5HDBA

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 5hdbA00
2VDKA 4WJKA 3K6SA 4UM8A 2VDOA 3T3MA 3K71A 2VDPA 3NIDA 3NIFA 5E6UA 1M1XA 3K72A 4MMXA 1L5GA 4O02A 4MMYA 3ZE1A 3ZE0A 4WK4A 4WK0A 3ZDYA 3V4PA 4Z7QA 3IJEA 5HDBA 1TYEA 3T3PA 3VI4A 5FFGA 4IRZA 4WK2A 4UM9A 5E6SA 3ZE2A 3VI3A 3FCUA 4Z7NA 3ZDZA 2VDRA 5FFOA 4MMZA 1JV2A 2VC2A 3NIGA 5E6RA 2VDQA 4Z7OA 2VDLA 3FCSA 2VDMA 4G1EA 3V4VA 2VDNA 4G1MA 3ZDXA 4NENA 1U8CA
chains in the Genus database with same CATH superfamily
3O4HA 1K8KC 5EMKB 3NVQA 4DNVA 4JT5C 4A0BA 5EAMA 4PBYA 5CXCB 3I7OA 3EI1B 4A7JA 4E5ZA 1SQ9A 3JZNA 3DXKC 3FM0A 5GXHA 2JKXA 2W18A 3V4PA 2PBIB 4A08A 5CYKA 3O4IA 3SHFA 3N0DA 3MXXA 4K3ID 3I2NA 3IIWA 3RN0D 4O1QD 3FCSA 4L3GD 4R7AB 3UR4A 3JZHA 2AGYA 4CY3A 5HE2B 3K71A 2BBKH 1YR2A 2B5LA 5GSAA 2PM9A 1TYQC 3AH8B 5M5VA 1H2WA 4OWRA 3RLMD 2HJ4A 3UKUC 3UVLA 4Z7QA 3PVUB 2HU7A 2H6NA 3NVNA 3T3PA 1YFQA 5EMMB 4O2WA 5I5JA 3V7DB 4CI1A 4ZOZA 4BCCA 3JAMg 2P9IC 3IVMA 4A0AA 3OL2B 3PVWB 1P22A 2HXCA 3EI3B 1PEVA 2UZYB 2MTAH 3ZE1A 3I7PA 3OKYA 2XZGA 3L4OD 3I8EA 5IJ8E 4WK2A 5E6SA 1ERJA 2H6QA 4FAVD 2J56H 3I89A 4J0XA 3MKQA 1QNIA 4Y7RA 3SWSD 4Z7OA 5M5SA 1L0QA 5TEEA 3EI4B 2P9NC 4G1MA 3ZDXA 4PSWB 4GZ8A 5C86A 2P9SC 4L3HD 5C9ZB 4FAND 1E8MA 5C92A 5FQDA 4DNUA 4GM8A 2WQ8A 3C99A 4IMMA 5EM2A 3VH0A 3C9CA 4AMYA 3AFCA 1TBGA 4PSXB 4CY5A 2HKMA 3RSEC 2IUPA 1GOFA 3EWEA 2OJYA 4A2LA 1E8NA 4GMBA 4PC0A 1O6GA 2AGXA 2I3SA 1RI6A 4N14A 2IUQA 2YB8B 4J8GA 2I3TA 3PXSD 3NIGA 1JMZB 2YNOA 3I8CA 3OTTA 2VDLA 4X61B 2VDMA 4OZUA 2Z2OA 4J82A 4J81A 3T3MA 2AH1A 2IAAA 3DDUA 1N6EA 3EQ9A 5A2Qg 4FHLA 4A0AB 1FWXA 2CE8A 4BUJC 3ZDYA 5JWZA 4GGCA 3UVKA 4QT8A 5EMJB 3MUNA 5EAPA 3PSCB 5FFGA 4L1QD 1NR0A 2HU5A 4J73A 5H17A 1E5TA 1UOPA 4QAMA 3SLED 2CN2A 4YVDA 5GXIA 3F3GA 5H14A 3PSLA 4CZVA 3ZWLB 1XKSA 2I0RA 4AMZA 4FWWA 4CZXA 4JSVC 4UM8A 3FRXA 3EU7A 4JXMA 3V9FA 3C5MA 1VYHC 3IIYA 4J78A 4K3JB 2OVQB 5KDOB 5AMSA 4WK0A 4PNKB 3IJEA 2AQ5A 2EIEA 5FXYA 3VI4A 3SN6B 3MUOA 3EI4A 3L4MD 1VE6A 5HE0B 3RFHA 2PM6B 3RRMC 2H6KA 2Z2PA 4X63B 5CXCA 3EI1A 1PBYB 3A0FA 4FA5D 3IJ1A 3SCYA 5IGQA 4GGAA 4X3EA 3IURA 2P9KC 1GXRA 1B9YA 5M5TA 5TF2A 3OKTA 1C9LA 4O3UB 5M5UA 3IKOA 4J77A 2H9MA 3UVNA 4CY2A 3VI3A 3K26A 1PGUA 3F3PA 4ZOVA 1UOOA 1A12A 3IUMA 5EMLB 5IJ7E 3I7KA 2P9PC 2H9LA 5HE1B 2VZ1A 3EI2B 3GD1I 3SMRA 1GP2B 2HJBA 3SJLD 3NIFA 3GFCA 4D9SA 3OKYB 3K27A 4MMXA 2CO0A 1L5GA 4ESGA 3MVDK 5TEFA 4G56B 4DNWA 1N6DA 2EIBA 3JZGA 1TYEA 2H14A 3C75H 4IRZA 5M61A 3OW8A 4BCBA 4FA9D 3FCUA 1MDAH 3KCIA 5EARA 2OIZA 4H5JA 2VC2A 5E6RA 1H2ZA 4RE5A 4ERYA 2XL3A 5SXMA 4FA1D 4AOWA 4EWRA 4GQBB 5H1MA 3EI2A 2UZXB 3QI0A 5AJAA 4NBMA 3SBQA 2P9LC 4U1EI 1SHYB 1VZ3A 3ZE0A 4J8BA 4QRJA 2GC4A 3JB9L 2BCJB 2TRCB 4A08B 3RFGA 4XYHA 4MK0B 5I5IA 4E5ZB 4O9DA 2B5MA 2VZ3A 4QL1A 2QR5A 1JTDB 2H68A 2VDNA 3J80g 4NAAA 5EM2B 3VA6A 3JPXA 5IC7A 4PXWA 3JROA 5E6UA 3AL8B 5TDHB 4FA4D 3I7LA 4O3TB 4O02A 5FKRA 4CI3A 1JOFA 1NEXB 2H9NA 3QHYB 5FLXg 2HYEA 3ORVD 4QQEA 2OVPB 2B4EA 3GC3B 5M5RA 2QC5A 3B7FA 1O6FA 1MG3A 2GC7A 5AFU3 4AEZA 4ERZA 2H9PA 5EALA 4LG8A 2AGLA 4Z8LA 4JSPC 3I7HA 3K6SA 3BG0A 4GM3A 4CI8A 5FKSA 4A09A 4E54B 3OL2A 3IJ0A 2QXVA 5HYNB 3VGZA 3SVWD 1T2XA 4GGDA 2XYIA 5FA5B 2BKLA 3UKRC 3MKSB 2XL2A 3EMHA 4L1MA 2CE9A 2YNPA 2HESX 4RE6A 5FKTA 4LG9A 2XDWA 3DM0A 4ES0A 5CXBA 5HQGA 5FKQA 4ZOXA 3RMZD 2OK4A 4X60B 1U8CA 2IURA 4GM9A 4CZYA 2YBAA 3SBRA 5B4WA 2Z2NA 3NIDA 2GNQA 4UI9R 3KRXB 4JSNC 1VZ2A 3F3FA 4MMYA 1S4UX 3FGBA 4G55A 3PE7A 4GQ2P 2OVRB 4JD2C 3RN1D 1H2XA 3JRPA 4BL0A 4AX4A 4FB1D 3ULEC 2AH0A 3SFZA 1A0RB 3DSMA 3KRWB 2YMUA 5C2VB 3E0CA 5GMKn 4J86A 4JHPC 4WJKA 2B5NA 2VDPA 3BG1A 5C2WB 2CNXA 3SXTD 2H3XA 4TZ4A 2XE4A 4A11B 2HU8A 1QFMA 1SQJA 2YNNA 4NC4A 5HDBA 4KFMB 2CO0C 4UM9A 3ZE2A 5K1CC 4A2MA 1VE7A 3MZLA 3NVXA 2O9KA 4J84A 5K19A 3EQ8A 3V4VA 4LGNA 4AN0A 1Q47A 1UOQA 2XU7A 3EI3A 2VDOA 1C9IA 1B9XA 3IUQA 5IT9g 2QZPA 2CN3A 1U2VC 3GREA 3U4YA 3AL9A 3ODTA 2PM7B 1N6FA 4XEIC 4D6VA 1UTCA 1PI6A 2IWKA 5IGOA 2IUVA 2EBSA 2AGWA 4HDJA 1R5MA 1GG2B 4Z7NA 2VDRA 4I79A 4J79A 4NSXA 3EQ7A 2EIDA 1MG2A 2G9AA 3SBPA 4CY1A 4G1EA 4JT6C 4NENA 2PM9B 2VDKA 4ZOYA 3MZKA 3MMYA 2J57G 1M1XA 3K72A 3PXWD 3UVOA 3V5WB 4BP9A 5I5MA 4ZN4A 5CXBB 4PBZA 2AGZA 3CIKB 4E54A 4WK4A 3IUJA 3PXTD 5THAA 3O4GA 2P9UC 1GOTB 4U7AA 4L9OA 1XHMA 1BPOA 5CYKB 4Y5RD 2IWFA 3ZDZA 2H13A 2Q7QA 3N0EA 3J81g 4JSXC 5FFOA 4MMZA 2VDQA 4H5IA 2H47A 4GQ1A 4JHNA 1K32A 5HE3B 1GOHA 4A09B 1XIPA 2I0SA 3HFQA 3DWLC 4CI2A 4BH6A 3OF7A 4A0BB 1OLZA 2G99A 2J55H 2OK6A 3IJCA 4IA9A 4A11A 3EG6A 4BCDA 1H2YA 3W15A 1K3IA 1OMWB 2EICA 4O45A 4AN1A 4CC9A 3DXMC 1JMXB 1GOGA 3O4JA 2HKRA 3IULA 3BWSA 4BP8A 4J87A 1QFSA 1U4CA 1JJUB 1I2MB 3UVMA 1JV2A 3IUNA 3I7NA 4J0WA 4ERQA 3AL8A 4XYIA 3CFVA 3P4FA 2I0TA 3OKWA 4D0KA 3CFSB
chains in the Genus database with same CATH topology
2VDKA 4WJKA 3K6SA 4UM8A 2VDOA 3T3MA 3K71A 2VDPA 3NIDA 3NIFA 5E6UA 1M1XA 3K72A 4MMXA 1L5GA 4O02A 4MMYA 3ZE1A 3ZE0A 4WK4A 4WK0A 3ZDYA 3V4PA 4Z7QA 3IJEA 5HDBA 1TYEA 3T3PA 3VI4A 5FFGA 4IRZA 4WK2A 4UM9A 5E6SA 3ZE2A 3VI3A 3FCUA 4Z7NA 3ZDZA 2VDRA 5FFOA 4MMZA 1JV2A 2VC2A 3NIGA 5E6RA 2VDQA 4Z7OA 2VDLA 3FCSA 2VDMA 4G1EA 3V4VA 2VDNA 4G1MA 3ZDXA 4NENA 1U8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDK A;  4WJK A;  3K6S A;  4UM8 A;  2VDO A;  3T3M A;  3K71 A;  2VDP A;  3NID A;  3NIF A;  5E6U A;  1M1X A;  3K72 A;  4MMX A;  1L5G A;  4O02 A;  4MMY A;  3ZE1 A;  3ZE0 A;  4WK4 A;  4WK0 A;  3ZDY A;  3V4P A;  4Z7Q A;  3IJE A;  5HDB A;  1TYE A;  3T3P A;  3VI4 A;  5FFG A;  4IRZ A;  4WK2 A;  4UM9 A;  5E6S A;  3ZE2 A;  3VI3 A;  3FCU A;  4Z7N A;  3ZDZ A;  2VDR A;  5FFO A;  4MMZ A;  1JV2 A;  2VC2 A;  3NIG A;  5E6R A;  2VDQ A;  4Z7O A;  2VDL A;  3FCS A;  2VDM A;  4G1E A;  3V4V A;  2VDN A;  4G1M A;  3ZDX A;  4NEN A;  1U8C A; 
#chains in the Genus database with same CATH topology
 3O4H A;  1K8K C;  5EMK B;  3NVQ A;  4DNV A;  4JT5 C;  4A0B A;  5EAM A;  4PBY A;  5CXC B;  3I7O A;  3EI1 B;  4A7J A;  4E5Z A;  1SQ9 A;  3JZN A;  3DXK C;  3FM0 A;  5GXH A;  2JKX A;  2W18 A;  3V4P A;  2PBI B;  4A08 A;  5CYK A;  3O4I A;  3SHF A;  3N0D A;  3MXX A;  4K3I D;  3I2N A;  3IIW A;  3RN0 D;  4O1Q D;  3FCS A;  4L3G D;  4R7A B;  3UR4 A;  3JZH A;  2AGY A;  4CY3 A;  5HE2 B;  3K71 A;  2BBK H;  1YR2 A;  2B5L A;  5GSA A;  2PM9 A;  1TYQ C;  3AH8 B;  5M5V A;  1H2W A;  4OWR A;  3RLM D;  2HJ4 A;  3UKU C;  3UVL A;  4Z7Q A;  3PVU B;  2HU7 A;  2H6N A;  3NVN A;  3T3P A;  1YFQ A;  5EMM B;  4O2W A;  5I5J A;  3V7D B;  4CI1 A;  4ZOZ A;  4BCC A;  3JAM g;  2P9I C;  3IVM A;  4A0A A;  3OL2 B;  3PVW B;  1P22 A;  2HXC A;  3EI3 B;  1PEV A;  2UZY B;  2MTA H;  3ZE1 A;  3I7P A;  3OKY A;  2XZG A;  3L4O D;  3I8E A;  5IJ8 E;  4WK2 A;  5E6S A;  1ERJ A;  2H6Q A;  4FAV D;  2J56 H;  3I89 A;  4J0X A;  3MKQ A;  1QNI A;  4Y7R A;  3SWS D;  4Z7O A;  5M5S A;  1L0Q A;  5TEE A;  3EI4 B;  2P9N C;  4G1M A;  3ZDX A;  4PSW B;  4GZ8 A;  5C86 A;  2P9S C;  4L3H D;  5C9Z B;  4FAN D;  1E8M A;  5C92 A;  5FQD A;  4DNU A;  4GM8 A;  2WQ8 A;  3C99 A;  4IMM A;  5EM2 A;  3VH0 A;  3C9C A;  4AMY A;  3AFC A;  1TBG A;  4PSX B;  4CY5 A;  2HKM A;  3RSE C;  2IUP A;  1GOF A;  3EWE A;  2OJY A;  4A2L A;  1E8N A;  4GMB A;  4PC0 A;  1O6G A;  2AGX A;  2I3S A;  1RI6 A;  4N14 A;  2IUQ A;  2YB8 B;  4J8G A;  2I3T A;  3PXS D;  3NIG A;  1JMZ B;  2YNO A;  3I8C A;  3OTT A;  2VDL A;  4X61 B;  2VDM A;  4OZU A;  2Z2O A;  4J82 A;  4J81 A;  3T3M A;  2AH1 A;  2IAA A;  3DDU A;  1N6E A;  3EQ9 A;  5A2Q g;  4FHL A;  4A0A B;  1FWX A;  2CE8 A;  4BUJ C;  3ZDY A;  5JWZ A;  4GGC A;  3UVK A;  4QT8 A;  5EMJ B;  3MUN A;  5EAP A;  3PSC B;  5FFG A;  4L1Q D;  1NR0 A;  2HU5 A;  4J73 A;  5H17 A;  1E5T A;  1UOP A;  4QAM A;  3SLE D;  2CN2 A;  4YVD A;  5GXI A;  3F3G A;  5H14 A;  3PSL A;  4CZV A;  3ZWL B;  1XKS A;  2I0R A;  4AMZ A;  4FWW A;  4CZX A;  4JSV C;  4UM8 A;  3FRX A;  3EU7 A;  4JXM A;  3V9F A;  3C5M A;  1VYH C;  3IIY A;  4J78 A;  4K3J B;  2OVQ B;  5KDO B;  5AMS A;  4WK0 A;  4PNK B;  3IJE A;  2AQ5 A;  2EIE A;  5FXY A;  3VI4 A;  3SN6 B;  3MUO A;  3EI4 A;  3L4M D;  1VE6 A;  5HE0 B;  3RFH A;  2PM6 B;  3RRM C;  2H6K A;  2Z2P A;  4X63 B;  5CXC A;  3EI1 A;  1PBY B;  3A0F A;  4FA5 D;  3IJ1 A;  3SCY A;  5IGQ A;  4GGA A;  4X3E A;  3IUR A;  2P9K C;  1GXR A;  1B9Y A;  5M5T A;  5TF2 A;  3OKT A;  1C9L A;  4O3U B;  5M5U A;  3IKO A;  4J77 A;  2H9M A;  3UVN A;  4CY2 A;  3VI3 A;  3K26 A;  1PGU A;  3F3P A;  4ZOV A;  1UOO A;  1A12 A;  3IUM A;  5EML B;  5IJ7 E;  3I7K A;  2P9P C;  2H9L A;  5HE1 B;  2VZ1 A;  3EI2 B;  3GD1 I;  3SMR A;  1GP2 B;  2HJB A;  3SJL D;  3NIF A;  3GFC A;  4D9S A;  3OKY B;  3K27 A;  4MMX A;  2CO0 A;  1L5G A;  4ESG A;  3MVD K;  5TEF A;  4G56 B;  4DNW A;  1N6D A;  2EIB A;  3JZG A;  1TYE A;  2H14 A;  3C75 H;  4IRZ A;  5M61 A;  3OW8 A;  4BCB A;  4FA9 D;  3FCU A;  1MDA H;  3KCI A;  5EAR A;  2OIZ A;  4H5J A;  2VC2 A;  5E6R A;  1H2Z A;  4RE5 A;  4ERY A;  2XL3 A;  5SXM A;  4FA1 D;  4AOW A;  4EWR A;  4GQB B;  5H1M A;  3EI2 A;  2UZX B;  3QI0 A;  5AJA A;  4NBM A;  3SBQ A;  2P9L C;  4U1E I;  1SHY B;  1VZ3 A;  3ZE0 A;  4J8B A;  4QRJ A;  2GC4 A;  3JB9 L;  2BCJ B;  2TRC B;  4A08 B;  3RFG A;  4XYH A;  4MK0 B;  5I5I A;  4E5Z B;  4O9D A;  2B5M A;  2VZ3 A;  4QL1 A;  2QR5 A;  1JTD B;  2H68 A;  2VDN A;  3J80 g;  4NAA A;  5EM2 B;  3VA6 A;  3JPX A;  5IC7 A;  4PXW A;  3JRO A;  5E6U A;  3AL8 B;  5TDH B;  4FA4 D;  3I7L A;  4O3T B;  4O02 A;  5FKR A;  4CI3 A;  1JOF A;  1NEX B;  2H9N A;  3QHY B;  5FLX g;  2HYE A;  3ORV D;  4QQE A;  2OVP B;  2B4E A;  3GC3 B;  5M5R A;  2QC5 A;  3B7F A;  1O6F A;  1MG3 A;  2GC7 A;  5AFU 3;  4AEZ A;  4ERZ A;  2H9P A;  5EAL A;  4LG8 A;  2AGL A;  4Z8L A;  4JSP C;  3I7H A;  3K6S A;  3BG0 A;  4GM3 A;  4CI8 A;  5FKS A;  4A09 A;  4E54 B;  3OL2 A;  3IJ0 A;  2QXV A;  5HYN B;  3VGZ A;  3SVW D;  1T2X A;  4GGD A;  2XYI A;  5FA5 B;  2BKL A;  3UKR C;  3MKS B;  2XL2 A;  3EMH A;  4L1M A;  2CE9 A;  2YNP A;  2HES X;  4RE6 A;  5FKT A;  4LG9 A;  2XDW A;  3DM0 A;  4ES0 A;  5CXB A;  5HQG A;  5FKQ A;  4ZOX A;  3RMZ D;  2OK4 A;  4X60 B;  1U8C A;  2IUR A;  4GM9 A;  4CZY A;  2YBA A;  3SBR A;  5B4W A;  2Z2N A;  3NID A;  2GNQ A;  4UI9 R;  3KRX B;  4JSN C;  1VZ2 A;  3F3F A;  4MMY A;  1S4U X;  3FGB A;  4G55 A;  3PE7 A;  4GQ2 P;  2OVR B;  4JD2 C;  3RN1 D;  1H2X A;  3JRP A;  4BL0 A;  4AX4 A;  4FB1 D;  3ULE C;  2AH0 A;  3SFZ A;  1A0R B;  3DSM A;  3KRW B;  2YMU A;  5C2V B;  3E0C A;  5GMK n;  4J86 A;  4JHP C;  4WJK A;  2B5N A;  2VDP A;  3BG1 A;  5C2W B;  2CNX A;  3SXT D;  2H3X A;  4TZ4 A;  2XE4 A;  4A11 B;  2HU8 A;  1QFM A;  1SQJ A;  2YNN A;  4NC4 A;  5HDB A;  4KFM B;  2CO0 C;  4UM9 A;  3ZE2 A;  5K1C C;  4A2M A;  1VE7 A;  3MZL A;  3NVX A;  2O9K A;  4J84 A;  5K19 A;  3EQ8 A;  3V4V A;  4LGN A;  4AN0 A;  1Q47 A;  1UOQ A;  2XU7 A;  3EI3 A;  2VDO A;  1C9I A;  1B9X A;  3IUQ A;  5IT9 g;  2QZP A;  2CN3 A;  1U2V C;  3GRE A;  3U4Y A;  3AL9 A;  3ODT A;  2PM7 B;  1N6F A;  4XEI C;  4D6V A;  1UTC A;  1PI6 A;  2IWK A;  5IGO A;  2IUV A;  2EBS A;  2AGW A;  4HDJ A;  1R5M A;  1GG2 B;  4Z7N A;  2VDR A;  4I79 A;  4J79 A;  4NSX A;  3EQ7 A;  2EID A;  1MG2 A;  2G9A A;  3SBP A;  4CY1 A;  4G1E A;  4JT6 C;  4NEN A;  2PM9 B;  2VDK A;  4ZOY A;  3MZK A;  3MMY A;  2J57 G;  1M1X A;  3K72 A;  3PXW D;  3UVO A;  3V5W B;  4BP9 A;  5I5M A;  4ZN4 A;  5CXB B;  4PBZ A;  2AGZ A;  3CIK B;  4E54 A;  4WK4 A;  3IUJ A;  3PXT D;  5THA A;  3O4G A;  2P9U C;  1GOT B;  4U7A A;  4L9O A;  1XHM A;  1BPO A;  5CYK B;  4Y5R D;  2IWF A;  3ZDZ A;  2H13 A;  2Q7Q A;  3N0E A;  3J81 g;  4JSX C;  5FFO A;  4MMZ A;  2VDQ A;  4H5I A;  2H47 A;  4GQ1 A;  4JHN A;  1K32 A;  5HE3 B;  1GOH A;  4A09 B;  1XIP A;  2I0S A;  3HFQ A;  3DWL C;  4CI2 A;  4BH6 A;  3OF7 A;  4A0B B;  1OLZ A;  2G99 A;  2J55 H;  2OK6 A;  3IJC A;  4IA9 A;  4A11 A;  3EG6 A;  4BCD A;  1H2Y A;  3W15 A;  1K3I A;  1OMW B;  2EIC A;  4O45 A;  4AN1 A;  4CC9 A;  3DXM C;  1JMX B;  1GOG A;  3O4J A;  2HKR A;  3IUL A;  3BWS A;  4BP8 A;  4J87 A;  1QFS A;  1U4C A;  1JJU B;  1I2M B;  3UVM A;  1JV2 A;  3IUN A;  3I7N A;  4J0W A;  4ERQ A;  3AL8 A;  4XYI A;  3CFV A;  3P4F A;  2I0T A;  3OKW A;  4D0K A;  3CFS B; 
#chains in the Genus database with same CATH homology
 2VDK A;  4WJK A;  3K6S A;  4UM8 A;  2VDO A;  3T3M A;  3K71 A;  2VDP A;  3NID A;  3NIF A;  5E6U A;  1M1X A;  3K72 A;  4MMX A;  1L5G A;  4O02 A;  4MMY A;  3ZE1 A;  3ZE0 A;  4WK4 A;  4WK0 A;  3ZDY A;  3V4P A;  4Z7Q A;  3IJE A;  5HDB A;  1TYE A;  3T3P A;  3VI4 A;  5FFG A;  4IRZ A;  4WK2 A;  4UM9 A;  5E6S A;  3ZE2 A;  3VI3 A;  3FCU A;  4Z7N A;  3ZDZ A;  2VDR A;  5FFO A;  4MMZ A;  1JV2 A;  2VC2 A;  3NIG A;  5E6R A;  2VDQ A;  4Z7O A;  2VDL A;  3FCS A;  2VDM A;  4G1E A;  3V4V A;  2VDN A;  4G1M A;  3ZDX A;  4NEN A;  1U8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...