5HDBA

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 5hdbA00
2VDKA 2VDPA 2VDQA 4Z7NA 3ZE1A 1U8CA 4Z7QA 4WK2A 3K71A 1JV2A 3T3MA 5E6UA 3IJEA 4WK0A 2VDMA 3VI3A 2VDNA 3NIFA 4IRZA 1M1XA 1TYEA 3ZE0A 4G1EA 3ZDXA 3FCUA 4MMYA 1L5GA 5FFGA 5FFOA 3VI4A 3ZDZA 3ZE2A 3NIGA 2VDOA 2VDRA 4UM8A 4WJKA 4Z7OA 3FCSA 5E6RA 4UM9A 2VDLA 4MMXA 4WK4A 4O02A 4NENA 2VC2A 3V4PA 4G1MA 3V4VA 3ZDYA 4MMZA 3K6SA 5HDBA 3T3PA 5E6SA 3NIDA 3K72A
chains in the Genus database with same CATH superfamily
3F3PA 5M5VA 3K26A 5SXMA 4JSXC 1PBYB 1VYHC 3L4MD 2IAAA 2VDNA 3ZE0A 1M1XA 2CE9A 2IUPA 5FFGA 3UVLA 3VA6A 1H2XA 5FFOA 3I7LA 4U7AA 3SCYA 5I5IA 2H3XA 2JKXA 3C99A 3KRWB 4MMXA 4AN1A 2CN2A 4J0XA 3KRXB 4L9OA 4E5ZA 2PM9B 3I2NA 2VDPA 2VDQA 2YMUA 4ERQA 4FA4D 2G9AA 3EI1A 3FGBA 2H13A 4CY1A 3IULA 4O1QD 5EMJB 3FCUA 4BH6A 2HESX 4GM3A 4JXMA 5EMLB 3ZDZA 3OTTA 2HXCA 4A0BB 3ULEC 3EI4B 2IURA 4NENA 5I5MA 4PXWA 1JTDB 1XIPA 3DDUA 4TZ4A 5HDBA 4J82A 3ZDYA 4D0KA 4X3EA 5GMKn 4A0AA 4FWWA 2PBIB 4GGCA 2GC4A 4GQ1A 2O9KA 4XEIC 4LGNA 3FM0A 4WK0A 5EAPA 4GZ8A 2AGYA 1UTCA 4CI2A 3IJ1A 2I3SA 4ZOVA 3AL8A 3U4YA 3EU7A 2GNQA 1RI6A 4U1EI 5GXIA 1YFQA 1N6EA 3F3GA 5FA5B 4Z7OA 2EIDA 2OVRB 3F3FA 4J0WA 1P22A 4LG8A 2CO0A 3MUOA 5EM2B 3VH0A 4CY2A 1NEXB 4GGAA 5CXCA 2YNPA 2J56H 2XL2A 3K72A 2EICA 4GQBB 2XDWA 5FKRA 1FWXA 3MXXA 4L3HD 3PSLA 3IJEA 4GM8A 5TF2A 2IWKA 3CFSB 5IJ7E 5M5UA 2P9NC 2UZXB 4H5IA 4PSXB 4A11B 3SJLD 4GGDA 4L1MA 2HU5A 3EI2B 2MTAH 4FA5D 2HYEA 3JZHA 4OZUA 3IUJA 3K6SA 1E8MA 2OVQB 2VDKA 4PBZA 1A0RB 3RFGA 5H14A 1H2YA 1K32A 4JD2C 4FB1D 3AFCA 3O4HA 4LG9A 1A12A 1JJUB 2B4EA 3AL9A 2J55H 2H14A 2P9IC 1BPOA 2EIEA 1R5MA 2WQ8A 3I7HA 1GOHA 2AGWA 1GOFA 2XZGA 4IMMA 5M5RA 1UOPA 3ZE1A 4J87A 1VE6A 3DXKC 5E6UA 2YBAA 3PXSD 4GMBA 1JOFA 4J73A 4G1EA 1N6FA 3MVDK 1H2ZA 4CI3A 3EI4A 3NIGA 1TBGA 4NBMA 3ZWLB 3JZNA 1OLZA 4NAAA 3SVWD 3V4PA 2BCJB 4PC0A 3W15A 1GP2B 2H9NA 4XYIA 4DNVA 2YB8B 3J80g 2AGLA 2I0SA 3GC3B 3CIKB 3IKOA 2QC5A 1K8KC 3MKQA 5K19A 1SQJA 3I8EA 4EWRA 2BBKH 4MMYA 4A08B 4E54B 3IUQA 2H6KA 5CXBB 4JT6C 2VDOA 3EQ8A 1U4CA 3O4JA 5EM2A 3FCSA 1VE7A 2HJ4A 4D6VA 3O4GA 2VC2A 5FXYA 2YNNA 3V4VA 4FAND 5AJAA 4DNUA 2UZYB 1QNIA 3UVNA 1MG3A 3UVKA 1QFMA 2QXVA 5HYNB 4AMYA 3PVWB 5GXHA 4WK2A 5IJ8E 4FA1D 4JT5C 1S4UX 4K3ID 2GC7A 3EI3B 4QQEA 3SFZA 4CI8A 4KFMB 3NIFA 2I3TA 2P9SC 4CY5A 2Q7QA 2EBSA 1H2WA 5HE0B 5C92A 3DSMA 3EI2A 3MMYA 4QT8A 5IGOA 4ERYA 4O3UB 4UI9R 3E0CA 3SBQA 4X60B 2IWFA 3MZKA 3OKTA 5M5SA 4J77A 5K1CC 4J86A 4H5JA 4JHNA 3GREA 4BP8A 4ZOXA 4N14A 3MZLA 5CYKB 4X61B 4FA9D 3OW8A 4AEZA 1Q47A 4MK0B 2XL3A 1TYEA 5FKQA 2G99A 3SLED 4J8BA 3JB9L 2HKMA 1C9IA 1TYQC 2P9PC 4J84A 3IIYA 3IJ0A 3OL2B 4JSNC 3SBRA 5EMKB 2P9KC 3JROA 5IGQA 4WK4A 5M61A 3I7KA 3KCIA 4G1MA 1I2MB 4ERZA 2PM7B 4O9DA 4ES0A 3HFQA 2TRCB 1U8CA 4JHPC 5EMMB 3DXMC 4K3JB 4Z8LA 5HQGA 5B4WA 2VDMA 1O6GA 3QI0A 1UOQA 3ZDXA 1UOOA 3RSEC 1L5GA 3EQ7A 3AH8B 5EARA 3O4IA 5HE1B 5EAMA 3PVUB 3VI4A 1T2XA 2PM6B 3AL8B 1SHYB 5C2VB 1NR0A 5JWZA 3OF7A 4FHLA 4QRJA 2PM9A 3UKUC 1GXRA 4CZYA 3T3PA 2I0RA 2Z2PA 1JMZB 4QL1A 3UKRC 1OMWB 5CXCB 1E8NA 3RN0D 4HDJA 2B5MA 4A08A 5AFU3 2W18A 4A2MA 4E54A 3NVNA 4BCBA 3V9FA 3QHYB 2IUQA 4IRZA 5TEEA 2HU8A 4JSVC 2P9LC 5AMSA 4BCDA 2CN3A 4X63B 2CE8A 2H9PA 3B7FA 4A0BA 4BUJC 4NC4A 3N0DA 4PSWB 3EMHA 2VDLA 4GQ2P 4AX4A 4JSPC 5KDOB 2B5LA 3RFHA 3DM0A 2Z2NA 2HJBA 5FQDA 3EI3A 2VZ1A 2CO0C 4Z7NA 3ORVD 3IJCA 4XYHA 3MUNA 1XKSA 3NVXA 5M5TA 3VI3A 4BL0A 3SWSD 2BKLA 3OKYB 4FAVD 4DNWA 3MKSB 4ESGA 3ZE2A 1U2VC 3NVQA 4J79A 3JRPA 4O3TB 4Y7RA 2I0TA 3SBPA 4O02A 2AGXA 5H17A 4CI1A 4OWRA 2H9MA 5TEFA 2B5NA 2VZ3A 3PSCB 5GSAA 4A09B 5CYKA 3K71A 1N6DA 3A0FA 1XHMA 5HE3B 4BCCA 3V7DB 5C2WB 1GOTB 2OIZA 5FLXg 1C9LA 4NSXA 3SMRA 2AH0A 3OL2A 2OVPB 4J81A 3VGZA 4A11A 3OKWA 1L0QA 2VDRA 2H6NA 2P9UC 4PNKB 4QAMA 5EALA 3UR4A 4R7AB 3SN6B 2AGZA 3PXTD 4CC9A 4ZOZA 4L3GD 1K3IA 4AMZA 2XYIA 3UVMA 3V5WB 3C9CA 4J78A 1PGUA 3SHFA 4Z7QA 4G55A 3I8CA 4E5ZB 3IUMA 3PXWD 4YVDA 1SQ9A 3J81g 4Y5RD 2Z2OA 2QZPA 3GFCA 3IUNA 2AQ5A 1YR2A 2H47A 3JPXA 2XU7A 1MG2A 3PE7A 2XE4A 3EI1B 3C5MA 4A2LA 4I79A 1ERJA 5C86A 3SXTD 4CZXA 3RLMD 3K27A 4PBYA 1PI6A 2HKRA 4ZOYA 4MMZA 4AN0A 3EWEA 3JAMg 3EQ9A 2OK4A 4CY3A 5E6SA 3CFVA 2EIBA 1B9YA 4ZN4A 5IC7A 1QFSA 3ODTA 5FKSA 5H1MA 3C75H 1GG2B 5HE2B 5IT9g 3T3MA 4A0AB 2H6QA 4D9SA 2OJYA 1JMXB 4G56B 5I5JA 2AH1A 1O6FA 3BWSA 2CNXA 4RE5A 2J57G 4O2WA 4UM8A 4WJKA 2YNOA 3BG1A 5E6RA 3GD1I 4O45A 2H9LA 4L1QD 4GM9A 3UVOA 1VZ2A 3RRMC 3DWLC 3IURA 3I7PA 4J8GA 3RN1D 3RMZD 1E5TA 3FRXA 1MDAH 4RE6A 2OK6A 3JZGA 1VZ3A 1JV2A 3OKYA 5FKTA 2IUVA 4A7JA 2HU7A 3P4FA 5CXBA 3I89A 3N0EA 1B9XA 4BP9A 5A2Qg 3L4OD 2QR5A 3IIWA 3I7NA 3I7OA 1PEVA 4UM9A 4CZVA 4A09A 2H68A 4AOWA 5THAA 5TDHB 1GOGA 5C9ZB 3IVMA 3BG0A 4IA9A 3EG6A 3NIDA
chains in the Genus database with same CATH topology
2VDKA 2VDPA 2VDQA 4Z7NA 3ZE1A 1U8CA 4Z7QA 4WK2A 3K71A 1JV2A 3T3MA 5E6UA 3IJEA 4WK0A 2VDMA 3VI3A 2VDNA 3NIFA 4IRZA 1M1XA 1TYEA 3ZE0A 4G1EA 3ZDXA 3FCUA 4MMYA 1L5GA 5FFGA 5FFOA 3VI4A 3ZDZA 3ZE2A 3NIGA 2VDOA 2VDRA 4UM8A 4WJKA 4Z7OA 3FCSA 5E6RA 4UM9A 2VDLA 4MMXA 4WK4A 4O02A 4NENA 2VC2A 3V4PA 4G1MA 3V4VA 3ZDYA 4MMZA 3K6SA 5HDBA 3T3PA 5E6SA 3NIDA 3K72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDK A;  2VDP A;  2VDQ A;  4Z7N A;  3ZE1 A;  1U8C A;  4Z7Q A;  4WK2 A;  3K71 A;  1JV2 A;  3T3M A;  5E6U A;  3IJE A;  4WK0 A;  2VDM A;  3VI3 A;  2VDN A;  3NIF A;  4IRZ A;  1M1X A;  1TYE A;  3ZE0 A;  4G1E A;  3ZDX A;  3FCU A;  4MMY A;  1L5G A;  5FFG A;  5FFO A;  3VI4 A;  3ZDZ A;  3ZE2 A;  3NIG A;  2VDO A;  2VDR A;  4UM8 A;  4WJK A;  4Z7O A;  3FCS A;  5E6R A;  4UM9 A;  2VDL A;  4MMX A;  4WK4 A;  4O02 A;  4NEN A;  2VC2 A;  3V4P A;  4G1M A;  3V4V A;  3ZDY A;  4MMZ A;  3K6S A;  5HDB A;  3T3P A;  5E6S A;  3NID A;  3K72 A; 
#chains in the Genus database with same CATH topology
 3F3P A;  5M5V A;  3K26 A;  5SXM A;  4JSX C;  1PBY B;  1VYH C;  3L4M D;  2IAA A;  2VDN A;  3ZE0 A;  1M1X A;  2CE9 A;  2IUP A;  5FFG A;  3UVL A;  3VA6 A;  1H2X A;  5FFO A;  3I7L A;  4U7A A;  3SCY A;  5I5I A;  2H3X A;  2JKX A;  3C99 A;  3KRW B;  4MMX A;  4AN1 A;  2CN2 A;  4J0X A;  3KRX B;  4L9O A;  4E5Z A;  2PM9 B;  3I2N A;  2VDP A;  2VDQ A;  2YMU A;  4ERQ A;  4FA4 D;  2G9A A;  3EI1 A;  3FGB A;  2H13 A;  4CY1 A;  3IUL A;  4O1Q D;  5EMJ B;  3FCU A;  4BH6 A;  2HES X;  4GM3 A;  4JXM A;  5EML B;  3ZDZ A;  3OTT A;  2HXC A;  4A0B B;  3ULE C;  3EI4 B;  2IUR A;  4NEN A;  5I5M A;  4PXW A;  1JTD B;  1XIP A;  3DDU A;  4TZ4 A;  5HDB A;  4J82 A;  3ZDY A;  4D0K A;  4X3E A;  5GMK n;  4A0A A;  4FWW A;  2PBI B;  4GGC A;  2GC4 A;  4GQ1 A;  2O9K A;  4XEI C;  4LGN A;  3FM0 A;  4WK0 A;  5EAP A;  4GZ8 A;  2AGY A;  1UTC A;  4CI2 A;  3IJ1 A;  2I3S A;  4ZOV A;  3AL8 A;  3U4Y A;  3EU7 A;  2GNQ A;  1RI6 A;  4U1E I;  5GXI A;  1YFQ A;  1N6E A;  3F3G A;  5FA5 B;  4Z7O A;  2EID A;  2OVR B;  3F3F A;  4J0W A;  1P22 A;  4LG8 A;  2CO0 A;  3MUO A;  5EM2 B;  3VH0 A;  4CY2 A;  1NEX B;  4GGA A;  5CXC A;  2YNP A;  2J56 H;  2XL2 A;  3K72 A;  2EIC A;  4GQB B;  2XDW A;  5FKR A;  1FWX A;  3MXX A;  4L3H D;  3PSL A;  3IJE A;  4GM8 A;  5TF2 A;  2IWK A;  3CFS B;  5IJ7 E;  5M5U A;  2P9N C;  2UZX B;  4H5I A;  4PSX B;  4A11 B;  3SJL D;  4GGD A;  4L1M A;  2HU5 A;  3EI2 B;  2MTA H;  4FA5 D;  2HYE A;  3JZH A;  4OZU A;  3IUJ A;  3K6S A;  1E8M A;  2OVQ B;  2VDK A;  4PBZ A;  1A0R B;  3RFG A;  5H14 A;  1H2Y A;  1K32 A;  4JD2 C;  4FB1 D;  3AFC A;  3O4H A;  4LG9 A;  1A12 A;  1JJU B;  2B4E A;  3AL9 A;  2J55 H;  2H14 A;  2P9I C;  1BPO A;  2EIE A;  1R5M A;  2WQ8 A;  3I7H A;  1GOH A;  2AGW A;  1GOF A;  2XZG A;  4IMM A;  5M5R A;  1UOP A;  3ZE1 A;  4J87 A;  1VE6 A;  3DXK C;  5E6U A;  2YBA A;  3PXS D;  4GMB A;  1JOF A;  4J73 A;  4G1E A;  1N6F A;  3MVD K;  1H2Z A;  4CI3 A;  3EI4 A;  3NIG A;  1TBG A;  4NBM A;  3ZWL B;  3JZN A;  1OLZ A;  4NAA A;  3SVW D;  3V4P A;  2BCJ B;  4PC0 A;  3W15 A;  1GP2 B;  2H9N A;  4XYI A;  4DNV A;  2YB8 B;  3J80 g;  2AGL A;  2I0S A;  3GC3 B;  3CIK B;  3IKO A;  2QC5 A;  1K8K C;  3MKQ A;  5K19 A;  1SQJ A;  3I8E A;  4EWR A;  2BBK H;  4MMY A;  4A08 B;  4E54 B;  3IUQ A;  2H6K A;  5CXB B;  4JT6 C;  2VDO A;  3EQ8 A;  1U4C A;  3O4J A;  5EM2 A;  3FCS A;  1VE7 A;  2HJ4 A;  4D6V A;  3O4G A;  2VC2 A;  5FXY A;  2YNN A;  3V4V A;  4FAN D;  5AJA A;  4DNU A;  2UZY B;  1QNI A;  3UVN A;  1MG3 A;  3UVK A;  1QFM A;  2QXV A;  5HYN B;  4AMY A;  3PVW B;  5GXH A;  4WK2 A;  5IJ8 E;  4FA1 D;  4JT5 C;  1S4U X;  4K3I D;  2GC7 A;  3EI3 B;  4QQE A;  3SFZ A;  4CI8 A;  4KFM B;  3NIF A;  2I3T A;  2P9S C;  4CY5 A;  2Q7Q A;  2EBS A;  1H2W A;  5HE0 B;  5C92 A;  3DSM A;  3EI2 A;  3MMY A;  4QT8 A;  5IGO A;  4ERY A;  4O3U B;  4UI9 R;  3E0C A;  3SBQ A;  4X60 B;  2IWF A;  3MZK A;  3OKT A;  5M5S A;  4J77 A;  5K1C C;  4J86 A;  4H5J A;  4JHN A;  3GRE A;  4BP8 A;  4ZOX A;  4N14 A;  3MZL A;  5CYK B;  4X61 B;  4FA9 D;  3OW8 A;  4AEZ A;  1Q47 A;  4MK0 B;  2XL3 A;  1TYE A;  5FKQ A;  2G99 A;  3SLE D;  4J8B A;  3JB9 L;  2HKM A;  1C9I A;  1TYQ C;  2P9P C;  4J84 A;  3IIY A;  3IJ0 A;  3OL2 B;  4JSN C;  3SBR A;  5EMK B;  2P9K C;  3JRO A;  5IGQ A;  4WK4 A;  5M61 A;  3I7K A;  3KCI A;  4G1M A;  1I2M B;  4ERZ A;  2PM7 B;  4O9D A;  4ES0 A;  3HFQ A;  2TRC B;  1U8C A;  4JHP C;  5EMM B;  3DXM C;  4K3J B;  4Z8L A;  5HQG A;  5B4W A;  2VDM A;  1O6G A;  3QI0 A;  1UOQ A;  3ZDX A;  1UOO A;  3RSE C;  1L5G A;  3EQ7 A;  3AH8 B;  5EAR A;  3O4I A;  5HE1 B;  5EAM A;  3PVU B;  3VI4 A;  1T2X A;  2PM6 B;  3AL8 B;  1SHY B;  5C2V B;  1NR0 A;  5JWZ A;  3OF7 A;  4FHL A;  4QRJ A;  2PM9 A;  3UKU C;  1GXR A;  4CZY A;  3T3P A;  2I0R A;  2Z2P A;  1JMZ B;  4QL1 A;  3UKR C;  1OMW B;  5CXC B;  1E8N A;  3RN0 D;  4HDJ A;  2B5M A;  4A08 A;  5AFU 3;  2W18 A;  4A2M A;  4E54 A;  3NVN A;  4BCB A;  3V9F A;  3QHY B;  2IUQ A;  4IRZ A;  5TEE A;  2HU8 A;  4JSV C;  2P9L C;  5AMS A;  4BCD A;  2CN3 A;  4X63 B;  2CE8 A;  2H9P A;  3B7F A;  4A0B A;  4BUJ C;  4NC4 A;  3N0D A;  4PSW B;  3EMH A;  2VDL A;  4GQ2 P;  4AX4 A;  4JSP C;  5KDO B;  2B5L A;  3RFH A;  3DM0 A;  2Z2N A;  2HJB A;  5FQD A;  3EI3 A;  2VZ1 A;  2CO0 C;  4Z7N A;  3ORV D;  3IJC A;  4XYH A;  3MUN A;  1XKS A;  3NVX A;  5M5T A;  3VI3 A;  4BL0 A;  3SWS D;  2BKL A;  3OKY B;  4FAV D;  4DNW A;  3MKS B;  4ESG A;  3ZE2 A;  1U2V C;  3NVQ A;  4J79 A;  3JRP A;  4O3T B;  4Y7R A;  2I0T A;  3SBP A;  4O02 A;  2AGX A;  5H17 A;  4CI1 A;  4OWR A;  2H9M A;  5TEF A;  2B5N A;  2VZ3 A;  3PSC B;  5GSA A;  4A09 B;  5CYK A;  3K71 A;  1N6D A;  3A0F A;  1XHM A;  5HE3 B;  4BCC A;  3V7D B;  5C2W B;  1GOT B;  2OIZ A;  5FLX g;  1C9L A;  4NSX A;  3SMR A;  2AH0 A;  3OL2 A;  2OVP B;  4J81 A;  3VGZ A;  4A11 A;  3OKW A;  1L0Q A;  2VDR A;  2H6N A;  2P9U C;  4PNK B;  4QAM A;  5EAL A;  3UR4 A;  4R7A B;  3SN6 B;  2AGZ A;  3PXT D;  4CC9 A;  4ZOZ A;  4L3G D;  1K3I A;  4AMZ A;  2XYI A;  3UVM A;  3V5W B;  3C9C A;  4J78 A;  1PGU A;  3SHF A;  4Z7Q A;  4G55 A;  3I8C A;  4E5Z B;  3IUM A;  3PXW D;  4YVD A;  1SQ9 A;  3J81 g;  4Y5R D;  2Z2O A;  2QZP A;  3GFC A;  3IUN A;  2AQ5 A;  1YR2 A;  2H47 A;  3JPX A;  2XU7 A;  1MG2 A;  3PE7 A;  2XE4 A;  3EI1 B;  3C5M A;  4A2L A;  4I79 A;  1ERJ A;  5C86 A;  3SXT D;  4CZX A;  3RLM D;  3K27 A;  4PBY A;  1PI6 A;  2HKR A;  4ZOY A;  4MMZ A;  4AN0 A;  3EWE A;  3JAM g;  3EQ9 A;  2OK4 A;  4CY3 A;  5E6S A;  3CFV A;  2EIB A;  1B9Y A;  4ZN4 A;  5IC7 A;  1QFS A;  3ODT A;  5FKS A;  5H1M A;  3C75 H;  1GG2 B;  5HE2 B;  5IT9 g;  3T3M A;  4A0A B;  2H6Q A;  4D9S A;  2OJY A;  1JMX B;  4G56 B;  5I5J A;  2AH1 A;  1O6F A;  3BWS A;  2CNX A;  4RE5 A;  2J57 G;  4O2W A;  4UM8 A;  4WJK A;  2YNO A;  3BG1 A;  5E6R A;  3GD1 I;  4O45 A;  2H9L A;  4L1Q D;  4GM9 A;  3UVO A;  1VZ2 A;  3RRM C;  3DWL C;  3IUR A;  3I7P A;  4J8G A;  3RN1 D;  3RMZ D;  1E5T A;  3FRX A;  1MDA H;  4RE6 A;  2OK6 A;  3JZG A;  1VZ3 A;  1JV2 A;  3OKY A;  5FKT A;  2IUV A;  4A7J A;  2HU7 A;  3P4F A;  5CXB A;  3I89 A;  3N0E A;  1B9X A;  4BP9 A;  5A2Q g;  3L4O D;  2QR5 A;  3IIW A;  3I7N A;  3I7O A;  1PEV A;  4UM9 A;  4CZV A;  4A09 A;  2H68 A;  4AOW A;  5THA A;  5TDH B;  1GOG A;  5C9Z B;  3IVM A;  3BG0 A;  4IA9 A;  3EG6 A;  3NID A; 
#chains in the Genus database with same CATH homology
 2VDK A;  2VDP A;  2VDQ A;  4Z7N A;  3ZE1 A;  1U8C A;  4Z7Q A;  4WK2 A;  3K71 A;  1JV2 A;  3T3M A;  5E6U A;  3IJE A;  4WK0 A;  2VDM A;  3VI3 A;  2VDN A;  3NIF A;  4IRZ A;  1M1X A;  1TYE A;  3ZE0 A;  4G1E A;  3ZDX A;  3FCU A;  4MMY A;  1L5G A;  5FFG A;  5FFO A;  3VI4 A;  3ZDZ A;  3ZE2 A;  3NIG A;  2VDO A;  2VDR A;  4UM8 A;  4WJK A;  4Z7O A;  3FCS A;  5E6R A;  4UM9 A;  2VDL A;  4MMX A;  4WK4 A;  4O02 A;  4NEN A;  2VC2 A;  3V4P A;  4G1M A;  3V4V A;  3ZDY A;  4MMZ A;  3K6S A;  5HDB A;  3T3P A;  5E6S A;  3NID A;  3K72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...