3IUJA

Appep_wt2 opened state
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
684
structure length
670
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Prolyl endopeptidase
publication title Induced-fit mechanism for prolyl endopeptidase
pubmed doi rcsb
source organism Aeromonas punctata
total genus 200
structure length 670
sequence length 684
ec nomenclature
pdb deposition date 2009-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3iujA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iujA01
4BCBA 3UUFA 5H3HA 5YASA 4X94A 4CCYB 4D9JA 3V1LA 1F0NA 4EUSA 5CRIA 1LPOA 3DQZA 2ORYA 1ZGCA 3AZOA 2Y6UA 3SK0A 2JGIA 5ALKA 1EB8A 3BWXA 1ZD3A 1GPLA 5K3FB 4XVCA 3PICA 3EBLA 2PSDA 3GBSA 2DQYA 2OXEA 1GPNA 2XQKA 1ODCA 5T4BA 1YR2A 4NVRA 1Z68A 4B0PA 1YB6A 1VXOA 3G0BA 2V97A 4MEBA 3T52A 3HZOA 1LZLA 4C89A 2WIGA 3WK6A 1IZ7A 1QIJA 5FPPA 3OC0A 4DGQA 5FP0A 2ZJ7A 3V1NA 1LNSA 5LZ7A 1TCCA 2Z8XA 3STUA 2PKYX 5ALDA 5JZSA 4ZV7A 4KE8A 1MT3A 2VQ6A 2GBGA 4J3JA 3I2HA 5KREA 1X2BA 3ZPXA 2G5TA 3N0TA 4G1FA 1PJAA 2XLBA 3DKRA 3O4IA 4KE6A 4MJ3A 4Y2QA 4K2AA 5ALZA 4X92A 1UXOA 3EQ8A 4X00A 3FWHA 1QIHA 1XZAA 3KWFA 3WK4A 3M82A 5AKGA 2XMBA 1J2EA 1FFBA 4UBIA 4AQDA 3FYUC 3STWA 1KU0A 4BAGA 3GROA 1XQXA 5D7BA 3I28A 2GBIA 1J06A 1SC9A 2WILA 5FKJA 4DMCA 4DSAA 3QYJA 3FVRA 1LBTA 4Y2PA 5DJ5A 1HBJA 3W05A 5AK3A 3C6ZA 3R3YA 1F6WA 4DSZA 4K6HA 5ALYA 4N5IX 4EZIA 5IVHA 3ZV7A 4WFKA 5AI9A 1H2YA 4KE9A 1BROA 1X70A 5A62A 2OAEA 2J4FA 3QPCA 3ESCA 3NOXA 5ALHA 3CCBA 2WFMA 2QXUA 2XUAA 5EIHA 2PX6A 1UKBA 5FPQA 2HRQA 1KEZA 2GZRA 1H22A 4HVTA 5E4YA 3FCYA 4CI9A 3G0DA 5CH3A 2WU3A 1X2EA 2VF2A 4LXIA 1XQYA 1Q84A 2O2GA 4CCYA 4DMHA 4W1PA 1F8UA 5KWJA 5AKIA 3ICVA 1ORWA 3C5WP 2OAGA 5JYCA 4UHDA 3VXKA 5FV4A 2J3QA 3O0DA 5CT6A 3AZQA 5A7GA 4B82A 4GWLA 1QIFA 3FLAA 4RNCA 5IVKA 4EY8A 1XRQA 1WOMA 1FJ2A 1GGVA 3FNBA 5ALMA 3BF7A 1AQLA 1UT6A 3C8HA 3R40A 1GXSA 3K9BA 4HXFB 4U2EA 1ODTC 3AJAA 1P0MA 1VXRA 5AP9A 1L7QA 1AURA 1WPRA 3VISA 2VT6A 4CG1A 2WIKA 5HF9A 4N8SA 5JD4A 4TGLA 4Q3OA 4B81A 4UHBA 3SX4A 3OPMA 4L72A 1QO9A 3WZMA 1W52X 1UFOA 4LYEA 5DNWA 1HPLA 4X97A 2QS9A 2GBCA 1WHTA 1EVQA 4Y2RA 1WB5A 3W9BA 4FMPA 2DFPA 2B20A 4QDZA 2ONCA 1XLUA 5FOQA 2WUEA 3I1YA 3H2HA 3WWOA 4N8EA 5HKAA 5AOCA 3WQHA 5LZ4A 4L3WA 1BRTA 4UHEA 1KU6A 4ITVA 3TGLA 4HTAA 1QIIA 5LZ9A 5HF5A 3FCXA 4B7ZA 5JAOA 1JT2A 1G5FA 1XZDA 3EF3A 2XMZA 5CT5A 3S2ZA 2C0QA 3WKBA 1L7RA 2WG2A 3MUNA 2CBGA 1Y7HA 3DKKA 5HKBA 2PPLA 5EIAA 3M81A 3MUOA 2HHAA 5E4JA 2PL5A 2VATA 3ZI7A 2QTBA 3RK4A 4MEAA 2LIPA 3G0IA 3EIOA 4EY7A 4LYDA 1VZ3A 4BP8A 1HL7A 4FHZA 2HU8A 1G4HA 4AZ3A 2QMQA 3RKSA 3I6MA 5AM3A 2XUPA 5ISMA 1LPMA 2HA7A 2RIPA 4J0KA 4Y2TA 2C4HA 3D2AA 2P8SA 2HRRA 1AKNA 3WYNA 1VE6A 2BAGA 1CUGA 1DWPA 3B12A 4G9GA 4G8BA 3U0VA 2PUHA 4IH1A 5DTIA 3GUUA 1EVEA 1ZD5A 5AOAA 5C8XA 4K6GA 2JGLA 2XQGA 1SFRA 2OPHA 4FTWA 5SYMA 4KEAA 5I7UA 5HK9A 2QUBA 5A6VA 4G5XA 2BGRA 4IHAA 1MAAA 1R3DA 1CPYA 4M0FA 1EA5A 1THTA 3F98A 2JEYA 1LPAB 5F4ZA 7YASA 2OLEA 3ANSA 1EX9A 5T4FA 2CB9A 2H1IA 1NU8A 2HFJA 4YK7A 3W9UA 1QO7A 3NWOA 3DL7A 5K3DA 2IIVA 1MNQA 4OB7A 2WKWA 1K6EA 4RE5A 2WUDA 4H7FA 2XMSA 4FOLA 2WFLA 1THGA 2WIFA 1EK2A 4DYHA 4DLNA 3BDVA 4QEKA 4N5HX 2XUQA 3PF9A 1CIJA 1MTZA 4P9NA 3FYTA 5A2GA 5DTJA 1CUIA 2EDCA 4U2CA 3G0CA 4WCVA 3FYUB 2QR5A 1YASA 2R8BA 3H2IA 1IUPA 2OQVA 1MX1A 4W1SA 1EDEA 3IVMA 3ZWQA 4RGYA 5IVDA 1R1DA 5JD5A 2RI6A 5JASA 4E15A 4QZVA 1DWOA 4A23A 1O6GA 5CXXA 3WWPA 4OSEA 1EB9A 1TIBA 2XI4A 3VVLA 3IUJA 2AXEA 4RPCA 3CXUA 5C81A 2O7RA 3GZJA 3R3ZA 3W04A 3DJYA 2K2QB 1JMKC 3WK5A 5LZ8A 3V1KA 4YX9A 2GYUA 1CUUA 1HQDA 4E11A 3WL7A 4DMKA 4WFJA 5K3EA 1T2NA 4AX4A 4P08A 2XDWA 5A71A 5LKRA 4J7AA 2VJCA 1ZI9A 2FX5A 4Y2YA 3HYSA 4GXNA 2DSNA 3A2LA 4WDQA 5D3ZA 4C87A 2O7VA 1K8QA 2HFKA 5CH5A 3IA2A 4DNOA 1R4ZA 1XRPA 1FFAA 4WJLA 4Q3KA 3FAKA 3KOOA 1A8QA 3QPAA 2WLSA 4NMWA 4HS9A 4X71A 4X6XA 1LGYA 4Z49A 5AH0A 3D0KA 3F67A 2Y2VA 1IMJA 2OGTA 1GZ7A 2WIJA 5ALEA 4P93A 3IUNA 2AJCA 1TCAA 1OCEA 1E66A 4Y2XA 5ALQA 1CUSA 4X3CA 2AJDA 4E14A 2WSLA 4JEIA 1DT3A 1VOTA 4EA6A 1YA4A 4CIAA 2Y2UA 5AM4A 2XMRA 1NX9A 1XRMA 3D7RA 3HC7A 4BTLA 3P2MA 1WCYA 3WWEA 2PBLA 1ZD4A 2XQIA 5ALGA 4U2FA 2GZSA 3KWJA 5JAUA 3FBWA 3FLBA 4UBLA 2ACKA 4P92A 5EHNA 4A16A 4OYYA 3VDXA 4XIIA 4MYSA 4B80A 3AFIA 3OOSA 4X91A 2HDWA 2B9VA 2XT0A 4OB8A 5AIBA 3I2KA 2ZYIA 4ARAA 4HRXA 1YA8A 4QE3A 4Y2SA 5DYYA 4UBJA 5HQ3A 4X90A 2VAXA 1WB4A 4G4JA 3FYUA 1EINA 4UFPA 1ACJA 4BCCA 1TKRA 3BF8A 3YASA 1YS2X 4BRZA 3V48A 3WMRA 4E46A 2GYWA 2WHRA 1QZ3A 1Q0ZA 2YASA 5ALXA 4JYPA 1SOMA 5AKZA 3C6BA 5JADA 4TPKA 3PFBA 3W06A 3QM1A 3F9CA 3QMMA 5JZBA 1IZ8A 3O9MA 3K2IA 3MVEA 2BJHA 4OU5A 2NW6A 1J1IA 4C88A 3DCNA 1DQZA 4GW3A 5C8ZA 3WK7A 5DNUA 1MJ5A 3PE6A 4BVJA 4DMFA 5CT8A 4B0OA 4OCZA 2HA4A 3F96A 1QIMA 2EEPA 1C7IA 3O4JA 4INZA 1YSCA 4UHHA 1U4NA 4AO6A 5AJHA 1AGYA 3X3HA 1XQVA 5CT9A 1BU8A 4IO0A 5BWBA 5ALJA 1HLGA 3IUQA 4UFNA 5KBYA 4HAIA 1XZEA 3RM3A 2VEOA 3GELA 3STVA 3HXKA 4DNPA 1CUWA 1BEEA 1EI9A 3A2NA 4X85A 5CXUA 1CUDA 1VZ2A 2WJ6A 2J4CA 4F60A 1ZOIA 4FFWA 3WKCA 2H7CA 1F0PA 1TQHA 4LXHA 4MQLA 4Y2VA 2DHCA 1G66A 1AUOA 5LKAA 4ZXFA 2DQZA 2QKYA 4G9EA 4KAJA 5AOBA 3STTA 3ZLVA 5E2IA 5CBKA 2UZ0A 2VTVA 2RAUA 1PV1A 1AMNA 1JU4A 2ROQA 5EHXA 2AJLI 4MXDA 4U2DA 3SWWA 3WKAA 1RWQA 1XKLA 2ZYRA 2OCKA 4DM7A 1PFQA 4AMZA 5CW2A 1XFDA 4C6HA 1DX4A 1UK9A 1YAHA 5K3BA 4BBZA 4LKOA 2Y6VA 5AI5A 4CFSA 3WWDA 4OB6A 1L7AA 1EH5A 4CG2A 4AN0A 4BVLA 3FOBA 1CUBA 3IB3A 3AIKA 4KAAA 1GQSA 1ORVA 1N1MA 2PUJA 4NZZA 1Q0RA 3W2TA 1DWQA 2VJBA 4WY5A 3RLIA 3Q0TA 3H04A 5AICA 4ARBA 1CQWA 4EY4A 2WG1A 1DTEA 1LPPA 1T4MA 2CKMA 2WU4A 3G02A 3HJUA 3I2JA 2JEZA 2WIDA 4ZWNA 4J0GA 1XLWA 2JGEA 1FFCA 4BAUA 3F8SA 5EI5A 2HU7A 3BJRA 4H7HA 2WFLB 2CZQA 2XUKA 2ZSHA 3KDAA 3FVTA 4DTCA 3E1GA 3R3WA 1BE0A 2WM2A 4J0IA 2RONA 1BN7A 2RHTA 5ALIA 3LS2A 2IX9A 5AI0A 2C58A 3DYIA 3EQ7A 1XRLA 4X95A 5AO9A 4EY5A 5ALWA 4H35A 6YASA 4MWTA 2WTMA 4X93A 4W1RA 2AJ8A 3E0XA 4AN1A 4J0JA 2JBWA 4RE6A 1C7JA 4B9EA 3G0GA 1UK6A 2ECFA 3R3UA 3ESAA 1QE3A 5AIAA 1QJ4A 4B6GA 1C4XA 3L1HA 1JU3A 4LHEA 5ALLA 3OURA 2HADA 2CMFA 1QLWA 4Q05A 2OCGA 4Q82A 2CUTA 1GT6A 1AZWA 2OG1A 3IBTA 1GPKA 3G9UA 4U2GA 3ED1A 1QIEA 3B5EA 1VE7A 1MX5A 2B4KA 1A8UA 2XUIA 2HM7A 3WYDA 2XUOA 2XB6A 5AI4A 1QIDA 3H1AA 3AUKA 4EY6A 3H18A 5KWIA 3WA6A 5AKLA 4J03A 3D4LA 4FNGA 1Y37A 2WJ3A 2VJDA 1HKHA 3DEAA 3GFFA 1DU4A 1A8SA 1QFMA 1XZCA 3VJKA 5C8VA 3U1TA 3UMJA 4S0XA 4PSCA 4BDSA 3WI7A 1XQWA 3H0CA 4AO8A 1YAJA 2G4LA 1ETHA 4LIPD 4ZRDA 3HLKA 3IURA 1ZIYA 2E3JA 1DQYA 2IITA 3HSSA 3T4UA 1XZFA 3AZPA 3QH4A 2ZJFA 1BEZA 3DOIA 5DWDA 1MAHA 2OQIA 2V96A 2PSFA 2YYSA 1NU6A 5ESRA 1ZD2P 3H19A 3WK8A 2VA9A 1CV2A 4BRSA 4BATA 3K6KA 5JATA 4IH9A 2PSJA 1N5MA 4JH0A 2B61A 4KYVA 1WHSA 3CN7A 5JALA 3G8YA 3WKDA 4FBLA 1XZBA 4H0CA 3DS8A 2JGJA 4KE7A 5HQ3B 3H2GA 4I3FA 3M3DA 2GBFA 5DYTA 1H23A 2HA2A 5CURA 2XUHA 1UK7A 3C70A 4W9RA 1P0PA 4H7EA 3IIIA 1CFJA 1UWCA 3QZUA 3BJMA 4FLMA 2CEKA 4H7JA 2X5XA 3G9XA 1ZIXA 3LP5A 4F0JA 4UBNA 4H18A 4PSDA 1U8EA 2FUKA 1ZJ4A 4W63A 1MX9A 1XKTA 2Z8ZA 3H1BA 2R11A 4PSUA 5JANA 3KSRA 2DCMA 4B9AA 5FDFA 3LCRA 1XZLA 4ZV9A 2DHEA 3DLTA 1ZI8A 1E89A 4Q34A 3N2ZB 2GYVA 4J0DA 4QDTA 3TRDA 4DNQA 4X6YA 3AINA 3QBJA 3ESBA 2I03A 4FLEA 3D2BA 2V9ZA 3WK9A 5C7YA 1UK8A 5AKEA 3HI4A 4GECA 2OGSA 3VJLA 1R9NA 5ALPA 2X76A 2XUDA 4M0EA 3LLCA 4PV7A 2ZJ6A 5AI8A 4F21A 5A7FA 1XZJA 1UKCA 4L0CA 4MQMA 5D3KA 1LLFA 2XUJA 5HCUA 3C8DA 3JYHA 1YS1X 5AHXA 4Y7DA 1H2WA 2ZYSA 3R0VA 1B41A 5FXMA 2RHWA 1D07A 2BCEA 5ALNA 2ES4A 5EIEA 5JAHA 5LIPA 4UUQA 3OG9A 5LZ2A 5BV7A 3WZLA 1BS9A 1XZHA 3QMWA 1LPBB 2WUGA 4UBMA 3O4HA 4MYDA 1WPXA 1E3QA 1SCQA 3G7NA 1IVYA 3ZLUA 3WIOA 4EBBA 3H2JA 3ILSA 1ACLA 1UZAA 3FLEA 5J3JA 1XRNA 1HDEA 5EHZA 5EFZA 4CG3A 1MN6A 4KRYA 5T4HA 2QOEA 1CRLA 1A7UA 5AK4A 1YB7A 1CEXA 3QITA 3FSGD 2JIDA 4A5SA 1EXWA 5DNVA 4QLOA 4YPVA 2G63A 2WTNA 1U65A 2QZPA 2ACEA 3JW8A 3E3AA 2XQFA 4Q1VA 3JWEA 2HA6A 3H17A 2QVBA 4UFOA 4UHCA 4XJVA 2JGFA 3C6XA 1Q83A 4HRYA 4WDRA 1UOQA 3IUMA 1CUHA 4NS4A 4JNCA 2H7XA 4JYMA 4IH4A 4C4ZA 2Q0XA 1OXMA 3BL8A 5CT4A 2BKLA 5SYNA 3WL6A 2I3DA 3M83A 2O2HA 3O4GA 4KRXA 4FLFA 4OYLA 2XUGA 1CUFA 1JJBA 1UOPA 4OUKX 3I2IA 4WFIA 1UKAA 1CUYA 1MPXA 2YH2A 2V98A 3PI6A 4G8CA 1J07A 4WY8A 4UPDA 3A2MA 1P0QA 4Y2UA 3WIBA 1XLVA 4L9AA 3O95A 2D0DA 2QM0A 3C5VA 2XQJA 3BXPA 5HK8A 1CUEA 2PVSA 1A88A 4V2IA 3S8YA 1CR6A 5JAPA 5AKJA 2YXPX 1AC5A 4H7IA 3PDCA 4OU4A 4K5QA 1G42A 2OCIA 2OCLA 2WHQA 3DDUA 3FSGA 4QDUA 2WG0A 3BE8A 3G9ZA 4GHWA 4FDMA 4LXGA 5AK6A 1R50A 4AXBA 5LZ5A 4KAFA 4GEGA 3QVMA 2VAVA 3LIIA 1TAHA 3CCCA 1QOZA 1S8OA 4FNMA 5EGNA 3GA7A 4MWSA 2PSEA 3VVMA 3ICWA 2FJPA 3C45A 3STYA 3D5EA 5AM5A 4CIBA 1LBSA 3AIMA 5EHQA 5K5EA 3CN9A 4EHBA 2WHPA 4ZI5A 4BE4A 1DX6A 3WJ1A 3TEJA 4GDMA 1GKLA 1VA5A 2WQZA 5IKXA 2HIHA 3A6ZA 3BIXA 3I6YA 3D59A 4W1QA 2I3ZA 2W22A 5HFNA 1ZICA 3VKFA 4OPMA 3B3QA 4B84A 5JZ9A 1LPSA 1W75A 5FUMA 3MGAA 3NGMA 1E5TA 4K6KA 1ZGBA 5A7HA 1R9MA 2X8BA 4GBGA 1XZMA 2XMGA 1VKHA 4ZGBA 2AJBA 1TCBA 4ETWA 1JJIA 4UBOA 4PO3X 5CTAA 4C4YA 5K3FA 1ISPA 5FRDA 4YASA 3BIWA 5AK5A 1K63A 3QPDA 4AMYA 1QONA 1XZGA 2C0PA 2XUFA 5LLSA 2Z3ZA 5JIBA 1H2XA 1U2EA 2OGZA 3DOHA 4HXGA 3ZLTA 3TJMA 2PSHA 4KACA 3HEAA 1CUXA 5DYWA 4BC0A 1GQRA 2FJ0A 2QRUA 1EDBA 2XMCA 1ODSA 3C6YA 3I6ZA 4CCWA 1W1IA 2EDAA 2Z5GA 5AKHA 1UOOA 1OILA 2CJPA 1SCKA 1TK3A 3AILA 1ZJ5A 1WB6A 3WJ2A 1O6FA 2JGMA 2WUFA 5AKKA 3R3XA 2DHDA 4B85A 3IDAA 2QUAA 3D2CA 5ALUA 2VT7A 1VLQA 2VSQA 4BAZA 1B6GA 3HACA 5K3AA 2Y1KA 5JARA 1E8MA 1FFDA 2C5GA 1CUCA 4ROTA 3I2GA 4PNZA 2PM8A 3V1MA 1JKMA 4QDOA 1R88A 1LZKA 1W6RA 4QDXA 3KD2A 1W4LA 1CUZA 4H7DA 4C01A 4PW0A 4F5ZA 5AKYA 3SC2A 4DNFA 5E4TA 1QFSA 4ZREA 2XMDA 3DNMA 5AM0A 2HU5A 3V9AA 3WL8A 1MU0A 3WLAA 1IUNA 2HA5A 2QXTA 2I78A 2HL6A 3Q8WA 5FLKA 3PF8A 3I2FA 2O2IA 3HABA 4BYMA 4QNNA 1XZIA 1SCIA 1E8DA 1BCSA 2WJ4A 1JMYA 1JI3A 2XLCA 3F97A 1FSSA 2C7BA 2WFZA 1QIGA 2JF0A 2DR0A 5AM1A 2JGKA 3KXPA 5BWCA 3A70A 4X6UA 2BGNA 3BDIA 4I19A 4G4IA 1QGED 3R41A 4AB1A 3PUIA 4N8DA 1YCDA 5BOVA 2QJWA 4HXEB 5LYYA 4BZWA 4X7BA 1ZI6A 3C87A 3OTQA 4XX1A 1MO2A 1VJ5A 2Z3WA 1FFEA 3H2KA 1CQZA 4O08A 4BDTA 4FKBA 1H2ZA 4PF1A 4M0MA 5ALFA 4BB0A 4OD0A 4GI1A 2G5PA 4AO7A 2PU5A 3PUHA 4Q3LA 4QWMA 4BCDA 5D6OA 4FFVA 5AI6A 4J0HA 5AM2A 2ZYHA 4C4XA 1JJFA 4KR0A 4QA9A 5ALVA 4DIUA 5I9IA 4JUIA 1XZKA 3QMVA 3VJMA 1RYYA 1GKKA 2H9YA 5ALRA 3PFCA 4H7KA 4BP9A 4Y9SA 3C43A 5ALOA 4TVKA 3ESDA 5IVIA 4FWBA 2XE4A 1M33A 4G8DA 4J0CA 4BZZA 4UBKA 4XWGA 4HZGA 5HF8A 1P0IA 3LIPA 4H77A 4KJXA 2H7YA 5HFAA 5CMLA 1EDDA 4U2BA 4B83A 3OM8A 1N5RA 2XMQA 3R3VA 4GLBA 3WWCA 4IQ4A 1MNAA 1W76A 3I1IA 1CLEA 2BUAA 5DLPA 2BFNA 3E4DA 1DINA 1Y7IA 1I6WA 1K4YA 1RP1A 1DT5A 4QLAA 1VA4A 2PU7A 1BCRA 4BTVA 2BUCA 1CUVA 3L1IA 2J3DA 3D3NA 3AIOA 2ZVDA 1XROA 3WL5A 3DL4A 3NUZA 1TRHA 3L1JA 4PQEA 1JFRA 2ZSIA 2HA0A 3STXA 3RARA 5K3CA 4I4CA 4AZ0A 1QIKA 3UUEA 2W6CX 1N8SA 1LPNA 5IH7A 5JD6A 1K5PA 5CH8A 4Y2JA 4BE9A 1WM1A 1E8NA 1XRRA 3WKEA 1CUJA 4BC1A 2VJAA 3ANTA 3G9TA 1IUOA 2QJRA 5ALSA 2D5LA 2WHPB 2RGUA 2BUBA 2HA3A 1EHYA 1QTIA 1AX9A 2QT9A 3IULA 1QTRA 4FBMA 3EQ9A 3O9VA 1USWA 3WA7A 4UHFA 5LP1A 4EB0A 1CVLA 5HF6A 3HRHA 5T4EA 5AKXA 5HZGA 3DD5A 5I8PA 1EK1A 3DYVA 1CUAA 4G4GA 4BVKA 1BN6A 2C5FA 5ALTA 4QWWA
chains in the Genus database with same CATH superfamily
4MRNA 3PNVA 1PS9A 4RJJA 2OVRB 4NWIA 4QBTA 3UYKA 3CLUC 3H1GA 2W8BB 1LWOA 3PWZA 3KSDO 3DSMA 3P2KA 5ALKA 2E4XA 3Q5EA 3RT7A 3HA7A 5C1IA 2BJVA 1WQ4A 3QF4A 5HE2B 3TCNA 1ODCA 4B0PA 4GSLA 5G1OA 2FFQA 3T5TA 5HJ5A 2A0FA 4A91A 2VUIB 5FPPA 2RFLA 2VDNB 5J2TA 2XMPA 2QLTA 1ZIDA 4EKDA 1LB1B 3O9ZA 3OCVA 3ICPA 1CZHA 3H83A 4KE8A 4NSNA 3ZY4A 3ABZA 2EYUA 2VNAA 1J5EB 3N0TA 3TLYA 3MWDB 3PIRA 4OV6B 4FGSA 1UMDA 4FA9D 1EUDB 3RAJA 1S3SA 4ARCA 2PZMA 4ZAWA 4QRIA 1WL8A 4RVOA 2NX2A 4LXQA 2HSEA 1J06A 2VR1A 3C8UA 3SY8A 3TM4A 2B1QA 2GQ0A 4RQAA 4ERYA 2BSAA 3ZWMA 1Y1KE 1FLAA 3W05A 3L79A 2I55A 5HCNA 3V34A 5AT1A 2YQ5A 2BYTA 1HKUA 1EZZA 3AUFA 2V4MA 5AUOB 4HNAB 1U7PA 2WFMA 3IVCA 2ESRA 4OQLA 1Z36A 3SKYA 4K81B 3P97A 4MA0A 3WWYA 3FCYA 3DVRX 5E95A 3SSOA 4EI8A 1H3FA 5HA5A 1RFLA 4UEOA 4OJMX 4CCYA 4PWZA 3MCWA 5K0FA 5KOHB 4X44A 4LJ5A 3VO9A 3ZIDA 4RTPA 5GXIA 3MC1A 5A5DA 3RVRA 2PZBA 1GCGA 3AZQA 4B3SB 2XF8A 4I4NA 3LECA 5TMEA 4TZKA 1RCUA 3AFNA 2QD4A 4N01A 3ZG6A 2ARKA 1SKUA 2R1ZA 4BNDB 2DFLA 2B2CA 221PA 4COOA 1I4WA 1IQUA 3PVUB 1OH7A 4AJEA 1TZ2A 1E0KA 3WDSA 4L5CA 3SVWD 1ACMA 4BKMA 4ZAZA 3L07A 1SUEA 1RNLA 1CY6A 2IS6A 1F1BA 3GGOA 3S7ZA 4ETNA 3HXLA 2GBCA 4B3MB 1EVQA 1JDJA 2BD0A 3D31A 2OL4A 3WGUA 2ZBUA 2O8NA 2YV4A 2R1VB 5J58A 1RI1A 4ITVA 2ZPUA 4R7ZA 1VSBA 1XEFA 1DAIA 1KGSA 2HF8A 2W0SA 2O8EA 3ULEC 5CAEB 3PFNA 2XADA 2IYFA 1HETA 1JP7A 4F06A 3UVLA 2HHAA 4UI9R 4CMHA 3EDYA 4J0QA 2VATA 3WLJA 1ZD1A 1Z88A 2XYHA 1S1MA 4JWTA 3Q4GA 2ZJOA 2JFYA 1HDGO 4LYDA 3H5AA 4HB4A 4PHCA 1NHGA 5C2VB 4CM8A 4LBVA 1Z6XA 1GR1A 3DZJA 5LD2B 1O2DA 2ID7A 3EIXA 4FAND 1R66A 1G5IA 5DBOA 5BOSB 3WYNA 1OLUA 5JAQA 4R31A 5JRZA 4EYQA 2QAIA 3AR6A 3W2GA 4BVFA 3GUUA 1ZO8A 3U7EB 2P2NA 3H87A 2XKAA 4PANA 3MN1A 4Q9KA 3S28A 2HW8A 4C0AC 4URFA 2RG1A 5E0OA 3P0RA 3V2IA 2ZI6A 1CTQA 1DE0A 3T34A 2P4EA 1T2XA 2Z09A 1JLLB 4C3ZA 1M2EA 3G82C 5J2UF 3I52A 1AZLA 2J57G 2DUWA 1W2HA 3EFOA 3LPCA 3KQMA 2PVCA 1MNQA 2WKWA 4C7BA 3QV1A 2BGWA 2HGSA 3UC9A 4ZZ3A 1W5BA 3GUHA 3T61A 1QRAA 3IC5A 4RD0A 2GM3A 1EK2A 2CDNA 2XE7A 4K3ID 1ESZA 3AONB 3Q72A 3ZOZA 5IN4A 1W48A 5KYKA 4EL5A 3RANA 2F4NA 4TV8A 2XA2A 4N40A 3UEOA 1WP9A 2R8BA 3LW7A 4D25A 3WLIA 2ZXUA 5IVDA 5ITZA 2CN3A 4L28A 3BKXA 5HDBA 3U48A 3LCUA 4QZVA 1MKYA 5IJ8E 2AEMA 4OSEA 4UXIA 5L9AA 2XI4A 4MVJE 2JKVA 4YJKA 1G20B 4HDMB 4CI2A 3WK5A 3SU8A 2XODA 3NQ41 1G5PA 1Y9JA 1H2BA 3I72A 1T2NA 1T8RA 2XDWA 2AJTA 2AFHA 1ZDMA 1C29B 1CNEA 2IHJA 2ZYUX 3A2LA 1M6NA 3EEOA 1SXHA 3PQFA 2X5JO 2O7VA 4RMIA 5ECDA 2DWCA 2NZ8A 3K2QA 4CT0A 4WJLA 4TT8A 5BSFA 4Q3NA 2PH5A 1EFRA 3ITNA 2F9LA 5B36A 3CA8A 1VRVA 3AM3A 1K8ZB 4ZAXA 2X8AA 4CJXA 4MRMB 3RS9A 3EY4A 4CIAA 2XMRA 3FIJA 3L7AA 3WAGA 3VZPA 2J09A 4N3NA 5B1SA 3OZXA 3HCEA 1C4OA 1N78A 3B60A 4Q0MA 2JPDA 3M5CA 5FOSA 1M83A 5DBFA 1QE5A 4AI6A 2FQ1A 4ZD6A 3KB1A 4OB8A 4PC6A 4IO1A 1X8JA 3RRJA 2YRXA 4NV1A 1U0RA 3HSYA 4YP0A 1ZPDA 1HRDA 5DYYA 3MMNA 4YP6A 2HZ7A 3UK6A 1PR1A 2XHEA 3ZW9A 4DIKA 4UFPA 4K9MA 3GPCA 4OGKA 2QL5A 3WMRA 4DRXB 1QZ3A 2HHLA 5AKZA 3G5MA 4CDRA 1H1LB 4PYOA 3P8ZA 4EH1A 3W5AA 4WE3A 2FPPB 3PXDA 4QBFA 1O5TA 3DULA 5CT8A 3ZXXA 4MW2A 4IAOA 2BEKA 3T3HA 4BP1A 3Q87B 3ISTA 5KJEA 2VDRA 4G0NA 2ZETA 4EW2A 4QOHA 4GGDA 3U16A 1OU4A 3WLNA 1O94D 2MINA 2DX7A 4WGGA 5B12A 2XL2A 1XZEA 5K01A 2IA5A 3VPFA 3SIPA 4FGWA 2F8MA 4TN5A 3LWZA 1RLUA 1KZYC 4Q4JA 2H2FA 3MB8A 2WJ6A 4C21A 1T3HA 4F60A 2GHTA 1AQUA 2Q2OA 1V35A 2P9SC 3FHOA 5IDQA 4FFWA 4HLNA 4EO4A 4UULA 3T5PA 1JQLB 1P1FA 3EH2A 1P8AA 3LRPA 3H16A 3IBFA 4UNIA 4L3OA 3TLEA 1GQ2A 3BTVA 5IAJA 3L46A 2VK1A 1ORDA 4MXDA 1BOFA 2WWTA 3LX4A 3CPSA 4P82A 3V4ZA 5J4KA 3A05A 4RYLA 4MB0A 4LAFA 5EYPB 2D7JA 3GPDG 3UQYS 2Q3HA 3PP8A 2AYYA 4MO9A 3HNRA 5CITA 1SCUA 4EGSA 2DH6A 3WVNA 4EG8A 1MFZA 2QT0A 1AKWA 1AK1A 2TSYB 3L6OO 2VJBA 4E94A 1O94A 2GFHA 1FXWA 3LUPA 3L4MD 1B00A 4CRWB 2WAXA 3QOYA 4LHVA 1IQPA 4ZO8A 4Z8YA 3HY3A 4JCCA 5KQPA 2XR1A 3KDAA 4A0BA 1UBCA 2PO5A 3A9WA 4DCJA 5FCDA 1KRHA 2IU3A 2B25A 1O96B 1EFAA 4JU8A 4P7BA 1GARA 1COWD 2C58A 5BN3B 4S1PA 1SUBA 4DAEA 4R98A 6YASA 3EHDA 2YWBA 1U1FA 4O2BA 4M9SA 5KNDA 1ISGA 3DOFA 5B7QA 1EIZA 2RHCA 3DT6A 4OI0A 3EZ9A 1P6QA 1NASA 1N5IA 4YTEA 1NR0A 3H0EA 2VHZA 3FE2A 1P73A 2ZXEA 1WDLA 4PRYA 1NA5A 3ND6A 1QOQB 3IBTA 1BXZA 2D4HA 1QIEA 2AB0A 3UOGA 4KQ1A 4J87A 2CK3A 2I1LA 4XGNA 5PGMA 3O3MB 1TYAE 5COBA 2FUG1 4DG9A 8LDHA 3E3NA 3PBKA 3EI2A 2AQIA 4M1SA 3ZC3A 1ADGA 4Z51A 1XK7A 2XYIA 1N33B 1OXSC 1Z8DA 1N9GA 1FS5A 1MDBA 4B79A 2GVZC 1H6CA 1COWA 2VJDA 1Z74A 3KYJB 1URPA 1QFMA 3IEUA 4TUYB 4CLDA 3DEFA 3GDWA 2X0RA 1N4DA 1V7PC 2HR1A 1CULC 1KQGA 3O3CA 4PU0A 2IPAB 3GRFA 3HWSA 1O08A 2OYCA 4TS3A 2FLWA 1L8AA 5K7SA 1U9CA 1Q7CA 2YYSA 1NU6A 2Y0PA 3SM3A 1W2WB 2JJ1A 5FWYB 4BRSA 5MGNA 3CX3A 5U4QA 2HU2A 4JH0A 2XWPA 4MAMA 4ZHQA 3KSZO 1DRJA 2VDPA 3VDMA 2OFPA 3IQEA 3Q0IA 4MRVA 3ZE9A 2I8LA 3H2GA 1WF3A 5LP6C 3M3DA 1Z73A 4D0KA 3Q40A 3C70A 4W9RA 1XCMA 4WHMA 1Y7TA 2CEKA 2HJBA 3VU3A 4BKUA 5L53A 5BT8A 5K3SA 2OZLB 3NEPX 3IHTA 4JITA 3KAPA 1H9BA 5HILA 2FPMA 3HLYA 1RACA 2R7NA 4D46A 1TI7A 3HP4A 3ZYZA 3UAXA 2VPIA 1DRVA 2SKEA 2XUDA 4D99A 3Q7TA 4K05A 3QWAA 3PT5A 1T5SA 2XITA 3WIEA 3B2EA 1DADA 5HCUA 5IANA 4OFZA 3PU6A 2IXAA 1D7AA 2NZYA 3P27A 1II8B 1SEVA 1DB3A 1YJBA 3NBQA 3M5WA 1WPXA 2G3YA 1E3QA 4KO4S 4EI7A 4X1OA 4QXOA 5G3YA 1E59A 3ZHUA 2X2EA 3FVWA 4JVSB 1R0LA 1NWHA 3HA5A 1UADA 2KE5A 4ENPA 2QOEA 5FPKA 4OGFA 1GRNA 5F73A 4KITB 2VRWA 3E5RA 2G63A 2WTNA 4H59A 2X5OA 2DWOA 1GO2A 2HA6A 1FA9A 5I48A 2VHXA 1AO0A 4UHCA 3U9SA 3SBEA 2J87A 3C6XA 1O8CA 4GWKA 4ZYYA 5CA0F 3KKEA 2D3WA 4AUKA 2P6OA 2HGZA 3GEPA 4KVFA 1W47A 1DG9A 2O2HA 1QG4A 4KXMA 5LBIA 1EX7A 4D79A 1IG0A 3PYLA 2ZRCA 2O4CA 2A92A 2A67A 1U1DA 4FP9A 4MV4A 2C2YA 3DV2A 1CUYA 4AFNA 3O4VA 4KWCA 4MS4A 3FI9A 4UPDA 2R4TA 2Z2OA 3KCNA 2YN2A 3P2EA 2F1JA 3MSCA 4O5AA 1MOQA 3SSMA 3WRXA 1SBIA 3IEIA 5LXTA 1W5SA 4EEXA 2EW8A 2PZKA 3H9CA 5AJVB 4US1R 3M6WA 3EZXA 2AK3A 5A0TA 1RQLA 1Y8AA 3MMZA 4MMZB 3F3SA 3I1JA 4WKBA 2PZFA 5HOQA 3WLLA 2QRLA 1JPNA 3RT9A 4KRGA 4N03A 5I4BA 4CL3A 3PDJA 5D01A 1RIFA 2VPPA 3FGOA 3V32A 2QBYA 3D4NA 4TQGA 3H9QA 4FNOA 1UFVA 2CV0A 1LBSA 4MPRA 1DIOB 1JX6A 3DOEA 2GPBA 2AOUB 1XZ8A 2X9NA 3D8RA 5F98A 4B71A 4EF4A 5IT9A 3D59A 5IG2A 1ISHA 3AJEA 5B58C 3FTFA 3CVWA 3DPIA 4NYJQ 1UBJS 2WJIA 2EIEA 1XTKA 1TEXA 1W5TA 2IH5A 4OIMA 3RSSA 2PCLA 3K09C 3ABIA 3A4IA 3SYMA 1W0CA 5AW4A 2A9KA 1YVUA 3IQGX 4DWJA 4UQOA 1VLHA 2WB4A 3B1ZA 4UHJA 4JS0A 5BR4A 1HZZC 4I4TA 1AQNA 5JXIA 2QRQA 1GQRA 2XXBA 4LX8A 1CZUA 2O54A 1X14A 4MJXA 4YJ2B 1DHTA 2QENA 5EUBA 9GPBA 5HPYB 3FMGA 1M0TA 4RY0A 1UDBA 1VLQA 3I3SR 5AUQA 5AVSA 5KSPA 3WL4A 4Y3UA 3UMCA 4X66B 1EFDN 3FPHA 3EF1A 3SOZA 1FFDA 4PSKA 4ROTA 4RZQA 3WXBA 1JDUA 1XJ0A 3KQUA 4MR7A 1SVIA 4YQFA 4PW0A 1M34B 2V0CA 3COJA 1XPRA 5ITWA 2H5EA 1Q12A 2RCNA 3HY6A 2FXVA 3PJDA 3J7AC 2FUNB 4CNQA 1MU0A 1E2NA 1GR0A 1DQNA 3S3TA 2H0AA 3ZJVA 1NUPA 2OK6A 3WYAA 4NOMA 2H5LA 1PQYA 5DHPA 4U6QA 4TV9F 1UMCA 3PHLA 3N75A 4QNNA 3ZCTA 2AYZA 2WHYA 1I4EB 2XLCA 4GM3A 4XWWA 3MIIA 1SVMA 1EG7A 2VNSA 4K8OA 5KQRA 1J0AA 2AGZA 2FPLA 1P9NA 4PXYA 4X7BA 1VE3A 5D86A 2WUWE 1YGPA 1BS2A 5EZYF 5JJKA 4BN0A 1TVEA 3KS9A 3VR1A 1ULHA 1H2ZA 4Z9FA 2ZDGA 4RABA 1FXUA 2E0IA 2XT6A 3ZKWA 1Y6RA 3NCTA 2WKSA 3RUCA 5AM2A 1JGTA 4MKFA 5ALVA 2EOAA 4D8UA 1XZKA 2PSSA 1J2YA 2FRDC 4IJWA 4X3PA 2QQGA 4KR9A 1PT9A 3C1AA 3IP1A 1J8VA 5IVIA 2IHUA 1GY8A 3LIPA 4B6JA 1Q16A 1YDFA 3PFIA 3VM6A 4DMRA 3E35A 3MWLA 2HPZA 2GB4A 4C6SA 5DGDA 4I9GA 4ZCPA 1SWVA 2RD2A 1LI7A 4MUFA 4CKBA 1VA4A 4ES6A 5CYKB 2CJWA 1IUKA 2XCSB 3GL9A 2WEKA 5DXJA 3TKAA 4M9QA 3D8BA 2DT8A 3I6IA 3KEGA 2X4DA 1AO3A 1MRSA 1ESCA 1A4UA 5JD6A 1GTZA 1OXBB 2AH5A 4Y2JA 2YHAA 4K9DA 4ER0A 5F64A 3VV3A 3NLLA 1ONNA 1MC5A 1IUOA 2YMQA 4AJPA 1E2QA 4ENWA 3UMVA 1GPMA 2ZI4A 4V0ME 4MQUA 4FBMA 2FSPA 4RETA 4S12A 1RSZA 1NZFA 4B4VA 2WMYA 1WY7A 3MAJA 2GF2A 3DMTA 3OJ0A 5LP1A 4U6NA 3PWSA 4AY3A 5LBUA 3TNJA 3BRCA 4UU0A 4MR8A 3ORSA 2W18A 2CLIB 2X9GA 4IKEA 3WG9A 2VDOA 1WXDA 4M6WB 2C9YA 1ZGCA 5BY2A 1HORA 4OA5A 4UUBA 2DQYA 3HCWA 1FRZA 1BVHA 4NBTA 1OBFO 3HYNA 5TRTA 4RKYA 2OZKA 3LP6A 4MEBA 1LZLA 3TZHA 3W3ZB 2F17A 2QWXA 5IHXA 4GKBA 3STUA 3X1XA 4MGKR 3MWKA 4L50A 1PN3A 4J3JA 4KSBA 4EYGA 3NRJA 3AR9A 3DKRA 3RIHA 2FP4B 2H9MA 4KQCA 2Y0BA 5IF3A 3WK4A 4DE5A 5H1YA 4WZBE 5AKGA 1FFBA 3OL2B 4LXUA 4EPRA 2BM1A 5ADWA 3IPCA 4J1TA 1QORA 1P2DA 1SC9A 3NVDA 3QYJA 4FB5A 1LBTA 1J7JA 4EUKA 2WY2D 3UQZA 3ZE2B 3UXEA 5I5MA 3SG0A 4TQUS 5D1HA 2IUQA 2GSWA 5INTA 1NBOA 2QQEA 4GGOA 2EATA 4EHKA 2WZBA 2OAEA 3LUBA 5L4NA 2ECKA 1NBMD 1ZJYA 4WKPA 3EB9A 4NFLA 1RWXA 3K53A 1T5TA 1MXFA 3EVDA 5HHTA 2JFGA 3MF4A 3NONA 1UFQA 1XQ6A 4RY9A 1BCSB 3FUUA 2HDNB 4LYJA 4HNQA 3GU3A 5BSMA 5FNVF 3LLSA 2I2CA 1W9MA 1XRQA 4F84A 3WGMA 1FJ2A 4F3KA 1FTNA 5LP6B 1M2FA 1UT6A 3QVWA 4CDNA 1BU5A 1PGPA 5C80A 4CR8A 4M3NA 4EW3A 1PEKE 1JDNA 3TZBA 1BMDA 1X1TA 3N2KB 1P1CA 4FFOA 3D6JA 3ZQJA 3URMA 3UWSA 3WR5A 1TOAA 4KLRA 4EUFA 4LJ4A 2HRCA 4X84A 3MBIA 4GQBB 3U62A 4QT8A 1H2FA 1CRZA 2X4LA 2KB0A 3I1YA 3EGIA 3NTLA 2O7QA 3VDRA 3RB8A 1SBNE 2JFFA 3AOGA 1BA2A 4KR2A 1OH8A 3FCXA 2ZS9A 4D0NA 2ZB4A 1Y98A 4TKUA 1XKSA 4F4DA 3CLKA 2V4ZA 3ZWBA 2AKAB 4EVQA 3CLVA 2FG6C 2GN0A 5A06A 3W0LB 1B8VA 4TYMA 4IVRA 4BEJA 3GLTA 3ONFA 4PGGA 5L4SA 4RVUA 3KRWB 2BI8A 1SQGA 2NXNA 1IB0A 3R6GA 5K8CA 4LNUA 3OIFA 5F2EA 1UBFA 1XPJA 4ID3A 5FNZA 3U39A 2MHCA 2YZGA 2QL7A 2IHNA 4HF7A 1QHFA 5L95A 4G8BA 1JA1A 2M32A 3VPHA 5IYZB 1IWPB 1IIBA 4YCNA 1Z4MA 3JVEA 3TAXA 5AOAA 2BC9A 2PH7A 3ENNA 2OPHA 1NJ1A 5I7UA 2GD2A 4DDKA 3K0EA 4M0FA 1GUDA 4NOKA 4YVFA 7YASA 2QUKA 3P0JA 5IKMA 2AHOA 1QG6A 2W8ZA 421PA 5ERXA 1U0OC 3H65A 4DEVA 3LUGA 1I1HA 1VI2A 2G09A 3HADA 1PI6A 4WLFA 2XF2A 3EPLA 1CEYA 2VH1A 4QD3A 1EVJA 1M1UA 2Q50A 2EJVA 2GEVA 3HO6A 3RK0A 2WINI 2WIBA 4DV6B 3BICA 2IZ5A 3DEJA 1O97D 2FAXA 3FYUB 4QC2A 1A27A 2Z6AA 2CE9A 3BREA 3D3QA 3BXEA 2R00C 1R1DA 1XIVA 1P5RA 1G3IA 4Z54A 1FRNA 2CVOA 2YBEA 1GZUA 4CKWA 5I9TA 2OHXA 4GQ1A 2CN2A 1U8XX 4NRDA 4P4SB 1FNMA 2O7RA 2OILA 1ZG3A 1L5LA 3OU6A 2ZIAA 4DPLA 2VDLA 2B21A 1JLHA 2H1VA 1J5PA 1ICIA 3CTMA 4EQ6A 3KYDA 2HJGA 1P7CA 3DSRA 3RAPR 5D5PA 3NP7A 1WUIS 2HFKA 2GESA 1C7ZA 1D1QA 1PJSA 2A78A 3LVBA 2JFUA 5K0BA 4C07A 4YI3A 4XYEA 2PM7B 4X6XA 4E30A 1USVA 1EEHA 4NH0A 4GE3A 2NNWB 4ITRC 3RK1A 1NXOA 3SYNA 1Z75A 4E14A 1U0NA 4JEIA 4DDMA 1P3DA 5AM4A 1XRMA 2DHRA 2AMFA 4G63A 4O3MA 4PZDA 4ZMSA 1QVAA 2ZB7A 2QEQA 3TFWA 2XQIA 1GYPA 4QQKA 2PD3A 5FBQB 4CBVA 3E70C 4RZ3A 4PGMA 3X1KA 4CTMA 3MERA 1F4PA 2WRZA 3WNZA 2VHUA 1KXJA 4Q7EA 4YHBA 4B80A 3AFIA 1YZKA 2ENUA 5HBGA 2BP7B 1Q14A 3GDGA 2DUNA 2FQWA 2GK6A 3OX2A 4AKEA 4QE3A 1WAMA 1EUZA 3IO3A 4Y2GA 2I4RA 3CFYA 3PEUA 4DCMA 4HDQB 5FTJA 3B36A 3DXYA 1IJEA 1VMDA 1TKRA 1AKRA 1RDFA 1EMDA 2A14A 3BM5A 1FYFA 2R3SA 2JHAA 5D1NA 4J2OA 1TMYA 1Z2PX 3K0BA 1JR6A 2GN2A 4O4HB 3PX3A 5LNK6 3PE6A 2O2JA 4MUJA 5E1MA 3KHUA 3DV0A 2E4UA 1U4NA 4JQCA 1XQVA 1P2GA 3PWTA 2E5FA 2C07A 3MOSA 3PJEA 1QVVA 1YTUA 4HLDA 4HAIA 3HXKA 2C97A 3TN7A 4H1HA 2UZ3A 1V8ZA 2UZ1A 2GTPA 3BAZA 4BNYA 4QBIA 3GRKA 5C35A 5E6UB 2HV8A 3N07A 3V1YA 4OYHA 4Z53A 2VYCA 2GN8A 1A9QA 4N0MA 3OQIB 3I73A 4Z0PA 2M1XA 4JUBA 3VOSA 3JQRA 2X5KO 3EZLA 5CPBA 1E3SA 1UZUA 1QMPA 1BXGB 1AMNA 1JU4A 2AMYA 2C9MA 1P18A 1BEUB 5KJ1A 3PUYA 3UYLA 3T7DA 3VC7A 3TBHA 2XSZD 3L2OB 1UDXA 1C0EA 4BVLA 4WOKA 1G6KA 4KAAA 3KB8A 1N36B 3TIVA 1FFYA 1ILWA 1E4OA 3RLIA 3ZD8A 5E6SA 3HV2A 4LWZA 1MVLA 4QAJA 4UM5A 4K3UA 3G8DA 4G36A 1QH0A 4YDHB 2BFBA 4UCXA 1H2EA 1MO6A 1SVSA 1T4MA 4JA0A 1Q7TA 3MJEA 2Q5HA 4PTYA 4ZWNA 1DEKA 1T4GA 4M86A 1S2IA 2O3UA 1JEOA 2X8JA 3AI7A 4Q9NA 4I1IA 3KE9A 1I7SB 1VBNA 3K0CC 3TXXA 2PRJA 5J59A 3X1ZA 4YV2A 3A6FA 2H0QA 1DEHA 1S01A 2IYOA 3B3AA 3TFQA 2G8LA 5A03A 4NEGA 1M2OA 3DTTA 2AI1A 5BWLA 5H4GA 5AI0A 2GTIA 1H6BA 3CWZA 5F7XA 3C8ZA 1TUBB 3QOFA 5ALWA 4EG6A 4Z7QA 4W5OA 1TZMA 4ZMBA 2BFEA 3E0XA 2IHKA 2XSZA 1C7JA 3EI1B 2FWRA 2DGDA 2QUJA 1US8A 5A2QA 2P1RA 3E27A 3L1HA 3A32A 3OURA 5EC8A 2CMFA 4RH0A 3HVUA 2Y1GA 4A92A 1PSZA 3DL0A 2HQSA 3KEQA 5GQSA 3W15A 4O0MA 2POQX 2CHQA 5I7FA 4JR0A 3AHJA 3KJNA 3CG0A 2YJ3A 2IYVA 5FBWB 2P9NC 2GNOA 2MYPA 2P5SA 4CN8A 2QVGA 1BJKA 1WV0A 4LN1A 3MUEA 3IBSA 2B5VA 1V7CA 2P9JA 5TQ2A 3GCWA 3QUBA 2BW0A 4NJMB 4JX9A 1MB0A 1DCMA 3DEAA 2R44A 4ZEVA 4KBYA 3RU3A 1S89A 3CBGA 4J75A 2G0NA 2CNKA 1ETHA 2HCFA 3AZPA 3ROZA 4MMYB 1TVMA 1KI6A 2V96A 5JYDA 2E4VA 1IZZA 4YR9A 1YRQA 2WVJA 3WK8A 4GSKA 3REQA 1H9CA 2AC2A 4A8JC 1M0WA 2AN1A 4X61B 5CLFA 4HLUC 2Y99A 4E32A 4AOWA 3LJKA 1NNLA 4LMPA 4P5PA 5CW1A 4FBLA 1XAJA 3DS8A 4LDRA 3EG5A 2BHTA 1YR3A 4M1TA 5CA1B 4KKVA 4LWPA 4PBTA 3FRXA 5EXTA 4D0RA 4KDEA 4XDGA 1PWXA 4YN3A 3QZUA 2ZRFA 4TYNA 1DJQA 4UUMA 2J3IA 1S5PA 2P9FA 1N5LA 1U8EA 4LFCB 2QPOA 3UHPA 1VIMA 1L7BA 3KSRA 4YYEA 1YBFA 2RHJA 1TJ4A 1PT5A 3B89A 3ZHOA 1JXOA 1CJKC 2YJNA 4J8GA 3ZE6A 3H5LA 1N2SA 3SC6A 5B2FA 5IEBA 2OGSA 1CQXA 2OXIA 4BN4A 4GDFA 4PV7A 3IP5A 2OPBA 3C24A 4O4IF 5A7FA 4MQMA 3SP1A 1QQAA 1G291 2EJTA 4N1AA 2ES4A 5COAA 1PD1A 4Z0TA 3W90A 2YNMA 5AVXA 1QDUA 3DW1X 1KDZA 1UP7A 3TNFA 1L5WA 1RJ9B 1XWWA 1T5HX 2KS6A 4BMPB 4C4RA 2FN4A 5HYNB 4O2AF 1XI2A 1W4RA 3GJRA 3NBAA 1F5NA 1I80A 5F1KA 5FTMA 3IJ1A 3QXSA 3B6MA 3C9CA 2MT9A 3GIDA 1NLUA 4TZ6A 4X8HA 2GBLA 3OTOB 2ZJ1A 4YUXA 3OP4A 3M33A 2HSDA 2VHTA 5KPDA 3SQOA 1C5KA 2G70A 5KQGA 1O7JA 1AKTA 4M8IA 4L9RA 2PLFA 2IXGA 1VMEA 5CYGA 1W5FA 4WFIA 3FHTA 3AXTA 5EMKA 2ZT8A 4FC7A 3K92A 4G8CA 4QHYA 2HLNA 3DWEX 4M21A 3LQFA 3F6EX 4JI5B 4R40A 4ZAGA 2B36A 1PU2A 2O06A 5JS6A 2GI4A 4BMCA 4MPTA 5AKJA 4B7CA 3KVYA 3KJFA 3F9IA 3N0WA 3PJGA 2WHQA 1E1DA 2OHFA 1UJCA 2EP5A 3E0CA 2ZM6B 3RGWS 1N0UA 3NMUF 4W5NA 2I3BA 2HT6A 4KG7A 4YLEA 1J0BA 3U6KA 4D5EA 3KT6A 2RAFA 4OQZA 2PXHA 1YRAA 821PA 4MWSA 3GH3A 1AGPA 3PJRA 2XCUA 2VC2A 3HU2A 3HSKA 4D6YA 3MZLA 4Y1GA 1WNTA 2G9VA 4IMJB 4R9SA 1XDWA 2YJTD 4DQKA 1EAMA 3OFND 3ZLBA 4W1QA 2NV0A 3CV3A 3FH0A 4F5YA 2I5PO 1C9EA 1LPSA 4QX6A 1TVCA 3KKKA 2P77A 3N8DA 4K6KA 4IIUA 1R0CA 4O45A 2BGIA 2HCBA 4ERQA 1V1RA 1TM5E 1NUHA 2PJZA 1EM6A 2H4HA 3LYUA 4GU5A 2PL3A 3ZU3A 1Z7BA 5F3DA 4O2RA 4EELA 3DLCA 3R23A 2C2KA 5FOWA 3ZDAA 3OZSA 1C3JA 2W37A 2OM2A 4AMYA 3AV3A 2A7QA 2XZTA 3DOHA 4O4JF 2PSHA 4ZOXA 1VPTA 3T7TA 5C4MA 3WLKX 1WCIA 3R7LA 1VE5A 2Z5GA 3VA6A 2ZVJA 2IQIA 3BBPA 5J43A 2FKAA 3WJ2A 2UKDA 3OFNA 3LZCA 2IUTA 3OLYA 3TTXA 2X3YA 2O8BA 4YALA 1K7FB 1WMSA 2QUAA 1DXHA 3IODA 3L8ZA 1U3VA 1RYMA 1P17A 4M89A 1OZFA 3GP5A 2G6BA 2ODNA 5AJAA 4HNSA 3N3BC 5BV2P 3SBOA 4BLTA 2BBOA 1OX5A 3W6ZA 4GYWA 2JI9A 4UMDA 1RI2A 1RC1A 3EN0A 4GZ6A 1JALA 5DCWA 2VSFA 5C31A 4MQ4A 3EIQA 1BGVA 2JLQA 3DEYX 4FUTA 2FFRA 2DRIA 1OYVA 1RM0A 1OGJA 1MABB 1APBA 2QY6A 3QP9A 3ND7A 3GRUA 3OM1A 5F12A 1UBUS 1C1XA 2VXCA 3LY5A 1X13A 1X39A 1R0RE 2OFFA 4PHFA 5BWCA 3PQ2A 1BO6A 4ARIA 1AB5A 5FUYA 3TDKA 4U1EI 1VE9A 5AVUA 1NW4A 4AURA 4R2WA 1I6MA 4HXEB 1MZPA 3FUTA 2R96A 4BMYA 2QAJA 3JRNA 2X5NA 4ZCLA 3I8XA 1YI8A 1QUFA 5ER6A 2YXDA 1I30A 1H42A 3LCMA 4OD0A 3NDBB 5DPMA 4TZ4A 1UWLA 4Q1DA 4FFVA 4A09B 3IMKA 4UQLA 4JUIA 2JLXA 2HRDA 3I64A 5CM8B 4YROA 5JNUA 3DA8A 3BK1A 3VOAA 5FR2A 3QV2A 3L8HA 3ESDA 3GT4A 1E1CB 3RS3A 4G8DA 4E7OA 1R8XA 3KBBA 5CCBA 1Z2OX 3AGPA 2HV9A 3K1YA 4O25A 4BO5A 5AQ1A 1LQ2A 2XMQA 2H54A 3T7JA 2AQ5A 2OVBA 4H31A 3E4DA 4UZEA 4DVGA 1K4YA 2IZZA 1LKZA 1H0RA 5FBKA 2JJ2D 1YQWA 1X9GA 3RYHB 4BFCA 1SXJB 4MWEA 3QNWA 4MVYA 6Q21A 2QVLA 2YNNA 2XZOA 4GM4A 1TAQA 2EF0A 5EM2B 3BHMA 4EM6A 4FCVA 3TNLA 1P2BA 2J46A 5HS6A 2H07A 4LZOA 4EDHA 1QSGA 5JS8A 2D5LA 3S44A 1TD9A 3G68A 3SQMA 2C88A 1NV9A 5BRNA 5JJIA 4JJIA 1KKMA 4H0NA 4MQFB 1F2VA 3R6LA 5DE3A 1TFUA 5I8ZA 4UPEA 5HZGA 3PYMA 1IYZA 4G0WA 4YJHA 4IOLA 4X94A 1D1TA 2CMKA 3C6QA 1A77A 4EUSA 1VHQA 1HGXA 2QW1A 4DLLA 1LPOA 4MKGA 4F11A 4HT3B 3PHCA 4HDRB 3EJ6A 1M72A 4TRNA 1YB6A 1BVUA 1UCFA 5LN1A 3GCXA 1O9HA 1F3LA 1XCOA 1K2VN 2C7OA 3K73O 4PYJA 5L7WA 1QIJA 3L8DA 2DOKA 1DP4A 4DGQA 1YMVA 2ZBPA 5HQTA 3IILA 1FDTA 4OZUA 2AA3A 2PKYX 4RCYA 4ZV7A 1DKLA 4QXQA 2RHRA 3AKEA 2ZBFA 2OORC 3M6VA 4Y2QA 1L7DA 1VJTA 3E5NA 3F3FA 5CB6A 2QTNA 3UMGA 1P29A 1LC3A 4N0QA 4AQDA 2JIQA 1U8YA 1A71A 5L3SB 4ZA2A 1XQXA 4NX2A 2HLDD 1PEVA 4TMXA 4XGKA 2EFHB 2A88A 4WCFB 4Y2PA 3F8WA 1I6LA 3R3YA 1OKKD 3R4VA 4KFUA 4MYRA 4BJ3A 2PVPA 3JQCA 3OZ7A 1VKZA 3U4YA 3MYYA 2Y4OA 3ESCA 1KY3A 3H13A 4RTMA 4RPLA 2PX6A 5KYVA 4EB8A 1I4LD 3KB6A 2UDPA 3LPLA 3MCAA 4XARA 5DSTA 2O23A 3F2IA 3VV2A 2VDWB 3LF1A 2LV8A 1DAFA 3A36A 2QTGA 2O2GA 4Q9IA 1UJ2A 2KI5A 3UF0A 4P3NA 3AF0A 3USCS 4LUCA 2G99A 5CT6A 1JH9A 4YC7A 1NXVA 4OQPA 4L8WB 3QKUA 2XYPA 5GP1A 4MDFA 1A98A 1KYVA 3E1KA 4BIIA 1QGUA 4Q7LA 2RH4A 3KLBA 1OKKA 2XEXA 5KTYA 1M1YE 4RTRA 4KQIA 5HF9A 1OIVA 5JD4A 4CLOA 3SOPA 1EP9A 4S0ZA 3BOSA 4JVNA 2YQZA 5G4LA 2O8CA 4QM7A 1M1XB 3U37A 3KQHA 1L9XA 3MXXA 2GK3A 1B26A 4RSHA 4G1EA 1G21E 2AG0A 1WZEA 1A4IA 2B20A 4B3TB 1G9TA 2HRBA 4KXWA 2WKQA 3WQHA 4JJ8A 2HEIA 4IUBS 1CE8B 2Q9CA 2COUA 5LZ9A 2P3SA 2FF5A 1XZDA 3GAZA 3ZDYB 3G8CA 4KXLA 1R0XA 4Z99A 1CS0A 2ORIA 4Q4DA 4YP1A 1BCRB 3SQXA 1Z0AA 2FN3A 5E4JA 1H69A 2CXTA 1MHTA 1FDWA 1Z5WA 3GNQA 3CPEA 1SGWA 5SYAA 4BP8A 2W6NA 3OUTA 4AZ3A 3BHIA 5E9QA 3EODA 3L0ZA 5TVKA 3GEBA 3RJ5A 2YUIA 2H31A 2GEUA 3F71A 5EESA 2CXPA 1FE8A 2Y9PB 2GD1O 2H0RA 3AB8A 1QK5A 1IAVA 3M4NA 3OZDA 4F6LA 1T8WA 1ZGHA 5IPFA 2O8DB 4BNLA 4HR7A 1JEYA 3RYIB 4FN5A 1PQUA 1WDKA 1DLIA 4TQ9A 4BMDA 2IFTA 4G5XA 5LA6A 4ALJA 5LQCA 4KMSA 3PNBA 1E3JA 3NHYA 1YQDA 4S1NA 5F4ZA 1IBSA 1KSGA 4GOLD 5EKXA 1L4HA 5A4FS 4XSGA 1W4BA 3LUDA 2Y27A 2FFHA 1KHTA 3UAGA 2HFJA 3FSRA 2X41A 3ZZUA 3PEYA 1R5JA 3VZRA 4MITA 5CJ2A 1E99A 2IYEA 3ZVLA 3L8GA 4LDPA 4HNGA 4IF6A 3KVRA 4JDUA 4ZJZA 1C9IA 1T5OA 2Q4BA 2YV2A 3GC6A 1XD8A 1Q2XA 3DVQX 4WNAB 3TUZC 1CIJA 1M76A 3RFXA 1XB2A 3HDGA 1Z2EA 3H1TA 5DRTA 5KDDA 3CR8A 2O19A 2C8LA 1XU4A 3LKBA 4IXNA 4YT8A 2WPDD 3TSWA 2J0UA 4AG6A 5G02A 3I62A 2Q1XA 4KQ9A 1HTTA 5KYUB 1Z33A 3SS7X 1A9YA 1TIBA 4CTJA 3S40A 2GJ4A 5C81A 4YNBA 1GN8A 4YX9A 4M0PA 4E11A 2WJJA 1FNSA 5JQGF 2BFOA 1SQSA 2VJCA 4Z4HA 3L1KA 1HL3A 2NVBA 2BTOA 3FZYA 4LFAB 2H5IA 2HCTA 3HYSA 1HQCA 1T6YA 2ZUBA 3IA2A 5KCMA 1NBHA 3T5MA 5JSQA 3QPAA 4E54A 1C8LA 3NFYA 2C7PA 3DDHA 1IXKA 1RI3A 5C5EA 1ZM3A 1TA4A 3IUNA 1YIAA 4ZOZA 2AJCA 3WB1A 3TPCA 4QOGA 1UM9B 4DVJA 1P2SA 4RDHA 4M8NE 1VOTA 5CEJA 5BYJA 1Z4LA 2PH3A 5C5IA 5CD9A 3R9XB 1G41A 1P45A 4J6EA 4UTXA 1Z2AA 4BNMA 5C46F 3L7DA 5JNRA 2PM6B 3LUKA 3KWJA 1YS4A 1NKVA 1Z6ZA 3K9WA 2ZPAA 4A16A 1RLIA 4PYIA 4LPKA 4WBNF 2II6A 3GN1A 3IEMA 1WS6A 2JH9A 5JFGA 3PUKA 5EZSA 4BNGA 3WGQA 2IX3A 2BHNA 1FL9A 4BMSA 4EKIA 2C2GA 2Y68A 4P54A 5BSEA 3AY3A 2WD9A 2BSQA 3WHPA 1VL8A 4NOJA 3YASA 1YS2X 4BRZA 5BR1A 4IIJA 1PWEA 1BE1A 4RTNA 1DAHA 5L45A 4WAUA 2EFYA 5IJ9B 1YZ3A 4M54A 1E98A 3ABOB 2IVZA 3RYCA 3NTVA 1P81A 5HX7A 2PKXA 3M8KA 4RMHA 1RPAA 5DASA 4DMFA 3WIUA 3ZUPA 4YACA 3OCXA 4AF8A 2HA4A 2OO5A 4W8HA 4EAQA 2ZTLA 1M7GA 3FCSA 2ZG6A 4UHHA 5CPFA 1KARA 1FX0A 2FZVA 5A3SA 1OREA 5BVHB 2OBNA 4L16A 2O9JA 2B4RO 3RM3A 2I2AA 5JR3A 3ZU4A 1I0LA 3BH7A 3A6HA 2FPSA 4WN9B 1KZ1A 2Z1NA 1RXVA 2J4CA 2MR5A 3QSGA 5H4HA 2C61A 4C29A 3BT7A 1G8AA 3W2IA 3ZHVA 1GILA 3QELA 4MQLA 4F8EA 1JB1A 1QZUA 4NH4A 2AWNA 2FMKA 4JOBA 4PGFA 1ZUNB 2GN9A 4JGBA 2CW5A 5CFPA 2C31A 2QTVA 1NBAA 4TXJA 4UMVA 3TR5A 3KNZA 5JISA 1XKLA 3FROA 1RM5A 3V7UA 2FWBA 4O02A 5DP1A 2XWSA 4ZIRA 1CFZA 3ZZMA 4DCTA 2V7WA 3V8BA 3FOBA 1VG8A 4FDAA 2M9MA 2JA1A 3FCAA 3AHGA 1JQAA 1GZHB 1FLVA 4D8VA 1TU3A 1RWVA 5LM3A 4X62B 3IXQA 3C14C 3CMMA 2I76A 1B3RA 3PDIA 1BWQA 3LTEA 2WU4A 1ZHHA 2P4QA 4EATA 3I2JA 1VLVA 4H3VA 1TUEA 4FWIB 4I5IA 3K0FB 1G2PA 5C7IO 3ET4A 2HU7A 1DC7A 5KWSA 1SKQA 2ZBVA 1DC3A 2FB9A 2WFLB 1I4TD 2PKWA 2XUKA 2ZSHA 2EGGA 1SHZA 4G37A 1O4WA 4CHGA 3OT5A 3I5UA 1CR2A 5LOVB 3PD7A 2VZ3A 5ALIA 1S4MA 3CPJB 3O8QB 1DBSA 4QREA 4E5VA 1K98A 1AHHA 1FFXB 2NO7A 4BZXA 3IUPA 4ED9A 3V8EA 2JBWA 4G1VA 1DTSA 1ZGGA 1QJCA 5KYYB 4TLDA 1L3IA 5AIAA 2C77A 4PR0A 2I7CA 3IE0A 4WLOA 4NYMR 1I2ZA 4A8PA 4FEEA 3V5NA 2GJAA 4Q05A 2CUTA 5IWAB 4GP9A 3W4KA 4PZZA 1LVUA 5KYGA 4U2GA 3UWKA 1GCOA 4QOFA 3ORVD 3F6BX 5JTTA 5IC5A 1V95A 3KZXA 2XUOA 4OOFA 3S1AB 1S2DA 3KQSA 3TSOA 5AI4A 4EVIA 1GM5A 2O8FB 1TZJA 5DNYB 3QTLA 1HKHA 3QVJA 4D2IA 1D4ZA 1UIMA 1U80A 3U3ZA 1XGKA 2VSNA 3BMNB 1XN4A 2IUFA 1A8HA 1A0OA 4FN4A 3J81A 1ZC3A 3D8SA 8GPBA 1XL1A 4UQPA 1XZFA 5F5NA 5LQUA 3II6X 3HLTA 5I9BA 1YZTA 5LYJA 1FMFA 4TXMA 2GZDA 4NMMA 3AFOA 2Z5FA 4JJZA 1KAQA 5AW0A 2VA9A 3F5SA 3L77A 2Q7DA 4YCBA 3K6KA 2VF5X 3R0XA 2YBDA 1X92A 2GO1A 4UM8B 3WNBA 4MOWA 3WKDA 4C3UA 5T41A 1W46A 3N28A 4RXUA 2ZRBA 4REQA 4I3FA 2WBLC 5ICSA 3T3PA 2JFOA 2VTDA 2SECE 1MDFA 3QKRB 4QYMA 1SXPA 4H6PA 1SUSA 4QEZA 4PSDA 2FUKA 1SKYE 5KC9A 1VJGA 3A1DA 4J91A 1N2CA 4PSUA 3BG0A 1NVFA 1RADA 4QTYA 2ODBA 1SM4A 3PCRB 4DNQA 2G1AA 5ED0A 5CNKA 4HEQA 2XOXA 2ISQA 3GIWA 1M8JA 1Z12A 4ZI7A 4D6XA 2J30A 1TFRA 5LDHA 1LLFA 4B6SA 8ADHA 1Z0KA 1O95C 1TVKB 3KLOA 1Q47A 2R5FA 4JXZA 1BX0A 2RHWA 1R4NA 1K5DA 2B4TO 4ND7A 4TLEA 4YFVA 5KYNA 4C2AA 4MYCA 3QMWA 1W96A 1T2VA 4R41A 4BQFA 5J9FA 4KO2S 5JCOA 5BNFA 4KGZA 2JCVA 4IUCS 3P7MA 4F2HA 4TMYA 3GWZA 2RB4A 4ZOLB 1HLDA 4J07A 1M5TA 3C48A 3DFUA 3OE1A 5MFZA 1GPYA 5JSZA 4ZRMA 5FOXA 2GPYA 1JG7A 3KDSE 4IMIB 4CL2A 1FZTA 5KYWB 5D87A 4HRYA 4RS3A 4P1ZA 5IM4A 3IUMA 4NBKA 1YQXA 1T4CB 1H66A 3AR3A 1KERA 2PUAA 7REQA 4GH5A 5GY7A 1JVSA 4TSRA 1QRSA 2XD4A 4JZKA 5IC4A 3M2PA 1V9SA 1J8MF 4P80A 3MRXA 3ZDCA 2FEXA 3B9BA 3LGXA 3A3YA 1C9DB 3IE1A 1X77A 5AVTA 4F71A 3OZTA 1L5SA 1I7NA 1NG9A 3O95A 4I55A 3T7SA 3BXPA 1WB9A 1WOYA 2WWGA 1BE8A 1ML3A 1X7XB 4KWHA 3K8OE 3M3HA 5BSVA 3D3WA 3TOZA 4G65A 3EIUA 2FSUA 4ZK2A 2P9HA 3BE8A 5SV2A 5ICCA 2BGGA 4LRWA 5KX5A 4R2LA 2X2PA 3G2PA 4IUYA 1GG9A 3CCCA 2QZ9A 1QLJA 4FU0A 3ROQA 3GA7A 4OQNA 2FJPA 3STYA 1OBHA 2CFIA 5AM5A 1NDUA 3G17A 5EWJA 1IPFA 4BV9A 4DPKA 3H86A 1DX6A 1E1NA 3PUXA 2E5LB 2IEBA 1AF7A 4M60A 3L4EA 1U8FO 1ND6A 1T3LA 1E5DA 1GTMA 4J43A 3TSCA 4LMRA 3R5KA 1P19A 3WYGA 4N48A 1LX7A 2NO5A 1EP3B 3OKYB 1TC2A 4DIDA 1JSRA 4WXRA 2OYSA 2B34A 4QYXA 4ENVA 1EHIA 2AG5A 5FR1A 4GBGA 4NR0A 4G26A 1LH0A 2KLBA 1FDUA 1FX1A 1TCBA 1YDEA 4D6VA 2WSYB 3QFCA 5CTAA 2VLIA 2HO5A 1PJ3A 2A9VA 2NZVG 1K63A 4HV4A 2K6GA 5AVVA 4RTKA 1W93A 2OC4A 1R9JA 1U2EA 4NU8X 3TGPA 3TE7A 1NE7A 5LQMA 4TL8A 4X3OA 1Z8FA 3H5WA 1HE8B 3C6YA 1T2FA 4BNIA 3PZBA 4L27A 4MQEB 4FZJA 1OV6A 3TW8B 4HK4A 5BMVA 3OZEA 1NBMA 1Z4IA 1JDTA 2DWQA 1KOLA 5KTPA 3DNPA 4YJ3A 4W82A 4EPYA 5BVGB 3LDUA 3TAHA 4YIHA 4RIIA 3L7JA 4ILKA 2FZGA 3NBMA 4AY6A 1CDEA 4O1IA 1YJ8A 3O8OA 4YBRA 1H4TA 1N6NA 4RA9B 2G9AA 1XL0A 4MIYA 3RS0A 1F4VA 4ZREA 1NYRA 4G0QA 3LUFA 4GQAA 1TXGA 5EJEA 3NHJA 2CC2A 1E1MA 2VP5A 3UBMA 1IN5A 1WSWA 3KRTA 3HNOA 4IFIA 3EOZA 4AZ0B 2BE9A 2ZUTA 1LVHA 3PHBE 3HABA 4V03A 2RI0A 4CF5A 1E8DA 5IJ0A 1WR8A 5IF9A 1NUTA 2FXIA 1JI3A 2ZWOA 1OLXB 2JF0A 3KXPA 2FPIB 3GA5A 3IQZA 1BIFA 1Z0DA 4OXRA 3THOA 4WTOA 1ZMBA 4CMEA 4WKGA 3THWA 1SZCA 4URXR 5CBPB 5JC1A 3D1LA 4ALKA 3K2BA 3K27A 4G5QA 2Z3WA 3GBPA 3RYFB 2ZIVB 3TIFA 4BDTA 3HVIA 4HADA 5SZJA 2Z9DA 4WKNA 4GI1A 1CRWG 1DFHA 3PUHA 1LLUA 4EFKA 2YMLA 4WVFA 3MD9A 3KUKA 2ZYHA 1PK7A 4G1CA 4QA9A 3DXXA 2V7UA 1GZ3A 1ECLA 3KOUA 2GM9A 3PFCA 1JSLA 3CLRC 4CF6A 1XHLA 5JZVA 4WBXC 2RGXA 4BZZA 2GTHA 4LHXA 2V6GA 2GN6A 2NSDA 1P0IA 3VSCA 2BF7A 2RJ3A 4Z0HO 3CX6A 3OCJA 3WLSA 1OXTA 1Z2DA 1U8CA 2X19A 2BUCA 4JT2A 4X8MA 1OAOC 2MOKA 4UAJA 3CEHA 4FMCF 3MCUA 3L7OA 1CRPA 4BFLA 4M1OA 1GSIA 1GAXA 4RDXA 5K3CA 1SVKA 4MS3B 2E55A 3PEFA 2W6CX 3PQ3A 4FXPA 4OFBA 1E6UA 1NIPA 1XG5A 2FP3A 1OC2A 1XNQB 3H42B 2PNJA 2QJRA 5CB0A 4GVLA 3U3XA 1U31A 1QTIA 4F1JA 2QT9A 3VR3D 4BLOA 1Z26A 2PG3A 4PQYA 2KSQA 4QXAA 4YRCA 4OHUA 1RI5A 2QD5A 2AFIA 3KTOA 4LG9A 2DKOA 3K32A 1PR0A 4HEA1 3WOHA 1JKJB 2A1UA 2OLKA 9ATCA 3JQBA 3MEQA 2OE2A 3QKSA 1XZQA 2GBPA 2P41A 5CM9C 2DERA 4RENA 3PUWA 3VHQA 1CRQA 1NRWA 2ORYA 2YX1A 2A9OA 1SUIA 4Y2HA 4PLVA 3BWXA 4IIHA 4F2WA 2HDOA 3GBSA 3WY9A 4A03A 4TLBA 1ENYA 2BHLA 3DDZX 1J0EA 1EUQA 4JSRA 3C7CB 1TCCA 2EVWX 4JWKA 3WLPA 2Z8XA 4KW7A 3EJWA 3WRVA 3C2QA 3HRIA 4DDWA 1L8XA 3I2HA 4JOQA 2FLKA 3TSAA 5FLEX 1IOLA 4QUKA 3FF1A 1KQFA 2G5TA 2XZDA 4RJTA 2EBSA 1K88A 4MJ3A 5TXGA 5JMOA 3UJ7A 1R00A 3ITKA 4LC0A 4OL9A 4R8KA 3VI4A 2ET6A 2O8VA 1R6DA 4UAVA 4UKDA 1U81A 1TRKA 5IFLA 1ZR4A 2GH1A 2Z1DA 3X1JA 3EW9A 4GOOD 4A2MA 1F6WA 1QE0A 1OD6A 4PLFA 4DHWA 3BB4A 2N75A 1JR3D 3LXUX 2G71A 3HGMA 4D9HA 1NVMB 5TGZA 4AP5A 3QPCA 1LW7A 3O2NA 2VHJA 5T7BA 2CLEB 3CLTC 5JBQA 3DE2X 2G72A 3TX2A 2AUMA 4HEJA 5E4YA 2HD4A 1JF8A 5FTLA 1XQYA 2I7XA 2QTCA 4A6EA 3DLHA 5GPBA 1G3MA 2WTUA 3I7NA 1GT91 2DUUA 4FFSA 3BD7A 3PENA 4JUDX 4HBZA 1RJEA 3C5WP 3WBFA 4XYGA 1T15A 2W8BA 4LXXA 1S3IA 3I0MA 4DEXA 3EUFA 4J29A 1XF9A 2VJYA 3CVJA 1QIFA 1HI9A 3V55A 1RMQA 4I79A 1BH6A 1GGVA 3DBHB 3RWMB 2BEUA 5JVDF 4NFSA 3EX7C 5A9TA 3I39X 3BTOA 2J8ZA 2VDNA 4WA7A 3AJAA 4HB2A 2HMUA 4BL0A 4QL1A 3W5IA 2FPXA 1O87A 4UEWA 3EOAI 3EW7A 3SX4A 4MQ5A 2HF7A 2ZWVA 4BO3A 2Q46A 1GCAA 5HIIA 4CM1A 4XGRA 3NH9A 4I1UA 3D6FA 2IEZA 4ND4A 4Y6QA 4KMRA 2ZKLA 4X1IB 1RYFA 2YFHA 2DFPA 4BV2A 1P4GA 1XTRA 3H7AA 3WWOA 2FPWA 2GSDA 2R6HA 3OLCX 1C3EA 1ST3A 2E1RA 3CRZA 3HO8A 2F9FA 2G40A 3U7QB 1IJKA 1CZLA 1UKYA 3CLSD 1T36B 2E85A 2GARA 3BGVA 5KTKA 2YVLA 3OJEA 4HNAA 2E2WA 5HIJA 4OJQA 2MMGA 1VZ3A 3FZEA 3NI2A 2JHCA 4IJ6A 4KXUA 4BWGA 3D8HA 3C8MA 5BN5A 3RBAA 4BGIA 5KOHA 1QANA 4DY4A 1IBRA 1CUGA 3RYTC 1NFFA 1OVMA 2X40A 2FUG6 3K05A 3DONA 3I6BA 3BGIA 5DTIA 1ATIA 1XYGA 2JGDB 2HAEA 4N3GA 3OJLA 1VBMA 5EJ8A 5C8XA 3KAKA 1U1IA 3UXHA 4Q3EA 4ATNA 1IH8A 3IMEA 4BNDA 2D7DA 4PXSA 4MZDA 3E4CA 3UA3A 2EKLA 5H16A 1TGYA 1I13A 3L5KA 5EFOA 1W49A 1M6WA 2FOXA 4YK7A 2D2IA 3HKCA 3W9UA 1NM5A 4JC4A 4GMKA 1EWRA 2JASA 1WUTA 5LJIA 4FYMA 3X44A 1S4UX 2Z6VA 2OYRA 1K6EA 1P7WA 2NZJA 4FOLA 2Y1WA 3L4JA 3FNEA 1O54A 4RH1A 2XVAA 1JIVA 1WXGA 3VYUB 1AKUA 2W00A 3IIEA 5A1TA 1TNDA 3AJ9A 2IY8A 4P9NA 1C4WA 2AD5A 1P1KA 4WCVA 2FEPA 4OOEA 5K9ZA 1UAYA 4GKKB 1F0YA 3ZQKA 3FMIA 4BLSA 1W5AA 5CAEA 1XEWY 3Q88A 4NU6A 4P3YA 3FCEA 1G8PA 3LD9A 2AGYA 3AW9A 5WRFA 1EB9A 5GONB 3ASYA 4ENSA 1T9HA 4BMXA 2K2QB 3KZMA 1RMTA 1NAIA 1TJ5A 3WL7A 3RLMD 4QJ5A 1DQRA 4YVDA 2NO6A 1MTOA 5JV5A 5BOSA 4N3CA 1X8KA 1IZ9A 3D4BA 4JR1A 3DKVA 1XRPA 2EZTA 3FAKA 3IOBA 2VH2A 3ENZA 3FKSD 4HS9A 3G7UA 5M29A 1LGYA 3ZJ5A 1VCIA 2ONZA 5KUTA 2PFSA 4C9BA 5ALEA 1N7IA 4B45A 4DM3A 1DCTA 4B5KA 3AETB 2MDTA 2PT5A 1SXJD 1SU4A 1YA4A 1ES9A 4TYPA 4P36A 4M8SA 2Z30A 2PBLA 2DLDA 3ITEA 3GEIA 4U9IS 4HDKA 3FB4A 4DBVO 3D7MA 1UBNA 1QS0B 4Y6SA 3V9FA 3N0DA 4XYBA 4UBLA 4UNPA 5E1DA 3BJEA 4LJLA 4WADA 5ARDA 2W6PA 4DDTA 3UJHA 4F4CA 4Y7RA 1KK1A 1AY0A 4QYIA 4ZT5A 2JCXA 3UG7A 1ZS9A 5HQ3A 1ZM4A 5K8TA 1T13A 2VAXA 4OM8A 4OMDA 1IBMB 1NLFA 4KAXA 4AYWA 2CFOA 3DG9A 4OJKA 4JYPA 1WXHA 1N5DA 4GRDA 4PSAA 3VHXB 1SZPA 1JA0A 1ADCA 3X43A 1XMQB 2D0IA 1JVBA 3SZMA 2D0PB 3SZRA 4FE4A 1ELOA 3ELBA 3ZWNA 4HDMA 1BQ4A 2V1XA 5L51A 4ARSA 4PG6A 5CNJA 3KXKA 1EQ2A 2PS9A 3G5UA 2YN0A 1YDGA 2ZROA 1Q0SA 4QTTB 2FHPA 2VEOA 3SVTA 4PONA 4B6QA 1HOXA 3A2NA 3A37A 4FKMA 2EQAA 2V8BA 3Q9NA 3WIVA 4JNKA 4GL2A 2H7CA 3I0NA 2AZMA 3B3JA 3QHQA 5IAGA 1AUOA 5IARA 3MQ4A 4MRMA 2VPZA 1MIHA 2H51A 1TQ2A 2GPAA 1E2PA 1U7DA 4C76A 5EJ4A 5AOBA 3ZLVA 2UZ0A 3MINB 4YT4A 4BFYA 2ODPA 2OHJA 1P5FA 2A2ZA 1SRRA 1U9ZA 3UXYA 5K0EA 3FYSA 3BGDA 1RQRA 3H8VA 3ETNA 1TUIA 3A10A 1OAAA 4LKOA 5AI5A 3C3PA 3E22B 3KKMA 4XUEA 3VYSB 2DHQA 2D3TA 1NNI1 4IIBA 5IGQA 2DZDA 2AE1A 1IN4A 1Q6YA 1UPUA 3AHHA 1RKQA 1HXHA 3WL3A 3EASA 4ZI3A 1XU9A 3TDNA 3TJZA 2DF8A 3BD8A 5BYAA 2GEJA 2GVDC 1M6VB 3B5IA 2IZ6A 4DRXA 2JEZA 2LXNA 2AVDA 3KQQA 2MU1A 2QSZA 2GMWA 1H1LA 3DAPA 2B1JA 2G9RA 3HCDA 4UCWA 2P8JA 3G13A 2HNBA 1FRVA 1GLVA 5CLQA 1W581 5KTNA 3R8FA 2VQSA 2PWAA 1I24A 1BW9B 4ND6A 4ENRA 4AS1A 1O6BA 1GPWB 5A9SB 2ZE7A 4P83A 3QVGA 4ADSG 4LJKA 1TYCA 4YRJA 4CHTA 4R2XA 1CW2B 3Q12A 4GM0A 4B9EA 5JNWA 1JXAA 3VVBA 1DXOA 4XLLA 3W6PA 3M7IA 4L9WA 3ICQB 5I8WA 1I32A 5AYVA 5TGDA 3UAZA 3WGGA 4AJ1A 1AZWA 4FOSA 3Q3IA 2R87A 2J3LA 3VPGA 3A3NA 2JLAA 2I65A 3U56A 4L2IA 3DAOA 1IOWA 4B7XA 2P27A 2Q27A 5FTWA 3SNHA 5G0WA 3QPVA 3O8RA 3WA6A 5JTUA 1T0JB 2IDMA 1LJLA 1DU4A 1H1DA 3NP9A 1D2HA 5H02A 5ELXA 5TQ0B 1YAJA 1ESDA 4LIPD 1UAAA 2WW8A 4DV3B 3IURA 3UICA 1KHHA 3S6JA 2IITA 3B85A 4YCMA 4A0SA 1NSYA 3C7KA 4RCZA 4PLYA 3AR7A 3DLPX 1JQBA 2GK7A 5E1BA 3EDRA 4LVNA 2P6NA 4TXNA 3BE4A 3H19A 3DVSX 3P71T 3M5DA 3R09A 3CNOA 3KTFA 1DCKA 3CLUD 4IH9A 4NYMQ 3FXAA 1D2RA 4O8CA 3OTGA 1PG5A 3G8YA 1KDYA 1CNMA 3INRA 5KKNB 3LOPA 1WCXA 5BN3A 2I4TA 3RMZD 2WV7A 1EAYA 3B6IA 3RJZA 1UK7A 5T57A 3S2EA 4A0AB 5H14A 3C7DB 4GL4A 4KGXA 1D2EA 1Y33E 4B7UA 3AUUA 1K4KA 4W63A 2NACA 4JA2A 2GKOA 2J9ZB 4KUGA 1PNQA 2ZB2A 1RKBA 3DHYA 3EVBA 3AVUA 4O3UB 2GCPA 4O2LA 1VI6A 4QDTA 2H9PA 1X1DA 1EVKA 4EVSA 3B2QA 3ESBA 4HDNB 2C2WA 1FXSA 2ZWAA 4JP2A 4JENA 1KS2A 3H9JA 1OBVA 3QYFA 4P81A 1FNCA 3KYIB 1UKCA 2Q28A 1XJ5A 4TMTA 1OXKB 1UR5A 1OAKA 4KSYA 3H5TA 1ISJA 4RC9A 2A9JA 5L6LB 4PAMA 2BCEA 4BHTA 2ZE8A 1Z5OA 2Q4DA 1E3WB 1FDOA 3BWVA 4WI1A 3O4HA 3F7TA 1GFSA 1QH9A 2ID4A 4GMHA 4C0SA 5J3JA 1KFCB 1Y48E 3DV9A 1XP8A 3C15C 3M6LA 1A7UA 1T34A 1QX3A 1R74A 3ONDA 5DNVA 4MWCA 4V0LA 4M9UA 3TG8A 2R86A 4K9SA 2XQFA 3AGQA 3CVUA 2JJ2A 5KHLB 4L4XA 3CW9A 1IFXA 2W6JD 4IRXA 2JK1A 5ECYA 1U6IA 2H1HA 3D6TB 3WLHA 4C4ZA 1EFTA 3BL8A 3TKLA 5CT4A 1HG1A 2FRXA 2YS7A 2ZBRA 2PV7A 5JNTA 2DBYA 3L7BA 4KK4A 1I51A 4L3GD 1P1BA 1UBRS 4FA5D 5FLXA 4LYAA 3ZDZA 1GU1A 4WY8A 4KGVA 1P0QA 3NHSA 3D81A 4Y2UA 3Q9SA 2D0DA 1YZUA 1M9NA 2OZLA 2XQJA 3MJHA 4Z8XA 5I7HA 2V4UA 4EW6A 1ORTA 2VTBB 3GZ4A 4EF5A 4BQNA 1NYTA 1NQVA 5CX1B 2YIDA 2PZ8A 3K6SB 4K5QA 2OCIA 4FMBB 2O0HA 4IMPA 4QDUA 2DFNA 2WG0A 3ND5A 3A1TA 3IIYA 2WTXA 1ZUIA 4ZQGA 1B1AA 2F1IA 4C3VA 1TMKA 2IT1A 2P0EA 2AN4A 4ZRNA 4JELA 1II8A 2VH5R 5A5GA 3B20A 3D5EA 1DWUA 3AIMA 2C7RA 2D1RA 4EHBA 1IL0A 3CY6A 2Z2NA 1B42A 2CEAA 2O0MA 4CMAA 3KEOA 4E3WA 2HK6A 2X1LA 3VKFA 3JQFC 3GLIB 4Z9YA 2YW2A 4G89A 1QPBA 5CFMA 3FPFA 4A3SA 4TQAA 1ZGBA 4BU0A 2ASEA 5C1BA 1Q11A 1I2MB 4Z6KA 1MC4A 4RD6A 3JWJA 4A8JB 1E64A 5DI9A 4I66A 4PO3X 3MELA 1AGXA 1JAIA 2BFCB 1PIWA 5AK5A 4OA8A 4ZCMA 3OIYA 1YTLA 4HDAA 3FETA 1PD0A 1YZVA 2HLDA 2QPAA 1RCTE 2RHLA 1CUXA 2QLJA 1PKXA 1F0KA 4JSYA 3UPTA 3KR1A 1JFLA 4BPRA 3AJ8A 2JH8A 1FU7A 4OYRA <