5HDBA

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 5hdbA00
3NIGA 2VDLA 3ZDYA 5HDBA 2VDQA 5FFGA 4IRZA 4G1EA 4Z7OA 5E6UA 1M1XA 3VI3A 4NENA 3IJEA 3ZE1A 1U8CA 3T3MA 4WJKA 4Z7NA 2VDKA 3V4VA 3T3PA 2VC2A 3ZE2A 3FCUA 2VDPA 4WK4A 4WK0A 3NIFA 4WK2A 3K72A 4G1MA 3K6SA 4UM8A 4O02A 1TYEA 2VDRA 2VDOA 1L5GA 4UM9A 3VI4A 3K71A 3ZDXA 2VDMA 4MMZA 5E6SA 3ZE0A 4MMXA 5E6RA 2VDNA 3V4PA 3ZDZA 4Z7QA 1JV2A 3NIDA 3FCSA 5FFOA 4MMYA
chains in the Genus database with same CATH superfamily
5I5IA 3FGBA 3OL2A 5EAMA 4BCDA 4FAND 4XYHA 3IJ1A 1GP2B 3AFCA 4CY5A 4DNUA 1C9LA 3EI3A 3UVNA 1OLZA 2CO0C 5HE2B 2UZXB 4JSXC 4J8GA 2HYEA 4O02A 5EAPA 5GXHA 2IAAA 1RI6A 3OTTA 3CFSB 4PBZA 2OK6A 3PSCB 4J84A 3IVMA 3C5MA 3SHFA 4L9OA 1SQJA 3K27A 3UVOA 1JOFA 4CI2A 3I2NA 2OIZA 3V7DB 3KRWB 5IGQA 1MG2A 4AMZA 4FHLA 4ESGA 3IURA 5C2VB 2YNNA 3DXMC 5C2WB 1L5GA 5FQDA 2QR5A 3DSMA 4R7AB 5HE1B 4CI1A 3MZKA 4ZOVA 3DM0A 2HU8A 3IUQA 5M5SA 3OW8A 2IUQA 4ERYA 3O4JA 2EICA 3ZDYA 3KCIA 3CFVA 3MVDK 1E8MA 1Q47A 2JKXA 5M5VA 4X60B 3IJEA 1QNIA 3CIKB 3GFCA 2OVPB 3K26A 3IIWA 4K3JB 4J87A 4LG8A 4PXWA 3SMRA 2YB8B 3UKUC 3J80g 2PBIB 2P9KC 3T3PA 3OKWA 2J56H 2I0TA 3DXKC 1TYQC 1B9XA 3IUNA 5M5TA 5HQGA 4Z7QA 3EWEA 4D9SA 1R5MA 4ZOZA 2YMUA 4XEIC 4Z8LA 3EQ7A 5M5RA 4IMMA 5SXMA 5H17A 4Z7OA 4A0AB 3MUOA 5C86A 4A11A 3EI4B 4GMBA 1U2VC 1GG2B 2P9UC 4J79A 3C99A 2CE9A 3ZE2A 2EIDA 4WK4A 5K19A 4U7AA 3SJLD 1YFQA 4JHPC 3I7KA 4PNKB 3O4IA 4QQEA 3SBPA 5EALA 3W15A 2B5LA 4K3ID 1FWXA 2BCJB 2VDNA 3V4PA 3MXXA 3IUJA 2BKLA 3EI3B 3SCYA 4E54B 2AQ5A 4AEZA 4AOWA 3OF7A 2VDLA 2Z2PA 3IJCA 2YBAA 3VGZA 3PVUB 5TEEA 3ZWLB 4E5ZB 1OMWB 2AGXA 1PBYB 2CE8A 4L3GD 4LGNA 3FM0A 3N0DA 1XHMA 3K6SA 1L0QA 3GC3B 3DDUA 2YNOA 4D6VA 4J8BA 3JROA 4J82A 4O45A 3U4YA 3EI1B 5KDOB 2HKRA 3ORVD 3MKQA 4A7JA 1GOGA 3EQ8A 3UVKA 1VZ2A 2I0RA 2WQ8A 2H6QA 4AMYA 2Z2OA 3F3GA 2H9LA 5CXBA 1C9IA 5HDBA 3I8EA 1TBGA 4QT8A 2P9LC 3IKOA 2H9MA 4O3TB 5FKSA 4NENA 4J81A 5AMSA 3IJ0A 3UR4A 3RRMC 4FA4D 4NSXA 3MUNA 3RFGA 2Z2NA 2HKMA 5IGOA 2VDRA 3VI4A 2BBKH 4A09B 1H2YA 3MZLA 5E6RA 4A0BB 5C9ZB 3C75H 4E5ZA 2AH1A 3SBQA 3AL8B 4CI3A 3OL2B 1PEVA 2P9NC 1N6DA 2EBSA 1K8KC 3NVXA 3J81g 5JWZA 1JMXB 1U4CA 4AX4A 5HE3B 4G1EA 4A2LA 1H2XA 3GREA 4ZN4A 2H3XA 3I7HA 4L1QD 2GNQA 4J0XA 4PBYA 5IC7A 4OZUA 1SHYB 3RN0D 5IT9g 2IWKA 4O3UB 3K72A 3V5WB 3IIYA 4J86A 4CY1A 2H6KA 4I79A 3OKTA 4AN1A 5FA5B 2UZYB 4GM3A 3ODTA 4A0AA 1JJUB 4ERZA 5EM2B 5E6SA 1VYHC 3SXTD 4X61B 4GGDA 3F3PA 2GC7A 4GQBB 4BH6A 2I3TA 5IJ8E 2P9PC 2VDQA 2MTAH 4D0KA 3VH0A 1GOHA 1N6FA 4YVDA 5AJAA 2OVQB 5TEFA 4XYIA 3T3MA 1VE7A 5EMKB 4Y5RD 3EI2A 3RMZD 4CZVA 5I5MA 3IULA 1PGUA 2VDOA 3I8CA 3ZDXA 4CI8A 2PM6B 4BL0A 3SFZA 4J77A 3EU7A 5AFU3 4DNWA 1A0RB 4GZ8A 3NIGA 5FFGA 2P9IC 4BP8A 3KRXB 2GC4A 1M1XA 1GXRA 4GGAA 3VI3A 1VE6A 4J73A 4O2WA 4E54A 3MMYA 4HDJA 2VDKA 3V4VA 1QFSA 2VC2A 4KFMB 5HYNB 3NIFA 3BG1A 2VZ3A 5FLXg 4PSWB 3FRXA 4UM9A 2EIBA 1K3IA 3UVLA 1NR0A 4FWWA 2H9NA 3NIDA 3VA6A 4CZYA 4ERQA 3B7FA 1PI6A 4JT6C 2TRCB 4O1QD 4A11B 2G9AA 3EI1A 4NAAA 3PVWB 1O6GA 3HFQA 5EMLB 1UOPA 3I7NA 3EQ9A 2Q7QA 3PXTD 4DNVA 5CYKB 2O9KA 4WK2A 4NC4A 3SWSD 2XYIA 4G55A 5GMKn 3I89A 2VDMA 3EI2B 2J57G 2AGWA 5FKRA 3QI0A 2B5NA 5H1MA 3FCSA 4ES0A 5FFOA 2XU7A 2QXVA 4ZOXA 4Y7RA 3L4MD 1NEXB 3RFHA 4UI9R 4IRZA 5CYKA 5CXBB 2IUPA 3PXWD 1MDAH 2AGZA 2PM7B 4G1MA 3MKSB 4PC0A 2HU7A 1A12A 3BG0A 5B4WA 1E8NA 2B4EA 3AL9A 2YNPA 4BUJC 2OVRB 2HJ4A 4A2MA 4TZ4A 3PSLA 5A2Qg 1P22A 3ULEC 5EM2A 3RN1D 3AL8A 1E5TA 2AGYA 1YR2A 3JZNA 3F3FA 1GOFA 4X3EA 3FCUA 4WK0A 2J55H 3IUMA 2PM9A 4BP9A 3OKYB 4UM8A 4CC9A 2P9SC 1TYEA 2OJYA 3K71A 4JT5C 4MMZA 2AGLA 4MMXA 1JMZB 2CN3A 3C9CA 4JSPC 3ZDZA 4EWRA 1K32A 3I7OA 3PXSD 1O6FA 5GSAA 4JXMA 2XDWA 2CN2A 4H5JA 4JSVC 4MMYA 3UVMA 4BCBA 5HE0B 2PM9B 4J0WA 4A08B 4GGCA 4RE6A 1T2XA 3PE7A 5E6UA 3L4OD 3A0FA 4A0BA 1U8CA 4FA1D 2H14A 5FKQA 4ZOYA 4O9DA 5C92A 3SN6B 3I7LA 5GXIA 5EMJB 2XL2A 2IUVA 4X63B 4G56B 4J78A 5CXCB 2VZ1A 3EMHA 1I2MB 3ZE0A 5FXYA 1ERJA 4GQ2P 5TDHB 2IWFA 3EG6A 3SBRA 2H13A 2XE4A 4LG9A 3JPXA 5H14A 4JHNA 3V9FA 5EMMB 3NVQA 3RSEC 3I7PA 1GOTB 3DWLC 3QHYB 1H2ZA 2G99A 4CZXA 3BWSA 3NVNA 2VDPA 1VZ3A 2OK4A 2W18A 5TF2A 3JZHA 4L3HD 1JTDB 1H2WA 3O4GA 2H6NA 2HXCA 1UTCA 4A08A 2QZPA 5I5JA 3JAMg 4U1EI 2I3SA 1UOQA 3JRPA 3P4FA 4A09A 5FKTA 5EARA 3N0EA 4L1MA 1MG3A 5M61A 5M5UA 2XZGA 1XIPA 2H47A 4QL1A 3RLMD 2HU5A 4WJKA 4Z7NA 4QAMA 4BCCA 1UOOA 4PSXB 1QFMA 4FA9D 4NBMA 4JD2C 3EI4A 1B9YA 2HJBA 2IURA 5K1CC 4QRJA 2EIEA 1JV2A 4IA9A 4MK0B 1SQ9A 5CXCA 3O4HA 3SVWD 4RE5A 4CY3A 1BPOA 1XKSA 2H9PA 3JB9L 2QC5A 4GM9A 4JSNC 4FB1D 3ZE1A 1S4UX 2CNXA 3AH8B 2AH0A 3SLED 4AN0A 5THAA 2B5MA 4OWRA 2HESX 4FA5D 1N6EA 2H68A 4N14A 4GM8A 3E0CA 4CY2A 4GQ1A 3GD1I 5IJ7E 2XL3A 3UKRC 4H5IA 4FAVD 2CO0A 2I0SA 3OKYA 3JZGA
chains in the Genus database with same CATH topology
3NIGA 2VDLA 3ZDYA 5HDBA 2VDQA 5FFGA 4IRZA 4G1EA 4Z7OA 5E6UA 1M1XA 3VI3A 4NENA 3IJEA 3ZE1A 1U8CA 3T3MA 4WJKA 4Z7NA 2VDKA 3V4VA 3T3PA 2VC2A 3ZE2A 3FCUA 2VDPA 4WK4A 4WK0A 3NIFA 4WK2A 3K72A 4G1MA 3K6SA 4UM8A 4O02A 1TYEA 2VDRA 2VDOA 1L5GA 4UM9A 3VI4A 3K71A 3ZDXA 2VDMA 4MMZA 5E6SA 3ZE0A 4MMXA 5E6RA 2VDNA 3V4PA 3ZDZA 4Z7QA 1JV2A 3NIDA 3FCSA 5FFOA 4MMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIG A;  2VDL A;  3ZDY A;  5HDB A;  2VDQ A;  5FFG A;  4IRZ A;  4G1E A;  4Z7O A;  5E6U A;  1M1X A;  3VI3 A;  4NEN A;  3IJE A;  3ZE1 A;  1U8C A;  3T3M A;  4WJK A;  4Z7N A;  2VDK A;  3V4V A;  3T3P A;  2VC2 A;  3ZE2 A;  3FCU A;  2VDP A;  4WK4 A;  4WK0 A;  3NIF A;  4WK2 A;  3K72 A;  4G1M A;  3K6S A;  4UM8 A;  4O02 A;  1TYE A;  2VDR A;  2VDO A;  1L5G A;  4UM9 A;  3VI4 A;  3K71 A;  3ZDX A;  2VDM A;  4MMZ A;  5E6S A;  3ZE0 A;  4MMX A;  5E6R A;  2VDN A;  3V4P A;  3ZDZ A;  4Z7Q A;  1JV2 A;  3NID A;  3FCS A;  5FFO A;  4MMY A; 
#chains in the Genus database with same CATH topology
 5I5I A;  3FGB A;  3OL2 A;  5EAM A;  4BCD A;  4FAN D;  4XYH A;  3IJ1 A;  1GP2 B;  3AFC A;  4CY5 A;  4DNU A;  1C9L A;  3EI3 A;  3UVN A;  1OLZ A;  2CO0 C;  5HE2 B;  2UZX B;  4JSX C;  4J8G A;  2HYE A;  4O02 A;  5EAP A;  5GXH A;  2IAA A;  1RI6 A;  3OTT A;  3CFS B;  4PBZ A;  2OK6 A;  3PSC B;  4J84 A;  3IVM A;  3C5M A;  3SHF A;  4L9O A;  1SQJ A;  3K27 A;  3UVO A;  1JOF A;  4CI2 A;  3I2N A;  2OIZ A;  3V7D B;  3KRW B;  5IGQ A;  1MG2 A;  4AMZ A;  4FHL A;  4ESG A;  3IUR A;  5C2V B;  2YNN A;  3DXM C;  5C2W B;  1L5G A;  5FQD A;  2QR5 A;  3DSM A;  4R7A B;  5HE1 B;  4CI1 A;  3MZK A;  4ZOV A;  3DM0 A;  2HU8 A;  3IUQ A;  5M5S A;  3OW8 A;  2IUQ A;  4ERY A;  3O4J A;  2EIC A;  3ZDY A;  3KCI A;  3CFV A;  3MVD K;  1E8M A;  1Q47 A;  2JKX A;  5M5V A;  4X60 B;  3IJE A;  1QNI A;  3CIK B;  3GFC A;  2OVP B;  3K26 A;  3IIW A;  4K3J B;  4J87 A;  4LG8 A;  4PXW A;  3SMR A;  2YB8 B;  3UKU C;  3J80 g;  2PBI B;  2P9K C;  3T3P A;  3OKW A;  2J56 H;  2I0T A;  3DXK C;  1TYQ C;  1B9X A;  3IUN A;  5M5T A;  5HQG A;  4Z7Q A;  3EWE A;  4D9S A;  1R5M A;  4ZOZ A;  2YMU A;  4XEI C;  4Z8L A;  3EQ7 A;  5M5R A;  4IMM A;  5SXM A;  5H17 A;  4Z7O A;  4A0A B;  3MUO A;  5C86 A;  4A11 A;  3EI4 B;  4GMB A;  1U2V C;  1GG2 B;  2P9U C;  4J79 A;  3C99 A;  2CE9 A;  3ZE2 A;  2EID A;  4WK4 A;  5K19 A;  4U7A A;  3SJL D;  1YFQ A;  4JHP C;  3I7K A;  4PNK B;  3O4I A;  4QQE A;  3SBP A;  5EAL A;  3W15 A;  2B5L A;  4K3I D;  1FWX A;  2BCJ B;  2VDN A;  3V4P A;  3MXX A;  3IUJ A;  2BKL A;  3EI3 B;  3SCY A;  4E54 B;  2AQ5 A;  4AEZ A;  4AOW A;  3OF7 A;  2VDL A;  2Z2P A;  3IJC A;  2YBA A;  3VGZ A;  3PVU B;  5TEE A;  3ZWL B;  4E5Z B;  1OMW B;  2AGX A;  1PBY B;  2CE8 A;  4L3G D;  4LGN A;  3FM0 A;  3N0D A;  1XHM A;  3K6S A;  1L0Q A;  3GC3 B;  3DDU A;  2YNO A;  4D6V A;  4J8B A;  3JRO A;  4J82 A;  4O45 A;  3U4Y A;  3EI1 B;  5KDO B;  2HKR A;  3ORV D;  3MKQ A;  4A7J A;  1GOG A;  3EQ8 A;  3UVK A;  1VZ2 A;  2I0R A;  2WQ8 A;  2H6Q A;  4AMY A;  2Z2O A;  3F3G A;  2H9L A;  5CXB A;  1C9I A;  5HDB A;  3I8E A;  1TBG A;  4QT8 A;  2P9L C;  3IKO A;  2H9M A;  4O3T B;  5FKS A;  4NEN A;  4J81 A;  5AMS A;  3IJ0 A;  3UR4 A;  3RRM C;  4FA4 D;  4NSX A;  3MUN A;  3RFG A;  2Z2N A;  2HKM A;  5IGO A;  2VDR A;  3VI4 A;  2BBK H;  4A09 B;  1H2Y A;  3MZL A;  5E6R A;  4A0B B;  5C9Z B;  3C75 H;  4E5Z A;  2AH1 A;  3SBQ A;  3AL8 B;  4CI3 A;  3OL2 B;  1PEV A;  2P9N C;  1N6D A;  2EBS A;  1K8K C;  3NVX A;  3J81 g;  5JWZ A;  1JMX B;  1U4C A;  4AX4 A;  5HE3 B;  4G1E A;  4A2L A;  1H2X A;  3GRE A;  4ZN4 A;  2H3X A;  3I7H A;  4L1Q D;  2GNQ A;  4J0X A;  4PBY A;  5IC7 A;  4OZU A;  1SHY B;  3RN0 D;  5IT9 g;  2IWK A;  4O3U B;  3K72 A;  3V5W B;  3IIY A;  4J86 A;  4CY1 A;  2H6K A;  4I79 A;  3OKT A;  4AN1 A;  5FA5 B;  2UZY B;  4GM3 A;  3ODT A;  4A0A A;  1JJU B;  4ERZ A;  5EM2 B;  5E6S A;  1VYH C;  3SXT D;  4X61 B;  4GGD A;  3F3P A;  2GC7 A;  4GQB B;  4BH6 A;  2I3T A;  5IJ8 E;  2P9P C;  2VDQ A;  2MTA H;  4D0K A;  3VH0 A;  1GOH A;  1N6F A;  4YVD A;  5AJA A;  2OVQ B;  5TEF A;  4XYI A;  3T3M A;  1VE7 A;  5EMK B;  4Y5R D;  3EI2 A;  3RMZ D;  4CZV A;  5I5M A;  3IUL A;  1PGU A;  2VDO A;  3I8C A;  3ZDX A;  4CI8 A;  2PM6 B;  4BL0 A;  3SFZ A;  4J77 A;  3EU7 A;  5AFU 3;  4DNW A;  1A0R B;  4GZ8 A;  3NIG A;  5FFG A;  2P9I C;  4BP8 A;  3KRX B;  2GC4 A;  1M1X A;  1GXR A;  4GGA A;  3VI3 A;  1VE6 A;  4J73 A;  4O2W A;  4E54 A;  3MMY A;  4HDJ A;  2VDK A;  3V4V A;  1QFS A;  2VC2 A;  4KFM B;  5HYN B;  3NIF A;  3BG1 A;  2VZ3 A;  5FLX g;  4PSW B;  3FRX A;  4UM9 A;  2EIB A;  1K3I A;  3UVL A;  1NR0 A;  4FWW A;  2H9N A;  3NID A;  3VA6 A;  4CZY A;  4ERQ A;  3B7F A;  1PI6 A;  4JT6 C;  2TRC B;  4O1Q D;  4A11 B;  2G9A A;  3EI1 A;  4NAA A;  3PVW B;  1O6G A;  3HFQ A;  5EML B;  1UOP A;  3I7N A;  3EQ9 A;  2Q7Q A;  3PXT D;  4DNV A;  5CYK B;  2O9K A;  4WK2 A;  4NC4 A;  3SWS D;  2XYI A;  4G55 A;  5GMK n;  3I89 A;  2VDM A;  3EI2 B;  2J57 G;  2AGW A;  5FKR A;  3QI0 A;  2B5N A;  5H1M A;  3FCS A;  4ES0 A;  5FFO A;  2XU7 A;  2QXV A;  4ZOX A;  4Y7R A;  3L4M D;  1NEX B;  3RFH A;  4UI9 R;  4IRZ A;  5CYK A;  5CXB B;  2IUP A;  3PXW D;  1MDA H;  2AGZ A;  2PM7 B;  4G1M A;  3MKS B;  4PC0 A;  2HU7 A;  1A12 A;  3BG0 A;  5B4W A;  1E8N A;  2B4E A;  3AL9 A;  2YNP A;  4BUJ C;  2OVR B;  2HJ4 A;  4A2M A;  4TZ4 A;  3PSL A;  5A2Q g;  1P22 A;  3ULE C;  5EM2 A;  3RN1 D;  3AL8 A;  1E5T A;  2AGY A;  1YR2 A;  3JZN A;  3F3F A;  1GOF A;  4X3E A;  3FCU A;  4WK0 A;  2J55 H;  3IUM A;  2PM9 A;  4BP9 A;  3OKY B;  4UM8 A;  4CC9 A;  2P9S C;  1TYE A;  2OJY A;  3K71 A;  4JT5 C;  4MMZ A;  2AGL A;  4MMX A;  1JMZ B;  2CN3 A;  3C9C A;  4JSP C;  3ZDZ A;  4EWR A;  1K32 A;  3I7O A;  3PXS D;  1O6F A;  5GSA A;  4JXM A;  2XDW A;  2CN2 A;  4H5J A;  4JSV C;  4MMY A;  3UVM A;  4BCB A;  5HE0 B;  2PM9 B;  4J0W A;  4A08 B;  4GGC A;  4RE6 A;  1T2X A;  3PE7 A;  5E6U A;  3L4O D;  3A0F A;  4A0B A;  1U8C A;  4FA1 D;  2H14 A;  5FKQ A;  4ZOY A;  4O9D A;  5C92 A;  3SN6 B;  3I7L A;  5GXI A;  5EMJ B;  2XL2 A;  2IUV A;  4X63 B;  4G56 B;  4J78 A;  5CXC B;  2VZ1 A;  3EMH A;  1I2M B;  3ZE0 A;  5FXY A;  1ERJ A;  4GQ2 P;  5TDH B;  2IWF A;  3EG6 A;  3SBR A;  2H13 A;  2XE4 A;  4LG9 A;  3JPX A;  5H14 A;  4JHN A;  3V9F A;  5EMM B;  3NVQ A;  3RSE C;  3I7P A;  1GOT B;  3DWL C;  3QHY B;  1H2Z A;  2G99 A;  4CZX A;  3BWS A;  3NVN A;  2VDP A;  1VZ3 A;  2OK4 A;  2W18 A;  5TF2 A;  3JZH A;  4L3H D;  1JTD B;  1H2W A;  3O4G A;  2H6N A;  2HXC A;  1UTC A;  4A08 A;  2QZP A;  5I5J A;  3JAM g;  4U1E I;  2I3S A;  1UOQ A;  3JRP A;  3P4F A;  4A09 A;  5FKT A;  5EAR A;  3N0E A;  4L1M A;  1MG3 A;  5M61 A;  5M5U A;  2XZG A;  1XIP A;  2H47 A;  4QL1 A;  3RLM D;  2HU5 A;  4WJK A;  4Z7N A;  4QAM A;  4BCC A;  1UOO A;  4PSX B;  1QFM A;  4FA9 D;  4NBM A;  4JD2 C;  3EI4 A;  1B9Y A;  2HJB A;  2IUR A;  5K1C C;  4QRJ A;  2EIE A;  1JV2 A;  4IA9 A;  4MK0 B;  1SQ9 A;  5CXC A;  3O4H A;  3SVW D;  4RE5 A;  4CY3 A;  1BPO A;  1XKS A;  2H9P A;  3JB9 L;  2QC5 A;  4GM9 A;  4JSN C;  4FB1 D;  3ZE1 A;  1S4U X;  2CNX A;  3AH8 B;  2AH0 A;  3SLE D;  4AN0 A;  5THA A;  2B5M A;  4OWR A;  2HES X;  4FA5 D;  1N6E A;  2H68 A;  4N14 A;  4GM8 A;  3E0C A;  4CY2 A;  4GQ1 A;  3GD1 I;  5IJ7 E;  2XL3 A;  3UKR C;  4H5I A;  4FAV D;  2CO0 A;  2I0S A;  3OKY A;  3JZG A; 
#chains in the Genus database with same CATH homology
 3NIG A;  2VDL A;  3ZDY A;  5HDB A;  2VDQ A;  5FFG A;  4IRZ A;  4G1E A;  4Z7O A;  5E6U A;  1M1X A;  3VI3 A;  4NEN A;  3IJE A;  3ZE1 A;  1U8C A;  3T3M A;  4WJK A;  4Z7N A;  2VDK A;  3V4V A;  3T3P A;  2VC2 A;  3ZE2 A;  3FCU A;  2VDP A;  4WK4 A;  4WK0 A;  3NIF A;  4WK2 A;  3K72 A;  4G1M A;  3K6S A;  4UM8 A;  4O02 A;  1TYE A;  2VDR A;  2VDO A;  1L5G A;  4UM9 A;  3VI4 A;  3K71 A;  3ZDX A;  2VDM A;  4MMZ A;  5E6S A;  3ZE0 A;  4MMX A;  5E6R A;  2VDN A;  3V4P A;  3ZDZ A;  4Z7Q A;  1JV2 A;  3NID A;  3FCS A;  5FFO A;  4MMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...