5HDBA

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 5hdbA00
2VDNA 1TYEA 2VC2A 3K72A 3VI3A 3V4PA 2VDQA 4IRZA 5HDBA 3FCUA 1U8CA 5E6SA 3T3PA 4Z7OA 4UM9A 2VDLA 3ZDXA 4MMZA 3ZE2A 4WK4A 2VDKA 5E6RA 1L5GA 1M1XA 3VI4A 3NIDA 3ZE0A 4Z7NA 3IJEA 3NIFA 3FCSA 2VDOA 4G1EA 4UM8A 5FFOA 4WK2A 4G1MA 3K6SA 4WJKA 2VDMA 3ZE1A 4MMXA 3ZDZA 4Z7QA 2VDRA 4WK0A 4NENA 2VDPA 5E6UA 3ZDYA 5FFGA 4MMYA 3T3MA 1JV2A 4O02A 3V4VA 3NIGA 3K71A
chains in the Genus database with same CATH superfamily
3V5WB 2QC5A 3C5MA 4D0KA 1A12A 5FLXg 3FRXA 3PSLA 4XYIA 3IUJA 5AJAA 3I8EA 4FAVD 1MDAH 2AGYA 3U4YA 5A2Qg 1GOFA 2XL3A 3NIDA 3RSEC 4KFMB 3IJEA 4LG8A 3FCSA 4BH6A 4RE5A 4A09B 4AN0A 3I7KA 3AH8B 1H2YA 5KDOB 1RI6A 3W15A 3ZDYA 1SQ9A 2BKLA 3CFSB 2H47A 4GM9A 4J81A 2P9LC 4AMZA 2QXVA 2J57G 1MG3A 4X60B 4JSPC 3JPXA 2HYEA 4JHPC 4L3GD 1VZ3A 4A08A 1MG2A 4E54A 1H2WA 2HU5A 4L1MA 1S4UX 5H14A 4UM8A 5FFOA 1GOHA 5HYNB 3SN6B 5EM2B 4XEIC 4Z7QA 2XL2A 3PVWB 1VYHC 5C86A 4J8GA 3F3FA 5SXMA 5HE0B 3SLED 3V4VA 3EU7A 4FA5D 4OWRA 2P9NC 3OKYB 2HKRA 1GXRA 1E8MA 5HDBA 2CE8A 3BG1A 4FB1D 5GMKn 3DDUA 4O45A 2I0SA 4I79A 2I3SA 3SMRA 4FA1D 3B7FA 1JJUB 5HE2B 4ZOYA 3ZE2A 2VDKA 2GC7A 1P22A 3CFVA 4QRJA 3ODTA 3JAMg 1O6GA 4U7AA 2IWKA 5M5RA 1N6DA 1N6FA 2AH1A 5M5UA 2PM6B 4J73A 4A7JA 4PSWB 3JRPA 2XZGA 3RMZD 4CI8A 4X3EA 3O4GA 2IUPA 3MXXA 3ORVD 4G55A 2B5MA 2YNNA 3FCUA 1A0RB 3RN0D 2HJBA 3EI2A 3PSCB 3SVWD 3IURA 4ESGA 5FKQA 1XHMA 2CN3A 2CN2A 2J56H 2VZ3A 1NR0A 2I0RA 3OKWA 3K6SA 1SHYB 3K27A 3MMYA 3F3PA 4GQ1A 4D6VA 4NSXA 5FFGA 2PM9A 5AMSA 2H13A 4Y5RD 4GQBB 4R7AB 2H6QA 1B9YA 2HESX 3PVUB 4J8BA 5FKRA 5H17A 3SBQA 4CY3A 2B5LA 2P9SC 5EARA 4X61B 3L4MD 3ULEC 3O4IA 5GSAA 4PXWA 3AL8A 1JMZB 4A11B 2H9LA 5I5IA 4GM8A 4U1EI 2YMUA 3FGBA 3QI0A 5GXHA 3I7NA 1YR2A 3IUQA 4G1MA 5TDHB 5I5MA 2H3XA 4O1QD 2HU7A 3DXMC 2OVRB 4BCCA 2OJYA 4NENA 2IWFA 2I0TA 1TYEA 1H2ZA 2AH0A 3IULA 3EQ8A 3EI4B 4AX4A 2XE4A 3EMHA 5TEFA 4UM9A 3NVXA 3ZDXA 2G99A 3OKYA 4WK4A 5CXBB 2IUQA 5K19A 4JSXC 3ZE0A 1PI6A 1VZ2A 2Z2PA 3JZHA 2H14A 3UVKA 2P9KC 3DM0A 3EI3B 2CO0C 4GGDA 2BCJB 1OMWB 3EI1B 4J77A 2CE9A 4PBZA 5AFU3 4J79A 5CYKB 4G56B 2H9MA 3FM0A 2VDNA 4PNKB 3IVMA 3A0FA 4CZXA 4FA9D 3IIWA 2HU8A 1YFQA 3T3PA 4GM3A 4FAND 3I2NA 4DNUA 2GNQA 4NAAA 1B9XA 4GMBA 3VI4A 3I7HA 4J86A 3MVDK 4H5JA 5C2VB 4CY5A 3GFCA 5K1CC 4CZVA 3SHFA 3KRWB 4H5IA 4CI1A 1T2XA 4NBMA 3PXSD 3J81g 3C99A 3EWEA 5E6UA 3RN1D 3QHYB 2EIDA 3MKSB 5EMMB 1JV2A 5IGOA 4FHLA 2EBSA 3OF7A 3RRMC 4J84A 3OL2B 4IRZA 4AMYA 2H68A 4GQ2P 4CY2A 2OVQB 3IUMA 4MMZA 2P9IC 5M5VA 1U4CA 4JHNA 1L0QA 1NEXB 5TF2A 4DNVA 5IJ8E 3MUOA 4A0AA 5C9ZB 3GC3B 1GOTB 3ZDZA 2BBKH 4CI2A 1K8KC 4QT8A 1JOFA 5HQGA 3J80g 4OZUA 4X63B 3VH0A 3I89A 3PXTD 2VZ1A 3V4PA 4BP9A 1U8CA 4IA9A 2AGWA 2H6KA 4CI3A 4IMMA 4J87A 5HE3B 3RFGA 2HJ4A 4NC4A 5FA5B 4A0BB 1C9IA 3OTTA 3SXTD 4ERQA 3IKOA 4O3UB 4JT6C 4LGNA 4A2MA 2MTAH 4Y7RA 1BPOA 4AEZA 4ERZA 4MMXA 2EIBA 4O3TB 5FKSA 4Z8LA 3L4OD 2IURA 3KCIA 2P9PC 2UZYB 3EI3A 4MK0B 3IIYA 3OKTA 3T3MA 3K71A 4A09A 3SWSD 4PC0A 2YNPA 3BWSA 1TYQC 5EMJB 4RE6A 5FKTA 4ZOZA 3I7OA 5CYKA 2TRCB 5CXCB 4BCDA 1XIPA 3JROA 1M1XA 5H1MA 1PGUA 2H9NA 3RLMD 3DXKC 4A2LA 4G1EA 3SCYA 2PM7B 4ZOXA 3V9FA 2VDRA 1OLZA 5EAMA 2JKXA 2AGLA 4MMYA 1QNIA 1XKSA 5C92A 2QZPA 4ERYA 2XU7A 1FWXA 5C2WB 2QR5A 2VC2A 5EM2A 3SFZA 2H9PA 2YB8B 3IJCA 2VDLA 2CO0A 4TZ4A 3OL2A 5EMKB 4CZYA 3I8CA 4L9OA 4DNWA 4Z7NA 3NIFA 1R5MA 3ZWLB 3JB9L 2H6NA 4CY1A 1O6FA 4O9DA 2OIZA 3UVOA 4EWRA 3C75H 3F3GA 3MZKA 1GOGA 2HKMA 5EAPA 4QQEA 4AOWA 4BP8A 3EI2B 1TBGA 4O02A 3SJLD 5FQDA 1PEVA 4D9SA 5B4WA 4FWWA 3K72A 3EQ9A 3JZGA 2GC4A 1JMXB 4K3ID 4UI9R 1QFSA 3UKUC 3MUNA 4BL0A 2PM9B 1ERJA 4ES0A 2IAAA 1VE7A 1K3IA 1H2XA 3PXWD 1QFMA 4J0XA 4WJKA 4E5ZB 1K32A 4A0BA 3JZNA 4JD2C 4BUJC 2B4EA 4L1QD 3O4HA 3NIGA 3AL8B 3DSMA 4HDJA 1E8NA 2WQ8A 1C9LA 2PBIB 3AFCA 3N0EA 4O2WA 2AQ5A 3UKRC 2EIEA 2YBAA 3GD1I 2Q7QA 3VGZA 5E6RA 3MZLA 4JSVC 1VE6A 3I7LA 2OK6A 5CXCA 5IT9g 3EG6A 3PE7A 2YNOA 5TEEA 3ZE1A 2I3TA 4QAMA 4XYHA 4GZ8A 3SBPA 1UOQA 2VDPA 3DWLC 2Z2NA 4A11A 4FA4D 4J82A 5GXIA 3CIKB 4K3JB 5IJ7E 3VI3A 1SQJA 4BCBA 2VDQA 2B5NA 5THAA 2J55H 2HXCA 5EMLB 5JWZA 2OVPB 2CNXA 2XYIA 2XDWA 3EI4A 2VDOA 3EQ7A 3P4FA 2EICA 2P9UC 3KRXB 4WK2A 3I7PA 1GP2B 5CXBA 4CC9A 2AGZA 3IUNA 1Q47A 4AN1A 2Z2OA 1E5TA 3GREA 3IJ0A 5M61A 3O4JA 5FXYA 3AL9A 4A08B 5HE1B 5M5SA 4E54B 3EI1A 1UOPA 3UVNA 2O9KA 3BG0A 5E6SA 4Z7OA 1JTDB 5EALA 3HFQA 3V7DB 5M5TA 1U2VC 4JSNC 4J78A 4L3HD 1PBYB 5IC7A 4YVDA 4ZN4A 2AGXA 2W18A 3IJ1A 2G9AA 4E5ZA 1UOOA 5IGQA 1N6EA 4JT5C 4QL1A 3UR4A 3E0CA 2OK4A 3N0DA 5I5JA 4A0AB 3MKQA 2IUVA 4ZOVA 1I2MB 4JXMA 1L5GA 3C9CA 3VA6A 4LG9A 4PBYA 3NVQA 4PSXB 3UVLA 4J0WA 3RFHA 3K26A 2VDMA 3OW8A 2UZXB 3NVNA 4GGCA 3SBRA 4N14A 4WK0A 4GGAA 1UTCA 3UVMA 1GG2B
chains in the Genus database with same CATH topology
2VDNA 1TYEA 2VC2A 3K72A 3VI3A 3V4PA 2VDQA 4IRZA 5HDBA 3FCUA 1U8CA 5E6SA 3T3PA 4Z7OA 4UM9A 2VDLA 3ZDXA 4MMZA 3ZE2A 4WK4A 2VDKA 5E6RA 1L5GA 1M1XA 3VI4A 3NIDA 3ZE0A 4Z7NA 3IJEA 3NIFA 3FCSA 2VDOA 4G1EA 4UM8A 5FFOA 4WK2A 4G1MA 3K6SA 4WJKA 2VDMA 3ZE1A 4MMXA 3ZDZA 4Z7QA 2VDRA 4WK0A 4NENA 2VDPA 5E6UA 3ZDYA 5FFGA 4MMYA 3T3MA 1JV2A 4O02A 3V4VA 3NIGA 3K71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDN A;  1TYE A;  2VC2 A;  3K72 A;  3VI3 A;  3V4P A;  2VDQ A;  4IRZ A;  5HDB A;  3FCU A;  1U8C A;  5E6S A;  3T3P A;  4Z7O A;  4UM9 A;  2VDL A;  3ZDX A;  4MMZ A;  3ZE2 A;  4WK4 A;  2VDK A;  5E6R A;  1L5G A;  1M1X A;  3VI4 A;  3NID A;  3ZE0 A;  4Z7N A;  3IJE A;  3NIF A;  3FCS A;  2VDO A;  4G1E A;  4UM8 A;  5FFO A;  4WK2 A;  4G1M A;  3K6S A;  4WJK A;  2VDM A;  3ZE1 A;  4MMX A;  3ZDZ A;  4Z7Q A;  2VDR A;  4WK0 A;  4NEN A;  2VDP A;  5E6U A;  3ZDY A;  5FFG A;  4MMY A;  3T3M A;  1JV2 A;  4O02 A;  3V4V A;  3NIG A;  3K71 A; 
#chains in the Genus database with same CATH topology
 3V5W B;  2QC5 A;  3C5M A;  4D0K A;  1A12 A;  5FLX g;  3FRX A;  3PSL A;  4XYI A;  3IUJ A;  5AJA A;  3I8E A;  4FAV D;  1MDA H;  2AGY A;  3U4Y A;  5A2Q g;  1GOF A;  2XL3 A;  3NID A;  3RSE C;  4KFM B;  3IJE A;  4LG8 A;  3FCS A;  4BH6 A;  4RE5 A;  4A09 B;  4AN0 A;  3I7K A;  3AH8 B;  1H2Y A;  5KDO B;  1RI6 A;  3W15 A;  3ZDY A;  1SQ9 A;  2BKL A;  3CFS B;  2H47 A;  4GM9 A;  4J81 A;  2P9L C;  4AMZ A;  2QXV A;  2J57 G;  1MG3 A;  4X60 B;  4JSP C;  3JPX A;  2HYE A;  4JHP C;  4L3G D;  1VZ3 A;  4A08 A;  1MG2 A;  4E54 A;  1H2W A;  2HU5 A;  4L1M A;  1S4U X;  5H14 A;  4UM8 A;  5FFO A;  1GOH A;  5HYN B;  3SN6 B;  5EM2 B;  4XEI C;  4Z7Q A;  2XL2 A;  3PVW B;  1VYH C;  5C86 A;  4J8G A;  3F3F A;  5SXM A;  5HE0 B;  3SLE D;  3V4V A;  3EU7 A;  4FA5 D;  4OWR A;  2P9N C;  3OKY B;  2HKR A;  1GXR A;  1E8M A;  5HDB A;  2CE8 A;  3BG1 A;  4FB1 D;  5GMK n;  3DDU A;  4O45 A;  2I0S A;  4I79 A;  2I3S A;  3SMR A;  4FA1 D;  3B7F A;  1JJU B;  5HE2 B;  4ZOY A;  3ZE2 A;  2VDK A;  2GC7 A;  1P22 A;  3CFV A;  4QRJ A;  3ODT A;  3JAM g;  1O6G A;  4U7A A;  2IWK A;  5M5R A;  1N6D A;  1N6F A;  2AH1 A;  5M5U A;  2PM6 B;  4J73 A;  4A7J A;  4PSW B;  3JRP A;  2XZG A;  3RMZ D;  4CI8 A;  4X3E A;  3O4G A;  2IUP A;  3MXX A;  3ORV D;  4G55 A;  2B5M A;  2YNN A;  3FCU A;  1A0R B;  3RN0 D;  2HJB A;  3EI2 A;  3PSC B;  3SVW D;  3IUR A;  4ESG A;  5FKQ A;  1XHM A;  2CN3 A;  2CN2 A;  2J56 H;  2VZ3 A;  1NR0 A;  2I0R A;  3OKW A;  3K6S A;  1SHY B;  3K27 A;  3MMY A;  3F3P A;  4GQ1 A;  4D6V A;  4NSX A;  5FFG A;  2PM9 A;  5AMS A;  2H13 A;  4Y5R D;  4GQB B;  4R7A B;  2H6Q A;  1B9Y A;  2HES X;  3PVU B;  4J8B A;  5FKR A;  5H17 A;  3SBQ A;  4CY3 A;  2B5L A;  2P9S C;  5EAR A;  4X61 B;  3L4M D;  3ULE C;  3O4I A;  5GSA A;  4PXW A;  3AL8 A;  1JMZ B;  4A11 B;  2H9L A;  5I5I A;  4GM8 A;  4U1E I;  2YMU A;  3FGB A;  3QI0 A;  5GXH A;  3I7N A;  1YR2 A;  3IUQ A;  4G1M A;  5TDH B;  5I5M A;  2H3X A;  4O1Q D;  2HU7 A;  3DXM C;  2OVR B;  4BCC A;  2OJY A;  4NEN A;  2IWF A;  2I0T A;  1TYE A;  1H2Z A;  2AH0 A;  3IUL A;  3EQ8 A;  3EI4 B;  4AX4 A;  2XE4 A;  3EMH A;  5TEF A;  4UM9 A;  3NVX A;  3ZDX A;  2G99 A;  3OKY A;  4WK4 A;  5CXB B;  2IUQ A;  5K19 A;  4JSX C;  3ZE0 A;  1PI6 A;  1VZ2 A;  2Z2P A;  3JZH A;  2H14 A;  3UVK A;  2P9K C;  3DM0 A;  3EI3 B;  2CO0 C;  4GGD A;  2BCJ B;  1OMW B;  3EI1 B;  4J77 A;  2CE9 A;  4PBZ A;  5AFU 3;  4J79 A;  5CYK B;  4G56 B;  2H9M A;  3FM0 A;  2VDN A;  4PNK B;  3IVM A;  3A0F A;  4CZX A;  4FA9 D;  3IIW A;  2HU8 A;  1YFQ A;  3T3P A;  4GM3 A;  4FAN D;  3I2N A;  4DNU A;  2GNQ A;  4NAA A;  1B9X A;  4GMB A;  3VI4 A;  3I7H A;  4J86 A;  3MVD K;  4H5J A;  5C2V B;  4CY5 A;  3GFC A;  5K1C C;  4CZV A;  3SHF A;  3KRW B;  4H5I A;  4CI1 A;  1T2X A;  4NBM A;  3PXS D;  3J81 g;  3C99 A;  3EWE A;  5E6U A;  3RN1 D;  3QHY B;  2EID A;  3MKS B;  5EMM B;  1JV2 A;  5IGO A;  4FHL A;  2EBS A;  3OF7 A;  3RRM C;  4J84 A;  3OL2 B;  4IRZ A;  4AMY A;  2H68 A;  4GQ2 P;  4CY2 A;  2OVQ B;  3IUM A;  4MMZ A;  2P9I C;  5M5V A;  1U4C A;  4JHN A;  1L0Q A;  1NEX B;  5TF2 A;  4DNV A;  5IJ8 E;  3MUO A;  4A0A A;  5C9Z B;  3GC3 B;  1GOT B;  3ZDZ A;  2BBK H;  4CI2 A;  1K8K C;  4QT8 A;  1JOF A;  5HQG A;  3J80 g;  4OZU A;  4X63 B;  3VH0 A;  3I89 A;  3PXT D;  2VZ1 A;  3V4P A;  4BP9 A;  1U8C A;  4IA9 A;  2AGW A;  2H6K A;  4CI3 A;  4IMM A;  4J87 A;  5HE3 B;  3RFG A;  2HJ4 A;  4NC4 A;  5FA5 B;  4A0B B;  1C9I A;  3OTT A;  3SXT D;  4ERQ A;  3IKO A;  4O3U B;  4JT6 C;  4LGN A;  4A2M A;  2MTA H;  4Y7R A;  1BPO A;  4AEZ A;  4ERZ A;  4MMX A;  2EIB A;  4O3T B;  5FKS A;  4Z8L A;  3L4O D;  2IUR A;  3KCI A;  2P9P C;  2UZY B;  3EI3 A;  4MK0 B;  3IIY A;  3OKT A;  3T3M A;  3K71 A;  4A09 A;  3SWS D;  4PC0 A;  2YNP A;  3BWS A;  1TYQ C;  5EMJ B;  4RE6 A;  5FKT A;  4ZOZ A;  3I7O A;  5CYK A;  2TRC B;  5CXC B;  4BCD A;  1XIP A;  3JRO A;  1M1X A;  5H1M A;  1PGU A;  2H9N A;  3RLM D;  3DXK C;  4A2L A;  4G1E A;  3SCY A;  2PM7 B;  4ZOX A;  3V9F A;  2VDR A;  1OLZ A;  5EAM A;  2JKX A;  2AGL A;  4MMY A;  1QNI A;  1XKS A;  5C92 A;  2QZP A;  4ERY A;  2XU7 A;  1FWX A;  5C2W B;  2QR5 A;  2VC2 A;  5EM2 A;  3SFZ A;  2H9P A;  2YB8 B;  3IJC A;  2VDL A;  2CO0 A;  4TZ4 A;  3OL2 A;  5EMK B;  4CZY A;  3I8C A;  4L9O A;  4DNW A;  4Z7N A;  3NIF A;  1R5M A;  3ZWL B;  3JB9 L;  2H6N A;  4CY1 A;  1O6F A;  4O9D A;  2OIZ A;  3UVO A;  4EWR A;  3C75 H;  3F3G A;  3MZK A;  1GOG A;  2HKM A;  5EAP A;  4QQE A;  4AOW A;  4BP8 A;  3EI2 B;  1TBG A;  4O02 A;  3SJL D;  5FQD A;  1PEV A;  4D9S A;  5B4W A;  4FWW A;  3K72 A;  3EQ9 A;  3JZG A;  2GC4 A;  1JMX B;  4K3I D;  4UI9 R;  1QFS A;  3UKU C;  3MUN A;  4BL0 A;  2PM9 B;  1ERJ A;  4ES0 A;  2IAA A;  1VE7 A;  1K3I A;  1H2X A;  3PXW D;  1QFM A;  4J0X A;  4WJK A;  4E5Z B;  1K32 A;  4A0B A;  3JZN A;  4JD2 C;  4BUJ C;  2B4E A;  4L1Q D;  3O4H A;  3NIG A;  3AL8 B;  3DSM A;  4HDJ A;  1E8N A;  2WQ8 A;  1C9L A;  2PBI B;  3AFC A;  3N0E A;  4O2W A;  2AQ5 A;  3UKR C;  2EIE A;  2YBA A;  3GD1 I;  2Q7Q A;  3VGZ A;  5E6R A;  3MZL A;  4JSV C;  1VE6 A;  3I7L A;  2OK6 A;  5CXC A;  5IT9 g;  3EG6 A;  3PE7 A;  2YNO A;  5TEE A;  3ZE1 A;  2I3T A;  4QAM A;  4XYH A;  4GZ8 A;  3SBP A;  1UOQ A;  2VDP A;  3DWL C;  2Z2N A;  4A11 A;  4FA4 D;  4J82 A;  5GXI A;  3CIK B;  4K3J B;  5IJ7 E;  3VI3 A;  1SQJ A;  4BCB A;  2VDQ A;  2B5N A;  5THA A;  2J55 H;  2HXC A;  5EML B;  5JWZ A;  2OVP B;  2CNX A;  2XYI A;  2XDW A;  3EI4 A;  2VDO A;  3EQ7 A;  3P4F A;  2EIC A;  2P9U C;  3KRX B;  4WK2 A;  3I7P A;  1GP2 B;  5CXB A;  4CC9 A;  2AGZ A;  3IUN A;  1Q47 A;  4AN1 A;  2Z2O A;  1E5T A;  3GRE A;  3IJ0 A;  5M61 A;  3O4J A;  5FXY A;  3AL9 A;  4A08 B;  5HE1 B;  5M5S A;  4E54 B;  3EI1 A;  1UOP A;  3UVN A;  2O9K A;  3BG0 A;  5E6S A;  4Z7O A;  1JTD B;  5EAL A;  3HFQ A;  3V7D B;  5M5T A;  1U2V C;  4JSN C;  4J78 A;  4L3H D;  1PBY B;  5IC7 A;  4YVD A;  4ZN4 A;  2AGX A;  2W18 A;  3IJ1 A;  2G9A A;  4E5Z A;  1UOO A;  5IGQ A;  1N6E A;  4JT5 C;  4QL1 A;  3UR4 A;  3E0C A;  2OK4 A;  3N0D A;  5I5J A;  4A0A B;  3MKQ A;  2IUV A;  4ZOV A;  1I2M B;  4JXM A;  1L5G A;  3C9C A;  3VA6 A;  4LG9 A;  4PBY A;  3NVQ A;  4PSX B;  3UVL A;  4J0W A;  3RFH A;  3K26 A;  2VDM A;  3OW8 A;  2UZX B;  3NVN A;  4GGC A;  3SBR A;  4N14 A;  4WK0 A;  4GGA A;  1UTC A;  3UVM A;  1GG2 B; 
#chains in the Genus database with same CATH homology
 2VDN A;  1TYE A;  2VC2 A;  3K72 A;  3VI3 A;  3V4P A;  2VDQ A;  4IRZ A;  5HDB A;  3FCU A;  1U8C A;  5E6S A;  3T3P A;  4Z7O A;  4UM9 A;  2VDL A;  3ZDX A;  4MMZ A;  3ZE2 A;  4WK4 A;  2VDK A;  5E6R A;  1L5G A;  1M1X A;  3VI4 A;  3NID A;  3ZE0 A;  4Z7N A;  3IJE A;  3NIF A;  3FCS A;  2VDO A;  4G1E A;  4UM8 A;  5FFO A;  4WK2 A;  4G1M A;  3K6S A;  4WJK A;  2VDM A;  3ZE1 A;  4MMX A;  3ZDZ A;  4Z7Q A;  2VDR A;  4WK0 A;  4NEN A;  2VDP A;  5E6U A;  3ZDY A;  5FFG A;  4MMY A;  3T3M A;  1JV2 A;  4O02 A;  3V4V A;  3NIG A;  3K71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...