YN3A 4OHZA 2YKGA 4KIUA 3LOPA 5E2IA 1CPYA 1FYEA 1U2EA 2KPOA 2P8SA 4KE7A 2IKQA 1KJIA 5JAIA 5EZYF 1YRQA 1UK9A 4UVDA 3KB8A 1PTJC 4KK4A 5ECYA 1OU0A 2PH3A 2GWRA 1O9HA 4YV1A 4UCXA 2GERA 3S27A 3K0CC 5C3MA 3NCTA 1W96A 4FCCA 4C0XA 3PJEA 1T6NA 3IXMA 4HVAA 2CHQA 1TK3A 5FF9A 4R5HA 3L9WA 3AL3A 2ID4A 2GCIA 4OQXA 4AUKA 3U3XA 1ZGCA 2JRLA 4U3JA 3N0WA 1SXIA 1GOTA 3E3LA 2HHJA 3KJZA 3D6NB 1HYQA 5DYIA 1KZ1A 2QTMA 1PO7A 4QZVA 2GF0A 3TLGA 4X6XA 1W73A 5C1OA 2JGFA 4CBVA 4C5BA 3TRJA 1PU2A 2DY1A 1KJWA 2IH2A 1J2UA 4ZRMA 3S1AA 3FKSD 3O82A 4HPXB 4B2LA 2B8EA 4ZMBA 1PLKA 1OFUX 1L4FA 3LHIA 4YRMA 3S2FA 2EJCA 1JP7A 4LDNA 2OR3A 1INLA 2I7XA 4L1MA 4DLPA 3EI1A 2IX3A 5BN4B 1W4LA 3WR5A 1KGSA 3DOIA 4IMPA 4DBLC 3I9V6 1RTKA 5TARA 2VJLA 5AHWA 4KH1A 4HFMA 5KOHB 1EFAA 4ZCSA 1ULBA 1KDPA 3SBXA 2W4IA 4NONA 1JHYA 1G66A 4CEHA 3COJA 1L1RA 2GWHA 5D7NA 4AJEA 1CE8B 3R75A 4WL0A 5EWMA 4JI1B 1YRAA 3JY6A 2Q9AA 3I1JA 3DZBA 2YDYA 1C9YA 1SIUA 1X13A 4EP1A 2QHXA 5EWJA 1KC3A 2D5BA 2ZTHA 1SRQA 2A0YA 3B6EA 5ALHA 3ZDYA 2Q5FA 1K7FB 1ZUNB 5HIIA 1CS0B 5EVCA 3DTVD 4NEHB 5C8XA 1Y6JA 1E3WB 5L6LB 5SZIA 2Q7XA 4GC5A 2GS9A 1V4VA 4BN4A 4RD6A 4CZXA 4H35A 2Z8ZA 1QGED 3JARA 3L7JA 1JGTA 1SIOA 4Z51A 4LRWA 4IVRA 1J0DA 4PC6A 3AO0B 1X7YA 3OHSX 3DBIA 1A4RA 3HU3A 3RREA 1I3NA 4EHLA 2GDJA 2KJQA 4MV0A 1GNRA 3BK1A 4PBYA 2I55A 3LKBA 3CKYA 2BP7A 3E9RA 3U4MA 4EVRA 4NU0A 5AQ1A 2NLOA 1CB0A 1TF2A 3ENQA 2OFXA 3CEAA 4H08A 2L18A 2Y0EA 1FOEB 2DSNA 1XTZA 2JJMA 1YUBA 2VT7A 1GITA 4LNUB 4PBSA 5P21A 2XYIA 4D74A 2YQZA 1E3MA 3ILVA 4ENQA 3VC2A 2G9NA 1SRRA 2MU1A 1U81A 2AHOA 2A9JA 1XLTA 1X1EA 2B2XA 2LDBA 3BBPA 3TTVA 1DRUA 1W59A 3D8TA 4FEEA 4WA8A 1PF7E 4C06A 1ZH0A 1Q7EA 4KQIA 1P8AA 2VNKA 3C5CA 2OXIA 1WDKA 2XRFA 1K3UB 2DQKA 2R6CA 4RKQA 4L3HD 2O1EA 5EIBD 4A36A 4M1QA 1IM2A 3ZBTA 3B7PA 3F7TA 3FGNA 3MCVA 2PR2A 1FFXB 2WWTA 3QMMA 2EKPA 1Z38A 3I01A 3AY3A 4MZDA 4ISBA 5J40A 1BDBA 4ER0A 3JQ7B 1R00A 1O9GA 2NN3C 2VDRB 3ZJ4A 1XN4A 4I9FA 1NLZA 2UV8A 2BE9A 2Z8YA 3Q3CA 1XCLA 4DV4B 5LQMA 2V98A 2HW8A 4HQKA 2I2DA 1RXIA 3OCUA 4LJSA 4I66A 4PX5A 4F6RA 1XQWA 5KQPA 4FDUA 4EJ0A 4J1TA 4MROA 3T95A 4GFDA 2XCIA 4IO0A 3QU9A 3LP6A 4JU9A 1N9GB 1T0UA 2AN9A 4IG9A 4DGQA 1N3BA 3P2EA 4K5QA 1MQSA 2GOYA 3BYZA 3WL8A 1TYQC 2VF2A 2G28A 3DGEC 5HKLA 1NY5A 4BVLA 4FMDF 5M5UA 3EMBA 2DETA 4GQIA 1XTKA 1CUGA 4MYCA 3O74A 1SPXA 3UO8B 4DNWA 2A1UB 2H6EA 1KMMA 2ZSEA 1JSRA 1TQ8A 2VOJA 2V9ZA 4CCWA 1R4NB 5K03A 4NV1A 3AIMA 5IEBA 5F9FA 1KI8A 4ILEA 1N2OA 2BKUA 3TW8B 4BVAA 4GX1A 1XP5A 1GPDG 4IDPA 3WISA 1SHKA 4BFYA 3FJOA 4JP2A 4W5HA 2A0WA 2IYNA 3HFJA 2PAAA 1EJ2A 2ZVDA 4FBMA 4RTJA 1Q1EA 1A9PA 3V4OA 5DHPA 4CE6A 2VKTA 2O5CA 4L2IA 2PX5A 4KIJA 3U19A 1Z4QA 2WZDA 5HWSA 2QM3A 1H1LA 1TCBA 2NUTA 2B98A 4C4AA 4R81A 3PEUA 3R6DA 2WM3A 3EOAI 3H97A 6YASA 2IODA 4EY4A 5AO9A 3ZCVA 1XRJA 3IJ0A 2VBGA 3TSYA 2UUCB 1ZNZA 3WYGA 3TTWA 2COEA 3UT0A 3LS2A 4UMEA 1R18A 4RK4A 4C5AA 1Q21A 4FYVA 3HFSA 1S1CA 4V1CA 3FIUA 3PVSA 3Q1LA 4ZI7A 2ZJYA 1QR6A 3CPSA 4POOA 2WTNA 1U1CA 1YDGA 3D2LA 1J33A 2P9QA 2WU3A 2C7GA 2IS1A 4KIGA 3D6AA 4DC1A 2ZI5A 5DCLA 3IAS6 1OI2A 2DMRA 4JSTA 5ICFA 3FOBA 5AJTA 4MUJA 3BD8A 4OHPA 4DCJA 1CBUA 1J06A 1Z5OA 4MWDA 3RIXA 2P1DA 4I5FA 4Y8VA 4ZOXA 3AERA 4UEJA 3ZV3A 1FDRA 3MAAC 2FGJA 3NONA 2PX8A 3CKLA 2D8MA 1I80A 4XZ3A 3R1IA 4OUDB 3H8VA 3R7FA 1PQYA 5DT9A 5T3YA 4DEYA 5EKXA 4AK9A 1TF7A 4LMPA 1SA0A 2GUGA 3LT5A 3X0DA 4YQEA 4BO6A 2WVHA 4GM3A 3LUDA 4URWR 4IYRA 5LMCA 5C4GB 3NLLA 2OLEA 3LHFA 3H0KA 3QNUA 2RH9B 3EMKA 3IBSA 3PX2A 2HQRA 3OCCA 3TJRA 2WJPA 2BY4A 3C2QA 4GAEA 5GM2A 3W6NA 4UTOA 3U0VA 3DZCA 3QA3E 1E2KA 4B5KA 4QJBA 1PGOA 1XZHA 2BHRA 2D54A 1XZDA 2IYXA 1XI2A 4HNTA 3PJGA 4Q9KA 4H59A 1JX6A 1TZBA 4O45A 1KY5A 3D59A 2CZGA 2IYQA 3IRVA 1FTNA 4OD0A 2IITA 1X1SA 3IBYA 4ESEA 1TYEB 3GLRA 2Q5QA 3F9CA 3C6MA 1CQJB 1C3XA 4RSMA 4FOLA 1Z2AA 4RV4A 3BTOA 1D1QA 2F9FA 5K6TA 1T8UA 1D03A 4QASA 3TLBA 2B34A 4U1RA 4PYIA 5JH7B 1JALA 1DDGA 1Q0TA 5CTJA 2WTUA 1HNNA 1Z36A 3L1JA 2BKAA 1KQFA 1NF3A 4ZDKA 5FO1A 3GLHE 4CYMA 5FPTA 5KHLB 4WOCA 1N3LA 3F47A 4TV9B 5EIHA 3NPMA 5JD5A 4IF4A 1L7PA 5JFOA 2PFKA 4CI8A 4XIGS 5F9HA 3F7MA 5CT5A 3Q9UA 2OD9A 1LS6A 5FWDA 4MVJM 1E1CB 5ALFA 4Y1FA 4JB0A 1TYAE 4R8SA 1JEDA 1JJ7A 4HJXA 3GP5A 3OZEA 3I0MA 5ECWA 3LBYA 2AGXA 1OFTA 2OO3A 4KZKA 1Q1NA 1AD2A 1RC8A 4K9RA 1TVCA 3EA4A 5LP6C 3HXKA 2A6PA 4JP8A 3U2QA 3EUWA 5U4XA 5K6RA 5TMBA 2RFLA 4UE3S 3HKDB 4XEHA 4F2PA 4YMHA 3M3HA 3TLJA 3HPQA 3CLUD 3BFVA 4G4IA 3SHOA 1GZUA 2OOSA 2VZ0A 3CNOA 3A04A 1XVVA 3HHPA 3PXTD 2LD4A 1SQ6A 3H5RA 4G56B 1EYZA 2CEKA 4IG4A 1DG3A 2QNRA 1IVYA 5JRZA 1EK6A 4Z9AA 2I7DA 1QPGA 3FCOA 4LOAA 1GR0A 4WZAA 3K0AA 4UBNA 3JTMA 3MMYA 2A5LA 4UVGA 1B2LA 3NHFA 4YMGA 4GP9A 2LCIA 4TXMA 4CM7A 4JIMA 1VJCA 5DLPA 1OZGA 5A3JA 1GDDA 2P3QA 4X5OA 2CJXA 4EYSA 2F43A 5JMPA 1K9SA 3U1BA 5JMOA 4HATA 2GM4A 2VQ3A 1IRXA 4PC3A 3EBOA 1PUJA 4OBEA 4JOQA 5DIZA 1KFEB 4DQUA 2VDNB 3KUXA 1M2KA 5C1IA 3GZJA 4B7CA 5ITZB 3C6BA 5HRCA 2FZLA 2M6LA 1B9YA 1E9DA 5TDHB 1DRKA 1QP8A 2GD2A 3QVJA 2O23A 4QSHA 4MW0A 4WNAB 1PJBA 3MFQA 3JSAA 3MINA 2R2AA 1E9FA 3FWPA 1FMJA 4A0GA 3INYA 2O7RA 3WLMA 3RS5A 2H1IA 3CGGA 2M32A 4RDCA 4E4RA 4DDUA 4MB6A 2B5WA 4EEZA 3QWIA 4OL0A 4ZYYA 4MTCA 1R12A 3QPBA 3BDAA 1RMTA 2O50A 4NYMR 4YCMA 4RJJA 1WF6A 1S3SA 1XT6A 5KSOA 1LV8A 3AILA 4EPXA 1RAFA 1VECA 3QBTA 1AE1A 5DT2A 2CL6X 4UUAA 2WIFA 1LK5A 4W8GA 3KJIA 3Q5DA 1VLJA 1B41A 4FCTA 1HDXA 4YHHB 5HIJA 3DDZX 3FZQA 3AGQA 1GYRA 2BFAA 2WJYA 4RM3A 4IAOA 3PWTA 4HPWA 1UBFA 4WLNA 3CNEA 1P7YA 4CFZA 3EZ2A 1F14A 4E94A 5AJVB 1WTCA 4C3VA 1AQYA 3CMCO 1F2UA 4FGUA 3GJ7A 1JTEA 4N7JA 1Y5MA 1Y7IA 1YDMA 2CKMA 5C46F 3H9GA 4GXRA 5EMJA 1WCV1 2WF6A 1RE1A 4HDMB 5IUKC 2GPYA 4MO2A 4PAQA 2XDQA 2PK3A 2FN9A 1QCZA 2ZVQX 4EHJA 3K9HA 1JFVA 5LQCA 1JDBB 2F8SA 4UQPA 1KJ8A 1KKLA 4PBZA 3RG2A 3AVOA 1XHEA 1KKUA 1ZGZA 2PIDA 4R05A 3TW6A 3A3PA 2ZSJA 2GZHA 1NFRA 4F7WA 1MOPA 3UUGA 1F6WA 2B0JA 1H2AS 5F1OA 3SBDA 2WD7B 1XCGB 3AUTA 3JQBA 2I4IA 3OIFA 4F86A 1F51E 3ZPXA 1JE0A 4G1EB 1XZAA 1WMSA 3CJQA 1NF9A 3V2HA 1M2OB 2JHAA 3TOCA 5LYJA 1F1BA 2H2AA 2FSPA 5FFOA 3GJXC 4EYEA 4IUBS 2J0VA 5DEIA 1P0QA 2VAXA 1DT3A 1L8LA 1U8AA 1ZGHA 4ESOA 1CZRA 3PUVA 3PE6A 4MA5A 3OKWA 3K31A 2Q2VA 1DSSG 1JMKC 3LP8A 5EHQA 1ZA1A 2GAJA 2WINI 3QXGA 3TPZA 3DC7A 1NXXA 2Q27A 3NALA 2XUQA 4D9JA 3DTNA 1A97A 3FYSA 2W58A 1CR2A 5KTPA 1YR3A 2CF5A 2ZT5A 1E2HA 1KETA 4O4LF 4NBUA 4F3KA 3LDUA 2CGEA 3RN0D 3L92A 1TUGA 4QLOA 2IF0A 1ZG3A 3QTBA 1XLWA 4RV5A 3LGXA 3WX0A 3V55A 4LY0A 2UVPB 4L0QA 1MHPA 1OCEA 1FNMA 2QRMA 3S4YA 5C8YF 4Q48A 1I4LD 4Q39A 1ZXXA 5COAA 2C5GA 4L8VA 3PC6A 3S8MA 4EW3A 4GR4A 1P4GA 4A8JC 3MM4A 3EMDA 4QYIB 3OLQA 3ZDEA 3P1JA 1UIRA 3JQ8B 2AEEA 3I28A 2YXLA 1HORA 4ENWA 1QIKA 3M4XA 1EPUA 1IYZA 2PMWB 1R15A 2Z2KA 4H6PA 4CY5A 5TPZD 5E3JA 3SKXA 3GDHA 1A9XA 5EY5B 1S0UA 1Z6YA 3TFWA 4YUAA 1SVWA 1TTPB 3S44A 1EE9A 3GEGA 4PSWB 3LT2A 5IEJA 4HGNA 2WABA 3OVMA 3MEQA 3LWZA 5HTKA 2G17A 1GV0A 4AVYA 1V3UA 4B3MB 4R9NA 5ER6A 1W88B 3UAZA 3JWGA 3HCWA 2Q5JA 1XKLA 3EDMA 3D9QX 1I9CA 4Q37A 3OEHA 1NTRA 1T4GA 4RANA 3X1YA 1D2GA 4O9DA 1K6EA 3MTBA 2CHEA 3OETA 3COZA 2HU5A 2X9VA 2W8BB 2UXBB 1NMXA 1Q83A 1AIPA 4E11A 5IS2A 1G41A 5J4YA 3I8XA 2AOTB 1DEKA 3O84A 1C0LA 1PFWA 4M8IA 3CRW1 2GPTA 2J7PA 2ZU0C 5IHXA 5KHAA 4S12A 1UFOA 3BVPA 3Q2IA 1H2BA 2DKOA 5IJ8E 3GMTA 1F12A 4ZAYA 3Q12A 3RVQA 2KHZA 1WUKS 3LI2A 5D86A 7AT1A 2FOXA 3HWWA 1DMSA 2G6BA 3IEVA 4JHLA 5HGJA 3E8SA 5KVVA 3JD2A 3RT7A 4R6WA 3CLSD 1W85A 1JEAA 4RD3A 1QS0B 1CQWA 1B9XA 3TAUA 3SIRA 5DYGA 2BGTA 4DV7B 3MJVA 3A11A 2X5NA 3GGSA 4D0GA 4LJLA 3PIDA 4UREA 2Y8EA 5F7XA 1CDOA 1NI4B 1X7DA 3DVQX 2ZM6B 5CVEA 3R44A 4FMBB 2F1OA 5JWZA 3K94A 1RXEA 2IBMA 3AI3A 1T0IA 2HJGA 2IE8A 2QD3A 3GWZA 2DJ5A 1JIUA 2IGTA 1DFGA 2QTZA 2X3UA 3VAAA 2XI4A 2Q4BA 3X43A 3VDMA 4M8NE 3DWIA 2LIPA 2Q3EA 2XLBA 2P5UA 4LYGA 4FX5A 1SU8A 2F64A 4BS9A 3K9FC 4EA6A 3O1HB 3WFIA 1HFEL 4XDYA 2HO5A 1G6Q1 4TTTS 3NHPA 1AHHA 1KFBB 3C1UA 2WF5A 3CXUA 3E2PA 5B30A 3KK0A 3A3OA 4BP8A 1YIDA 2NW6A 4BRSA 2ZE6A 1ENOA 2Y68A 3G82C 4MQMA 3ROKA 1UK7A 3GA7A 4JXXA 1G4AE 1PFVA 3A06A 3LO8A 1YB4A 1J2YA 5ILOA 1GTJ1 2OO5A 3L5KA 5LCXA 1B3BA 3MHPA 1MOQA 5C3UA 1EM8A 4C6TB 4ZO7A 3RLMD 3NI2A 2EFCB 3FCYA 4PYQA 3UBMA 3UQYS 2HQOA 5D3QA 2ZJ0A 1CW2B 1OI7A 2QRVA 4HD8A 2PZAA 3IO3A 4XVQA 2VDLA 1J0AA 4K46A 1M34B 3P2KA 2E1RA 3D1JA 4K9SA 4XWGA 1NUTA 1JB1A 3ESCA 1JKJB 1J56A 2YWHA 1YGPA 5CFNA 5FI5A 5AK0A 5I5JA 5IDWA 1K3TA 4BECA 1ID1A 3GEMA 4OYYA 1ZD2P 5AKGA 2NO6A 3F9RA 1QH8B 5HZHA 2QM0A 3DW1X 5T3UA 1F9EA 2FKAA 3PC7A 3KVRA 4RMNA 3RRXA 5DIFA 3ETEA 1DXHA 4ILKA 1XTSA 2X3FA 2GBGA 5JYDA 4X6YA 2I33A 3PF9A 2ATIA 3U17A 4Q4HA 4D0KA 1L7EA 2ZTUA 2Q6OA 1U7PA 5TGZA 1FRFS 3MJSA 4HRVA 1EIWA 3GJ4A 4BNVA 2C5HA 2BI8A 2ERYA 1UT8A 4JI8B 5B12A 5CCXA 2G9QA 1UINA 1U6KA 3OUTA 3LL4A 4KQ6A 5CBKA 2QAGB 2W11A 4D3XA 1YVRA 3DF9A 1K97A 4H5IA 3MPOA 4D9NA 1BVYF 1Q0RA 5D85A 4MKHA 5TJ9A 2QMHA 2WPNA 3Q10A 4B6FA 5KJ6A 3UAVA 1PYDA 3R76A 4LBZA 1HE5A 1ZK3A 2XB4A 5M61A 5DO9A 3WY9A 5F7OA 4E7OA 3T8YA 4CTJA 1B8VA 4CKEA 4BGIA 2IU6A 2O2JA 3OZ7A 4IHJA 3DFKA 4JLBA 1NI3A 1KAQA 3EEQA 3KPYA 4CIXA 5J3JA 2ZZMA 2VUTA 4K2HA 3P97A 2PUBA 3EAGA 3RHSA 1PWYE 5FA5A 3EZNA 3ABIA 2FWPA 4FYPA 3OJOA 5FUMA 3S2ZA 3K6RA 4BMPB 2YZGA 2NTEA 2NPOA 3HXOA 4MIYA 3Q6MA 2JVKA 4G55A 2OHJA 2Q9BA 4WLFA 4WXRA 3BB4A 2BCJQ 5CLHA 1WUHS 3NIGA 4NQZA 3O8QB 2CYCA 3K2BA 4GI1A 1Y8QB 5I3CA 1Q0LA 3TZ6A 1V48A 1UMCB 5F2NA 3UNXA 3ZGOA 4Q9DA 1SQSA 3YASA 3F0TA 4L8YA 2WMDA 3HI6A 1HKUA 4KLAA 2I3SA 4QPPA 5FTKA 2J9YB 4F91B 1K7EB 1O87A 2ETXA 4BVEA 1WZEA 3AW8A 3GPBA 1W5SA 3I2IA 4N65A 5E6SA 4L4YA 2VTDA 4L4RA 4BO2A 4UMVA 2V6JA 2GJAA 1UM8A 3NWJA 3OT4A 1XLUA 3F90A 4Q00A 1USGA 2CY0A 1P2DA 1K2VN 2RKBA 5EMKA 5TC4A 4DV5B 4FAND 2R97A 4ZN4A 1TDJA 2IYYA 3QWHA 1VPTA 3ZDXA 1Z18A 4Q3KA 2JW5A 5FWYA 2OWDA 3ZHXA 2PLNA 1TM3E 5F98A 2A84A 3LX8A 1X9GA 1T3GA 3LO5A 4TX1A 3IUNA 2VHUA 3MJRA 3ZCTA 3THXB 1GQ2A 2PLWA 2P2LA 4NK4A 4G5YA 5TEVA 4F4IA 3DULA 2IE0A 4FI3F 3RTDA 3GLIB 1N7JA 1ESMA 3R7NA 4MWGA 5HIMA 3QU2A 2H2IA 1VI2A 5DTMA 2E5WA 1U2SA 6LDHA 4TOIA 3KUDA 5BNWA 5CM9C 1LTQA 3T4EA 1M74A 5CA1A 4M55A 3A05A 2G0TA 1HNWB 2IEZA 1TM1E 4ZRNA 2IH5A 1C9JA 4FFPA 1CEEA 1L7OA 4H4DA 5FLXg 4J29A 2WP8J 3FSGA 3AJ8A 4WZAE 3VNBA 5A71A 4LOLA 4TTRA 1CT9A 4CVNA 1HDRA 4DMMA 2GZAA 1ZC3A 1APBA 3A6GA 3I9MA 3PQDA 5DXJA 4TTQA 2ZUVA 3D3NA 4I5GA 1B0PA 1VB3A 1C3OA 1DCMA 3T94A 4DJ5X 2O0MA 4LNHA 1STOA 1E63A 3JYQA 3W8RA 1QYIA 2GETA 1US8A 3I61A 2PYDA 1D5CA 1LSUA 3T35A 1U1FA 1G9XA 1VMIA 4LNAA 2MYTA 1DBVO 2IV7A 1M5TA 1UQTA 2IYVA 2PKQO 1N7IA 4OB7A 2Z9DA 2NSJA 3PRJA 3DNFA 1W48A 4BVGA 4YJKA 1IY8A 1KPGA 1DIHA 4LZJA 3GN2A 3R7BA 2C97A 4XW2A 3WYCA 5GVSA 1LW6E 1NJGA 2V6BA 2VP0A 1MB0A 4D9EA 5FV4A 2VTBB 2Y71A 5EESA 4N47A 2K2QB 2AZXA 2C9BA 2NT4A 1UBGA 1A27A 1R5BA 3MAJA 5ILQA 1PD1A 4HJRA 2AS0A 1D2CA 2OFPA 1KP9A 4ZQEA 1XX6A 1W5EA 4KRFA 4J9VA 2WWWA 3E0QA 1PT7A 3PPXA 4L07A 2VO1A 1TU3A 3QYPA 2NU9B 2XZGA 4CW7A 3NANA 3FNRA 1DAMA 4HNVA 1UCFA 1PR1A 1KYXA 4PZ9A 2NVBA 4C1NA 3ML1A 2P9PC 4CQMB 1UOEA 3T0GA 4MGEA 4DLBA 4Q7KA 5DMXA 3MWFA 4DC9A 2OFFA 5AK6A 4UAJA 1K7SN 3NEJA 2K2WA 4A0AA 3MB8A 3DMHA 1JLLB 3QLVC 2VUHB 4BFUA 3MB5A 4XVHA 4MHTA 3AJ9A 1JQLB 1GGJA 2EQBA 2PL1A 3UANA 1OZ0A 3SVWD 4NPCA 4BLSA 4BNDA 2XF8A 3RHTA 2CUTA 4QGHA 1B3RA 1KAMA 4YJ2F 1POWA 2FSVC 4MQEA 5ESRA 2E4WA 3EI2A 3W34A 3PQ2A 3H1FA 4DDTA 2GN4A 3WYBA 1W9MA 2VHQA 3FW1A 4J0WA 1FYDA 1RWWA 2Y1CA 2I2WA 4OQZA 1CSEE 5BR8B 2DECA 5JS1A 4Y6PA 1GOGA 3ZOKA 3QQPA 3UMGA 1M1ZA 1B76A 1DWQA 2DUWA 2HA5A 3QFTA 5I45A 5I9TA 3I7PA 3DCJA 4YPOA 1K6XA 3HDQA 3CX7A 2AKYA 2NYRA 1I1HA 3LQ1A 2JL1A 3KQHA 4WY5A 3N9IA 1WHTA 5ARDA 1V2GA 4OWRA 4IMIB 2VR1A 4UHJA 4OZUA 4XGNA 4F2GA 1FTQA 5DMHA 2J6BA 4NC4A 4KTTE 5FUBA 3T3MA 4Z0PA 2JRCA 4Y9DA 2XL2A 4UFPA 4JL5A 3GUUA 2HEGA 3PRKE 3HQ4O 2JA1A 4Q82A 2DLDA 3FDIA 4L8WB 2WJ3A 4TSRA 4EYKA 1M1YB 4UM8A 3KSBC 2CSUA 4XX1A 3FYDA 3EGEA 3COVA 3G5MA 1JIIA 3C70A 3KEFA 2N46A 1NXTA 1AA6A 2C4TA 4RPCA 1VL6A 2AN5A 2H00A 4RJKA 2LNDA 4ZA2A 1QRAA 4U9UA 1Y7LA 2I03A 2RHJA 2X8JB 5K8VA 2IXDA 3HFGA 2R00A 2XBLA 3GUCA 1NJ2A 2EFYA 4P3YA 1TIPA 3T7EA 2FFJA 5AT1A 1QH0A 3E61A 2YZMA 3W3AH 4Y6RA 4U00A 1R0BA 4ZICA 5HP4A 1VRWA 1IN7A 5F78A 2DEUA 1I0LA 2XCRB 5DOVA 1JMVA 3EUEA 2ZWVA 1BKYA 4NS4A 5EXTA 5HW0A 3QW4B 5GVRA 4E07A 2X4LA 2Y0CA 3QHYB 3UPDA 4BLUA 1ZD1A 1UMKA 3M1LA 2GAIA 1J24A 1DKNA 4DG9A 4D25A 5JJIA 4BLQA 1QH9A 3SQLA 1P22A 4Y1EA 1HQDA 3JAWA 3PLNA 2IUYA 3I6BA 4E2ZA 1RQPA 1I7NA 1K5DA 3LHSA 1JHOA 3EZ6A 3QVXA 4NMWA 1Y3IA 3BH7A 1ND6A 1RI1A 4R4JA 3L3BA 5JADA 1AKVA 2WP0A 4J75A 1QG4A 2ABWA 2PM6B 2RJ3A 2FEMA 3ETLA 5LA6B 4E46A 5C7IO 3OH8A 4LTMA 4CGZA 1AMNA 3RW9A 1TL7C 4JLUA 2QJTA 3UXEA 2V1UA 5IT9g 4ZYUA 1T9GR 3RROA 5C34B 4ZDJA 4GWLA 3H65A 1JIQA 1U8TA 5AMSA 5CYOA 4LJRA 3DMYA 5HDQA 4ZVVA 2OGSA 1NQ5A 2V96A 2A1TR 2RHRA 4UAVA 1ULSA 4JBGA 3AT1A 1KU6A 3U3RA 1RYDA 4FSDA 1GA4A 4FK8A 5CLLA 1M6VB 3N2KA 4RACA 3IALA 3PEVA 4JL8A 1KNXA 2GRAA 4TS3A 3NASA 1QR2A 4RIEA 4ZTZB 1UDRA 4IIBA 3WQSB 4WZ6A 2X13A 2ID8A 4TKUB 4AG6A 2Q3LA 1MO4A 1PWHA 3G2NA 4TV8F 3RS9A 1DBRA 4E51A 2BTOA 3ZV6A 3MXXA 1OU4A 4OPMA 2TMKA 3NHYA 4I1YA 1U3DA 2FWNA 4JI6B 4ARBA 5A4DA 4LJ9A 1F2TA 4GGDA 3GDWA 3IE0A 2XSZD 1N5JA 4HMPA 2RHLA 4AG5A 3NHUA 2QD1A 3H9QA 3STWA 2ONZA 5JWOA 1G16A 4KMSA 3T06B 3FD8A 4XYHA 3BQ9A 3ZWOA 2FUEA 4W9RA 4J9UE 1BCRA 2HWYA 1L0BA 1HSOA 4R71A 1TIBA 4JKOA 1C9EA 4JP5A 5CH5A 1BZYA 2PN1A 4G0NA 3CFVA 1SWVA 2C2YA 2AH0A 3CUYA 4RVNA 1IZ9A 4Y2QA 4FNMA 4FFNA 3F71A 4D0SA 2QDKA 5JZMA 4H7KA 3O4HA 3B7WA 3VSEA 3SN6A 5TVKA 3RTCA 3T9EA 3N53A 2M6KA 1RXWA 4LXXA 1PWZA 2CK3A 4D9FA 2C0QA 5EP3A 2HWXA 4N0PA 3UPTA 5ES4B 3LYLA 3U7IA 4WKBA 5I4KA 3HA5A 3NM6B 4JGIA 1QTIA 3OE1A 4GQAA 1FDVA 4KAJA 5BMVB 4JELA 1BE0A 4DIKA 4GRDA 1YZUA 2XUDA 2BEUA 2FPPB 1HRKA 2IW1A 4LV8B 1ZNWA 2C9CA 3VYWA 2IOHA 1ZH8A 4HLUC 3K8OE 5LYJF 2EL9A 4PPGA 2O3JA 3N7UA 1T9ZA 5JE8A 5CNMA 5KNDD 1IUKA 1QQ7A 4MEBA 4YT8A 5HILA 4Y5RD 3A6LA 4LQDA 3JWIA 4G0QA 4LFCB 5EJ4A 2B8JA 1VL0A 4FGLA 4MB2A 4MICA 3WBJA 1PSDA 1R0LA 4M0UA 3K1JA 1XCBA 3ZTYA 3WXBA 3H04A 4LYHA 2PNJA 5LQJA 1XTPA 1XFAA 3A3NA 4B71A 4U6NA 4NZNA 3BWDD 3AEZA 5BWBA 2IYFA 4A0SA 1W36D 1ZAYA 4YLGA 1DWPA 2HRZA 3WWOA 4QLBA 4MS3B 4GW3A 2O2HA 3UAWA 2P3SA 3I7OA 5EG5A 4AYXA 3PXSD 3KYDA 2XWJI 4EUKA 1BS2A 4RKFA 2WUWE 5HIKA 1ZL0A 5LOVF 1Q7BA 2BR3A 4BXOB 4RMHA 2P67A 2IWKA 3DS8A 3E9YA 3IEXA 2PS1A 5LZ8A 1I24A 4KQWA 4TTVA 3V7YA 2ZRGA 3WFJA 3OX4A 2AUNA 1K7XB 1XDZA 3LPCA 4JJ8A 3RASA 4DUZB 2C5SA 2C4NA 2FWRA 3FRIA 1QBKC 4IH9A 4P58A 3WK8A 4HYQA 3DWGA 1PNOA 1VGQA 2P9EA 2ZTLA 3R24A 4IIEA 4AMYA 2UZ4A 3S7ZA 2ZJBA 1YCGA 3TQQA 2BWJA 1RWMA 4ZU1X 4J76A 4ZEWA 1LFAA 2R6ZA 2NQ2C 4LHSA 2WSSD 5HJ2A 2QKYA 2NVUB 3BEDA 1LQUA 1E20A 1BE6A 1JIJA 5AJUA 1VJ5A 2XCLA 1XTTA 1QC5B 4L15A 1W5BA 3PVZA 3L18A 4EMSA 4UEOA 3IB3A 1FJGB 2FQQA 3ZE0B 1EUCA 3DEHA 3JVEA 2FRVA 3A0UA 3PSAA 4QECA 2EAUA 2ZWPA 2X9NA 4D7AA 3SFZA 1MCZA 2Z83A 4CQLA 4ZP1A 3V1UA 2YMPA 3QHAA 4X20A 2WB4A 1TTQB 1MRZA 1CULC 1SG9A 4NMMA 2VLIA 4YRTA 3JYHA 2EGGA 2QRLA 4YQZA 1GWNA 1JLSA 3HXTA 4IDQA 1M1NA 5FPKA 4G67A 4MK4A 4YRBA 5LJIA 2VNHA 4X60A 1IIRA 4DMUB 3KZ1E 2HO4A 3MN1A 1GTMA 2Y3IA 2WU4A 1QNLA 5JPCA 4N9QA 1PQUA 4IXWA 4TZ0A 2ZVPX 1HA3A 4HLQB 1QZ3A 2X77A 2BDEA 4RK5A 1YJ8A 1R4MB 1NUUA 4JI0B 2O3RA 3KBOA 2F9LA 3T5PA 2GZRA 4AULA 3LW8A 4MQBA 2OG2A 1BTOA 1JQAA 3B3FA 4LDRA 1YL5A 5M5RA 3A6HA 4C7XA 5JT1A 3PUIA 1TA9A 4MRSA 5GJVC 2BGRA 3G2IA 5K3OA 1YTLA 3JR7A 4WFJA 1Y6QA 2NTJA 4HNSA 3JVVA 3CRNA 2H5IA 4JMPA 3M0EA 5I9IA 2H16A 5FA6A 5TGTA 1DE0A 5SY4A 4FDLA 4WINA 4BB6A 2QRNA 3ISJA 5KYTA 1SUSA 1OPRA 1TNDA 1ULAA 3C8MA 1O6ZA 1Z2PX 4Q9JA 3ZIUA 4I5EA 4BATA 3WB1A 4F1JA 4HNUA 3CX8A 5IX8A 3A6EA 2IWRA 1OLZA 4EA8A 1YJAA 2PQ2A 1AQIA 4B34A 4U7TB 2YH2A 2ZDHA 1AH2A 1H22A 1EFCA 3ZUGA 3AWDA 2FN8A 1LK0A 3GUYA 1Z6PA 4OXNA 2Z4SA 2OYRA 3PCTA 2HUPA 2YMMA 2EBHX 1P6UA 1M0TA 4AI6A 4DMGA 1KGDA 2IPAB 3ZNQA 4BWVA 4H6XA 1Z6AA 1UDCA 3LQ2A 5H68A 1XZKA 2QJWA 1ECGA 2PTHA 3TQSA 2W98A 2IW3A 1MBZA 2EFEB 4QDTA 2C4HA 5F23A 2X0JA 1UKVY 1DKOA 4FFBA 2G1UA 1FS5A 3BJEA 4LCEA 2WICA 4KUHA 2GRJA 4QNMA 2FW9A 3DHEA 3MTEA 3ZU6A 1UJ6A 1L8QA 3X3HA 1N6EA 5B64A 1NATA 1KY2A 2JAUA 1Z0ZA 3LHKA 3VPSA 3NVQA 3UTCA 1V8ZA 1DBWA 3EMVA 3RS7A 2F00A 1KOLA 2DKNA 3STHA 6ADHA 5L3SA 1Q2UA 5F1YA 5BSRA 3SJUA 2H17A 4TLMB 1J1ZA 3PIIA 1X7ZB 721PA 3B70A 4OF4A 4CDRA 1I2MB 4KFSA 2HBQA 4CI3A 5ELMA 5DYNA 3GFFA 2CN1A 2VPWA 4E5YA 2QBYB 3EZLA 5FTNA 1LLQA 3CUTA 2WUGA 3V4PA 1X7XB 1EBBA 4H7JA 1C2YA 4JEMA 4D45A 4W1QA 1U0HC 4PC2A 2OA0A 4ZODA 3SZRA 1VLZA 4O02A 3AQ4A 2RGDA 5SYAA 5C4IA 1XWIA 4S1OA 5BV7A 2A9FA 3WV5A 1R0SA 4NENB 1ML4A 4AMGA 4YCCA 2RD2A 3E9DA 3GLTA 1PK8A 4CN9A 3FOCA 2P4UA 4Q3OA 5PNTA 3L82B 3NIFB 2VDWA 1YDFA 4HUQB 5FUVA 3ULKA 5J59A 2GH1A 1RNLA 3B5JA 1B74A 3WWDA 3RWOA 4FKMA 4QGAA 2Z5GA 4EBBA 3KJHA 1KO5A 4WQMA 1PLJA 2OKGA 2OM6A 3WNVA 3BQNB 5D1HA 1JKXA 1KI6A 2RBGA 3DDNA 3RYFA 2X8WA 5B1EA 4KQMA 5A7GA 5BVHA 3PBKA 4DLLA 2YFYA 2O8VA 2ZJFA 4PICA 3KQTA 1PX2A 4F1WA 1C9DB 1TLTA 3U26A 3W6ZA 2VUUA 4KR9A 1ORRA 4TUYB 4KQJA 4E5ZA 3GAFA 5ITSA 2FWMX 3Q72A 4E5KA 2YV3A 4XFDA 4F3TA 2H1FA 4A03A 2Q4EA 2O7SA 2AGZA 4TMWA 3GHHA 3K1AA 3IOYA 5C7YA 1OXTA 1E9AA 2ZSAA 1ZMXA 2WC1A 3KWMA 3DBLA 2HFKA 3F46A 4OV6B 1XRQA 2NXNA 2NXWA 3RGGA 5BXYA 4HWTA 3F4LA 2Y05A 2FEPA 1U0SY 1BXRA 3OM0A 4FC7A 3NXSA 3BCHA 4YH1A 2IOFK 3HCAA 3TEJA 2XWBF 1SHYB 2NSLA 5EHNA 4DB4A 1V6SA 1MV5A 4CQNA 4EYOA 1G63A 1T8PA 2XAUA 3ZCQA 2P30A 4A26A 2YX1A 4G5HA 3CONA 4DR6B 4L50A 4WK4B 4MJ7A 2LPMA 2Z58A 1SU6A 4DDKA 1R50A 2G99A 1I8TA 4PNEA 2AOUA 3MJCA 5F33A 2IZZA 1L6IA 4PQGA 4YUWA 5CA0F 4Q3DA 5J2UF 4A2LA 4K6GA 1QRDA 2JKVA 1P81A 2A58A 2QMUA 1OR8A 1E5LA 4QDXA 5TS3A 3I2GA 3AKDA 2PEZA 4Z7JA 4A82A 1AKWA 5AVXA 3JYNA 4UPVA 3I7NA 3D5EA 5E9QA 1KEEA 2BV3A 1NM5A 5FPYA 4JYMA 4MGZR 2BMAA 4UNNA 1Y33E 3VI4A 3LUHA 4M9UA 1A5TA 4LWZA 3M6LA 1DIRA 4RZ2A 2ZJOA 1BXZA 3SCZA 3PITA 3GFTA 2Q4TA 2BEKA 4UOQA 2APJA 4I4TB 5D5PA 1HYGA 1Z22A 4RFLA 5IVIA 3ITEA 1QIMA 1YNOA 2PRZA 4RFSB 1ZJ6A 3PTLA 1V26A 3J80A 1H4TA 3UH1A 3V8EA 4R51A 3KSDO 1M54A 2PWBA 2EBUA 1KMCA 3U7JA 4H9GA 3EG6A 5BO5A 2H63A 4DT1A 2YJ6A 3KTAB 4P0TA 2VYVA 2XB2A 1JLKA 4TTIA 3P7MA 2PT7A 3OL2B 3G88A 4B3XA 1TZMA 3P0HA 1NP3A 2J0SA 3B9QA 5EAMA 3Q9SA 1V35A 4EZIA 3HU2A 1VDZA 3ZVKA 1BHSA 3IAUA 4RVCA 2C82A 1ZGGA 4WK6A 5L3QA 1U65A 4FCWA 2VIIA 4MR9B 3UJCA 1GSOA 2CLCX 5I9LA 3DHYA 2OV3A 2MHCA 4M22A 5ES3A 1U2TA 5HQTA 3QIAA 4XQCA 4OQMA 1RZ3A 1YRWA 4HZUA 3IULA 4I46A 3NQ41 4Q19A 3AZQA 4RW0A 5LB2A 2JGRA 2FCAA 4NL4H 5KTOA 4HDOB 3JZAA 3EARA 3GEIA 1DNPA 2V3CC 5J9FA 3BH6A 5ULLA 3GYBA 3W4KA 1CC1S 5CYKA 4JKIA 1X1TA 4EENA 1X7WB 3CKKA 1F4PA 2OP1A 1RHQA 4CL0A 3EQ2A 3K8QA 2AQIA 2GNPA 1Y4SA 2IXBA 2QN1A 3ETGA 3LTNC 1KU0A 2GD6A 1ZMRA 1OYWA 2C57A 3AEYA 4CNBA 2FK8A 1PUXA 3DXMC 3C6XA 2P91A 1ZJZA 1KDVA 3IEKA 3FLBA 1RXVA 1XTUA 5U9CA 4DNXA 5BRAA 3MAGA 3N3BC 5DLDA 1X8XA 3OF5A 3P9YA 4Q3AA 2R4TA 1BXGA 2CNKA 3DBVO 1N33B 1OAAA 2C2XA 4O2BA 4MUMA 3PGLA 3NC0C 4G1BA 2H65A 2DHEA 3CR7A 3R6WA 5KYWA 1CJKC 1GD1O 4GPIB 2A9RA 3NVDA 4OH7A 5CK4A 2A5GA 3EPJA 1ADYA 3OIVA 2BF7A 1FQJA 1PBYB 5BV2P 2AMJA 1L7MA 4JBIA 3HRHA 2HU8A 3L01A 2R44A 4RHYA 4L9OA 2FA9A 4N0MA 1SC3A 4DLNA 2RGGA 1UP6A 4TL9A 4FYKA 5LQNA 1I1QB 3UA4A 2ZSHA 3L7MA 3Q7EA 2BGNA 2K5UA 2RGNC 4M87A 5F9MA 1I1NA 2PAFA 1FDIA 3G9ZA 3JAKB 1MGPA 3A4YA 1GAJA 3T1YB 1C1HA 4YHBA 3E70C 1NMEA 2MYNA 5DN6A 2O2YA 3BL6A 2YBDA 4P38A 3BXPA 1NVTA 2EW2A 5C9ZA 3EGIA 3V6MA 2V9CA 4YASA 3S2UA 3VNUA 1V1MB 2ZIEA 2FFAA 3F6RA 1YB6A 1JDJA 4Z3KA 1A0RB 2R2GA 3FNFA 3O94A 3M89A 5J47A 1GPYA 1AZTA 2C2HA 1G6KA 1W4ZA 1M8GA 4R2MA 1OBHA 5EPUA 3GFCA 3E4CA 3OZSA 4DDHA 1BE8A 5FTJA 2DF8A 3UENA 3CNNA 1PFGA 3CEHA 3DOJA 4JXZA 1E5QA 4MPPA 3VM6A 3P9PA 1YZGA 2ZP1A 1MC8A 2NMVA 2MT9A 2P9FA 5HZKA 3GRRA 4LF4B 3TTYA 1ZS9A 5E8RA 2D74A 2QGFA 3H5AA 4K3UA 3PRHA 1A9SA 4J7UA 1IPHA 2UUAB 1EESA 1KVUA 2IU4A 2VYVD 4R16A 4PHHA 2KB0A 3FCSB 3K6SA 4FILA 1X42A 4N48A 1H6DA 1QF9A 3OKYB 3W79A 4D96A 2XMRA 3ZE2B 4S1NA 3DE7X 2D5AA 5EXDA 1YZNA 1NF8A 3QELA 2ZI9A 3DDSA 1TTTA 2KI5A 1YE8A 2J3DA 2AYXA 1AV6A 2QX7A 5LBTA 4YAIA 3ZE1B 5I4CA 2GX6A 2C8JA 3H86A 5B37A 4BP1A 3C8ZA 5T5QA 1Y4UA 1S8FA 5CLGA 4D79A 2DH6A 2IHKA 2P69A 3DNMA 1QGYA 2CBGA 1E4EA 1F7VA 2H29A 3TFOA 4OP1A 1DC3A 3F6YA 3QX3A 4C7BA 5KCMA 3UAOA 2ZYSA 2GRUA 4L9SA 1ELOA 1O1YA 4XCQA 3E53A 3EIUA 3TIFA 2DPXA 1R0RE 1KWKA 2UYCA 3KQMA 2VPQA 4NBMA 4RMIA 1JIXA 2KE5A 5LXTB 1DBSA 4GOJA 2H92A 3DG9A 2AK2A 4A8JA 4W8OA 3MK31 1T43A 4Z4IA 2G6TA 3A4LA 1Z2OX 2B7BA 3C45A 2FZVA 1DHRA 3PQ6A 1BN6A 3TOXA 1BPOA 2Q5HA 4DIFA 2WTMA 4ZV9A 1N5LA 2XY4A 4L22A 1CIJA 4DBLE 5CYPA 2ZIXA 5JSZA 3VFDA 4X0EA 2N1MA 4FFDA 4NZ9A 5D1NA 5EE0A 4X63A 3WWYA 1Z6GA 1J5PA 3STVA 2ISCA 2Y0PA 2BHTA 1L5ZA 1X86B 4YONB 3CPJB 1AK9A 2UVQA 2RGRA 4MWEA 1P5RA 4E5PA 4ER3A 4DNUA 5H9WA 1E6CA 5BT8A 3S2EA 3WE7A 1L4GA 2Z04A 4X71A 3RFHA 1GA1A 3K2QA 5K3FB 3EQ9A 1NW4A 4YQFA 1PG0A 3A6PC 5EYPA 6NULA 2CFOA 3OPYA 3SWWA 2FP4B 3WDLA 4CV2A 4NXMB 2J0EA 2H9PA 1VL8A 4E09A 4D42A 3WGMA 5DLEA 5I7VA 3T7KA 3OT1B 1N5OX 3D5TA 4GRAA 4OGLA 4ZYZA 1Y80A 3P32A 2ZWMA 3RC2A 3K2IA 2GAAA 1N2ZA 1U5BA 4ZQGA 4AJ2A 3JATA 4IDBA 4O2AA 4O4HA 1Q16A 2P2GA 4D3YA 1AJEA 5BV0A 4XM1A 1EQUA 1GKIA 5K3EA 2VHCA 3OM9A 2YHIA 4HEA1 3S8YA 1RT9A 1QHGA 3HCCA 1L7VC 2G80A 2ZI3A 3K53A 4H31A 1TW3A 5IJWA 3H4MA 4B5LA 3O3OB 4KYUA 4ALNA 2J6CA 1XVUA 4EPRA 3CURA 5I48A 1G55A 1FTWA 2FP3A 4RABA 3EQ7A 1LX7A 2OE2A 1OTYA 3LQ4A 1UZAA 4F4UA 1G9SA 4CM4A 2NV2B 1MT3A 3AH8A 1VI6A 3QVVA 4KDCA 2P2YA 1I6LA 4ALKA 1JZTA 5CM8B 4ZKEA 1W25A 2J9FA 3FSRA 4C0AC 4P4SA 2GM9A 3U3DA 5EN4A 4TZ6A 1EFVB 3HO6A 1LWOA 2VZ8A 1CQIB 4PBRA 3FM0A 3PUWA 1EP9A 1T5IA 1DL5A 2PM7B 1PR3A 1DBPA 5G53C 3FLEA 3MGBA 2WE8A 2G0AA 4DLXA 1JA1A 4ID3A 4E3ZA 4WNYA 3J81g 2GZMA 4AJ4A 4TSKA 3S0JA 5KQMA 3EGXB 2VF4X 3CT4A 4IH4A 3KOUA 2G07A 3UJ3X 4QREA 3OEHD 1IH8A 1EK5A 2GYWA 3AIKA 4LWQA 3EOBI 3R0IA 1CY4A 1E5DA 4UZFA 5F4ZA 3H5LA 2V6FA 1L7NA 5HQ3B 2FPKA 1O58A 5G1PA 1WWKA 1OX6A 2PSEA 1SKAA 2AZMA 2J7PD 3B9PA 2Y1GA 4GPZA 2P0YA 2DLNA 1SVLA 1TZCA 1S2LA 1SQGA 3IC5A 3CNLA 5JW6A 1DBQA 4ZCIA 5M5TA 2OBBA 2HXCA 2BTEA 3AZOA 1QVVA 4ZVOA 2A33A 1U8YA 3FPCA 4BB9A 2DH5A 1EJ0A 4YI3A 2DQSA 5K45A 2ZRKA 1P0PA 2JCXA 1F60A 5ISMA 1LBTA 3QE4A 1JJVA 5EKSA 1DO8A 1FQKA 5AW3A 4NKRA 1EX7A 3DMFA 3GW8A 1XTIA 1T8WA 1U11A 4P4NA 3G5AA 4YCBA 1DGQA 1JEEA 2EKZA 3BKXA 4I4IA 5ALEA 3TDKA 1SY7A 3R8CA 1DIAA 3P8ZA 3WK5A 2IQIA 5M5BA 4PCUA 4JAVC 2GGSA 4KITB 1JFRA 3H1EA 5HF8A 1P0CA 4W7SA 1CZLA 4P4GA 1OFUA 3D3EA 2QE7A 4CL3A 3TVTA 4ROSA 3ZXIA 1OKKA 2XE8A 3RDPA 1O95C 4OJNA 4QFMA 3C6YA 4HVLA 2IT1A 1L5OA 3UJNA 4KQKA 2QD2A 4JT6C 3IFSA 2A0UA 4MWSA 3N8IA 4LXYA 4CN8A 4N8DA 4DXAA 3T12A 1Q0HA 3LZDA 2WTBA 1TO1E 5AKYA 4H3KB 1JEQB 3WL5A 3JVDA 2P6RA 3GRVA 2O48X 1WIWA 2UYOA 5MN6A 4QGSA 1RI6A 1SIBE 3A6FA 1QK4A 1L5GB 3SIPA 4DCPA 4FHLA 4OQPA 1R74A 2GILA 4EGQA 5IXYA 2OLKA 1P5ZB 3LCUA 2I3ZA 1CUEA 4JMLA 5KBYA 3ZDCA 5K0CA 1JVNA 4WUVA 4BLWA 4B3JA 1QIDA 4MK0B 3KR1A 4REMA 3AVUA 3AU8A 4PG6A 3DPIA 1O08A 1V4BA 5KQSA 1V3VA 3WMWA 4NLLA 1D7OA 1SHTX 2C9DA 4CL2A 2QRQA 5GTDA 3C8HA 2ZB3A 4MW7A 3EJ6A 4XVCA 1UM9B 1GPJA 3V7WA 2VF5X 2ZIVB 3HUEA 3FBWA 3SNKA 3IHTA 1R3DA 3DVAB 3CF2A 2QQEA 2IYOA 2XWSA 5CK5A 1B16A 3DT8A 1E6MA 1O97C 3HO1A 1H2FA 3OE5A 4P08A 4LECA 2XBMA 1V8BA 2JH9A 2NTNA 2DR2A 3DC2A 1ZGAA 1I0ZA 4QWMA 1P9WA 5BYJA 5DKFA 1H23A 2ZRPA 3RC3A 4B3TB 4Y7RA 2NVWA 4B7ZA 1FP4A 5I7WA 2WYVA 3AHCA 4QGGA 4E5NA 3WBBA 4GKVA 3KR9A 1G38A 1R66A 5ALMA 2Q3DA 1R3UA 3PJFA 4EO9A 1NP7A 3QWAA 5ALIA 1G21A 4RCZA 3CCBA 4ITVA 1FTSA 4GI3A 3N2NA 4IRXA 3EXFA 4CDMA 1U8CB 3DT6A 5EIWA 4A1FA 2R1VB 1Z4KA 4D4KA 3BHNA 4HLDA 3OPQA 1YZYA 3IIEA 4OXKA 4U6QA 3ELUA 1RHMA 2ZR0A 2C99A 5H3LA 2P2CA 4ZC8A 1XALA 3L0BA 5IDVA 2XOEA 3LIPA 5GGYA 2J5KA 3ACBA 4IGEA 3W5DA 4TVOA 1N0WA 1PK7A 4MIEA 2AJBA 1XDUA 4D3ZA 1KSFX 2COKA 5CDSA 2WR8A 3N2EA 5E2BA 3I72A 1E3SA 1MPTA 3PV0A 3L1KA 3ZDQA 4L4SA 3ZNNA 3R7WB 3WHPA 1GQYA 4A16A 4MX8A 1W9HA 5GP1A 1P6QA 3B89A 5AOAA 5KX5A 1JT2A 2AYYA 2XCOA 2JVIA 2CO0C 4ZZ2A 3LX4A 3EGCA 2ZAIA 4COKA 4ZI7F 1V1JA 2ZK7A 4S2EA 5EHIA 1KY3A 5JAUA 2GT1A 4XWKA 4DZTA 1SOWA 3DV0B 3ROMA 3WV4A 4EPWA 2NADA 2ZYVX 3FPKA 1UBLS 1QU2A 1FUUA 3NX4A 4NYMQ 2CT8A 1MPXA 4YV0A 5IUJC 1RJWA 4PXAA 8GPBA 5I01A 1V5FA 3O1LA 2ZYIA 4RBNA 1C1XA 5AXBA 2H6NA 3HG7A 4Y9UA 2I3AA 5E7JA 1QZXA 2HF8A 1AHPA 4BDSA 1VG9B 4UHDA 4XWAA 1CUDA 3GMSA 3AF3A 2JHPA 4RLFA 3PNQA 4X84A 2FX2A 3U7QA 2I4MA 4JUAA 1NSYA 4Q1BA 4QBFA 2ZTVA 5IDXA 3K9BA 3FMVA 1OKKD 4LX8A 1TO2E 1Q74A 4KO1S 4R1SA 2XDAA 4OGGA 2YY5A 5I8WA 1QV6A 5K4AA 1IU9A 2JJQA 3M82A 3K8ZA 3G8AA 4ME6A 2OLJA 1NKSA 2ZQZA 3DPUA 5L6MB 4INJA 1DQYA 4CM9A 2Q5CA 3GZNA 1J1IA 2OXRA 3EW7A 5JJLA 3T3HA 3CVJA 4L3OA 4UE6A 3WO1A 4KQ2A 4GM0A 2D3TA 1HYHA 1J21A 1NRIA 1SUAA 3C9CA 1G20A 2WK1A 4B4UA 1MOSA 1ZD8A 3MWYW 4ZQBA 3LPLA 5AWFC 5CBPA 4LYAA 3GRUA 1MW8X 3TH5A 2Y2VA 5FQOA 3T5TA 2IX9A 4ZAXA 3FDFA 3WLSA 2JARA 4CLDA 1IEQA 1VGVA 2PBFA 2XNKA 3RO7A 3PJDA 1REQA 1WU7A 3T5CA 4QEDA 1QQAA 1JAHA 2ASVA 2HJBA 4AJNA 4ZPXA 4W1PA 1Y1RA 1SULA 4KWTA 5IH3A 4NTZA 3BREA 4N6NA 1H8EA 4BBAA 1W1IA 3UHOA 1DO2A 2DUJA 2PM9B 3COYA 1VYTA 2WHYA 1V7QA 3KJEA 3NDBB 4MYUA 1V7CA 1EQAA 4HS4A 1XZJA 3C8DA 3LDFA 3Q0TA 4ZEMA 2WNSA 4DCCA 3LLMA 3QVLA 1WQ3A 4XYGA 4M1EA 3QE9Y 3REQB 5TS2A 2VXBA 4RNDB 1JEYA 3D5QA 2XVZA 3CVVA 4D82A 4RVSA 5DW0A 2G9VA 3BX1A 4K1XA 4O1HA 3CN7A 3HDHA 2J5QA 1XU4A 5AOCA 1XZMA 3SDZA 2XCSB 4QQNA 4M1OA 4CKWA 3JD3A 1S1MA 5CW1A 3ZY3A 4D41A 4HNGA 2YC4C 1YWGO 4DNPA 2AX4A 3S7TA 4CM6A 2J0UA 5CLIA 1IVNA 2B8NA 2IQ5A 4IV8A 3FSGD 4D9KA 2YWRA 4ONEA 1PEKE 3QLVA 4DQLA 2H9IA 4DTIA 3H1TA 3FAKA 5ALDA 4BNJA 2A88A 2OVRB 2PXXA 5LZ4A 1IZYA 1NN1A 3H83A 3KQOA 1QCCA 5DN9A 4OEHA 4I1IA 1JU4A 4E70A 4EX6A 2UZXB 4TMXA 2FSVA 2JBAB 3LPDA 1XHMA 1NNI1 1VKRA 5C5EA 3HXPA 3X2SA 3HL4A 5JJKA 1XD8A 3R41A 5AD1A 3CM0A 2DWCA 3K2EA 4LMRA 5IAOA 3DE5X 5JXJA 4YCJA 2GYYA 5EIXA 5L3RA 3HMKA 1YFQA 3DBRB 3S55A 3MGKA 4H27A 1GTG1 1ZOOA 3D6HA 2C3YA 3SM9A 4Y18A 1ZH2A 1W75A 4J0GA 4N5HX 3PCRB 4MR8B 4NWIA 5IW8A 1SM4A 3L8MA 5JOQA 2XF2A 4F60A 3NYIA 5CH3A 1TQ6A 1KERA 2I0FA 1T34A 3EIEA 3RG8A 2C2GA 5DBIA 3I5AA 2QTGA 3W1VA 5GV7A 3P9IA 3D3JA 3D8UA 3ZV4A 3NYQA 1EAMA 3ND7A 3I6YA 3VHRA 5C80A 4P3KA 2VQFB 4UCQA 5DHFA 4ZEOA 2CNNA 1X0XA 4CF6A 2R7MA 1CG6A 3SC2A 2WT8A 4F5EA 4CV0A 4KOEC 2BCGY 3WLPA 4CM1A 1GZ4A 4RZIA 4BAGA 2ECFA 3QEBZ 3UT6A 2G9RA 3W7BA 3PR2B 2FDRA 3SFTA 2QXTA 4HAIA 3KYCA 4AS2A 3V4VA 1EJ6A 4FCVA 1BVRA 5T8KC 1CF2O 4DLAA 2HT6A 3BILA 4MAFA 2I3TA 1RAGA 1SB9A 2NZXA 4Q5IA 4R8KA 4DWWA 2Q5IA 1Q44A 1YZQA 3GGCA 3OZDA 1PGQA 5KYYB 1L5YA 2IHBA<