5HDBA

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/immune system
molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 5hdbA00
2VDPA 3FCSA 3K6SA 4UM8A 5E6RA 4NENA 3ZDZA 3ZE2A 5E6UA 2VDQA 1L5GA 4MMYA 2VC2A 3NIGA 4MMZA 4WK0A 5FFOA 2VDKA 4WK2A 4Z7OA 1TYEA 2VDLA 5FFGA 3K71A 2VDNA 4WJKA 3ZE0A 3ZE1A 3FCUA 1M1XA 4O02A 1U8CA 3NIDA 2VDRA 4MMXA 4WK4A 3K72A 3V4VA 4Z7QA 4UM9A 4G1MA 1JV2A 3VI4A 2VDMA 4IRZA 3ZDXA 3VI3A 4G1EA 5HDBA 3V4PA 5E6SA 3T3PA 4Z7NA 3NIFA 3ZDYA 3T3MA 3IJEA 2VDOA
chains in the Genus database with same CATH superfamily
4FAVD 4JSXC 2YNOA 4ZOXA 5HE1B 5K19A 5C92A 2CO0C 4ERQA 4E5ZA 4L9OA 4U7AA 5FFOA 3GREA 4J8BA 2PM9A 5M5VA 3E0CA 4MK0B 2H9MA 2OVPB 1U8CA 3B7FA 3QI0A 4BP8A 5EM2A 5GMKn 4Y5RD 3I8EA 4O45A 1QFMA 4J78A 3DXMC 1C9LA 5I5IA 4CY5A 3JAMg 5IT9g 2IAAA 3IJCA 3P4FA 4FA4D 1GP2B 2PM7B 3MXXA 3RFGA 4BL0A 4UM8A 5E6RA 3MKSB 3RRMC 2EICA 3IIYA 3I89A 4FA9D 3EWEA 4MMYA 1A0RB 2AH1A 3EQ9A 3JZHA 3QHYB 1M1XA 4A09A 4NSXA 2B4EA 5GXHA 3IUJA 4CI2A 5IC7A 4Z8LA 3IVMA 5FA5B 3RN0D 3RMZD 4BCDA 3PVWB 3EQ7A 3MMYA 4H5IA 2Z2NA 3PXSD 4O3TB 4CZVA 1PEVA 5A2Qg 5I5MA 1VZ3A 2VDQA 4WK0A 4L1QD 2AGYA 4QQEA 5H17A 3OKYA 3GFCA 3IUQA 4IMMA 5TEEA 5C2WB 3KRWB 3FCUA 2AGZA 2MTAH 1H2YA 4A11A 3FM0A 1PI6A 4GQBB 2AGWA 2OIZA 1N6EA 3AL8A 1YR2A 3C75H 4J73A 4JSNC 2YNPA 3IJ0A 2OVQB 2IUQA 5CYKB 3UR4A 1C9IA 4G55A 4IA9A 2YNNA 3C9CA 3JPXA 3EQ8A 3BG1A 3RSEC 3KCIA 3SLED 4EWRA 2I0TA 3ORVD 3UKUC 4PSXB 1VZ2A 2I3TA 4A0AB 3K72A 4QT8A 4XYIA 4G1MA 2CN2A 1UOPA 2J56H 4A08A 1H2WA 2XE4A 4GQ2P 3C5MA 4D0KA 5EMMB 4RE6A 4JT6C 3EI2B 1OLZA 4FAND 5H1MA 1K3IA 3CIKB 2CNXA 2QC5A 1JMXB 4NENA 4CI8A 4YVDA 1O6GA 2WQ8A 2JKXA 4OWRA 4PC0A 4QAMA 4ESGA 4Z7OA 5FFGA 5I5JA 4H5JA 4AMYA 2HKRA 3NVQA 2HU8A 2H13A 4X60B 4E54B 5EAMA 5TEFA 1VE6A 3EI4A 3VI3A 2B5LA 3V4PA 3SVWD 5C86A 1JJUB 2XDWA 2YB8B 5JWZA 1GG2B 4J87A 5EALA 4LGNA 3V7DB 4GMBA 4AEZA 3NVXA 4FA5D 1UOQA 4L3GD 2HESX 4D9SA 3AL9A 4AMZA 1VYHC 2BCJB 2GC4A 4JT5C 3F3PA 4A7JA 2B5MA 4GGDA 4ZOZA 5E6SA 4N14A 3IKOA 3NIFA 1BPOA 4A0BA 5AJAA 2EBSA 2H6QA 3K6SA 1U4CA 3EI3B 4X63B 5GXIA 1GOGA 3SBRA 1L5GA 3N0EA 2VC2A 3EI1B 2IURA 2QZPA 3N0DA 2VDNA 3DDUA 2IUVA 4J8GA 4O1QD 2CE8A 2P9KC 1YFQA 4J84A 5EMLB 4CI1A 5AFU3 5IJ7E 4JXMA 1XIPA 2GC7A 5CXCB 3F3GA 5CXBB 3ZDYA 4AOWA 4J0XA 2P9PC 3EI2A 4O2WA 3IULA 3ZDZA 5E6UA 1GOTB 3SMRA 3OF7A 3SXTD 2VZ1A 1GOHA 4WK2A 4WJKA 3W15A 3ZE0A 3ZE1A 5M5TA 4U1EI 4MMXA 1UTCA 5HE2B 2O9KA 3EG6A 4J86A 3SN6B 3VI4A 1P22A 4JSVC 3O4GA 4UI9R 3EMHA 3CFSB 5C2VB 2P9NC 4E5ZB 2G99A 4A2LA 2XL3A 4JHPC 4RE5A 2P9SC 1S4UX 3UVOA 1E5TA 3JZNA 1I2MB 4GQ1A 4ERYA 1PBYB 5EM2B 3K71A 1QFSA 1UOOA 5EAPA 5THAA 3DWLC 2VDRA 5IJ8E 2Q7QA 2VZ3A 4HDJA 3I7HA 4UM9A 4ZOYA 1A12A 4PSWB 2BBKH 3UVNA 2I3SA 2Z2PA 4GM9A 2H9PA 2IUPA 4LG8A 2GNQA 2TRCB 4I79A 3PE7A 2AGLA 5M5RA 5AMSA 1JTDB 3EI3A 4L1MA 4JHNA 2P9LC 4J0WA 4LG9A 5B4WA 2Z2OA 4TZ4A 2H9LA 3NIDA 5FQDA 1K32A 1U2VC 4R7AB 3MZKA 3FGBA 1H2XA 3PSLA 1E8NA 3SBQA 4BH6A 3VH0A 5TF2A 2OJYA 3OL2B 1TBGA 4AX4A 3K26A 3I2NA 3OKTA 3EU7A 3CFVA 1B9XA 3OW8A 1K8KC 1JMZB 3T3MA 5FLXg 3L4OD 3U4YA 1XKSA 2H14A 5CXCA 4BCBA 3OKYB 3GD1I 3JZGA 3MUOA 3NIGA 4MMZA 4L3HD 3DXKC 3I7KA 2VDKA 4A11B 2VDLA 5GSAA 2P9UC 4K3ID 1SHYB 3RN1D 2XYIA 5M5SA 4XEIC 1JV2A 1N6DA 4IRZA 2AQ5A 4CC9A 1SQJA 4BUJC 1R5MA 4KFMB 5EMKB 4PNKB 5IGOA 4Z7NA 3I7LA 3MUNA 3BWSA 2AGXA 3OKWA 4FWWA 4G56B 3F3FA 5C9ZB 1XHMA 3OTTA 1E8MA 1H2ZA 4PBYA 4GM8A 3IUMA 1TYEA 3I7NA 5CYKA 2B5NA 1RI6A 3IURA 4Y7RA 3SJLD 4NC4A 4A08B 1VE7A 2HYEA 1MG2A 4BCCA 1L0QA 3ULEC 3UVLA 3SWSD 2UZXB 4FB1D 2HXCA 4K3JB 2I0RA 2VDMA 3UKRC 5H14A 5KDOB 4A0AA 4G1EA 2CO0A 2H6KA 5FKQA 2UZYB 2IWFA 2H6NA 4OZUA 3RFHA 3SHFA 3C99A 4PXWA 4BP9A 4ZN4A 2HU5A 4D6VA 4DNVA 4J81A 3UVKA 3GC3B 1QNIA 2H9NA 2HKMA 1GXRA 2J57G 3L4MD 2HJ4A 3EI4B 5K1CC 4GGAA 2EIEA 4WK4A 3UVMA 3V9FA 4J82A 2OVRB 5TDHB 1GOFA 1MDAH 4Z7QA 4A2MA 4E54A 4GZ8A 2EIDA 5EMJB 2AH0A 2IWKA 1FWXA 2PM6B 1JOFA 3I8CA 3IJ1A 3ODTA 4DNUA 3HFQA 3OL2A 2H47A 2P9IC 4J79A 2VDOA 3MZLA 3A0FA 2HJBA 2XZGA 3K27A 4X3EA 2PM9B 5FKRA 1SQ9A 5FKSA 4GM3A 1PGUA 3NVNA 5HE3B 4CY2A 3PXWD 2PBIB 3BG0A 4PBZA 2YBAA 5M5UA 5EARA 4J77A 5HE0B 4A0BB 5FKTA 4O9DA 5HDBA 5SXMA 3J81g 4JD2C 2OK6A 3IJEA 3IUNA 4CZYA 3AFCA 4CZXA 3I7OA 5FXYA 1MG3A 4DNWA 3ZE2A 3PVUB 3VA6A 3O4HA 1ERJA 4ES0A 4FHLA 2XL2A 4FA1D 2CN3A 1Q47A 1NEXB 4A09B 2I0SA 4ERZA 3JRPA 4CY1A 3EI1A 2CE9A 4O02A 4XYHA 3V5WB 2OK4A 3MVDK 4CY3A 4JSPC 2J55H 5HYNB 4NBMA 3J80g 3SCYA 3I7PA 4GGCA 3SBPA 2H68A 2H3XA 2HU7A 3ZWLB 2YMUA 3KRXB 3MKQA 2QR5A 3FRXA 4CI3A 2VDPA 3FCSA 3PXTD 1NR0A 1OMWB 5CXBA 3PSCB 1T2XA 3RLMD 3DSMA 3JROA 4AN1A 4AN0A 5IGQA 2BKLA 2W18A 3JB9L 3AH8B 3AL8B 5M61A 1O6FA 3IIWA 1N6FA 4X61B 2XU7A 4QRJA 2EIBA 3V4VA 3SFZA 1TYQC 3DM0A 3ZDXA 3O4JA 1B9YA 4ZOVA 2QXVA 3T3PA 5HQGA 2G9AA 3VGZA 4NAAA 4QL1A 4O3UB 3O4IA
chains in the Genus database with same CATH topology
2VDPA 3FCSA 3K6SA 4UM8A 5E6RA 4NENA 3ZDZA 3ZE2A 5E6UA 2VDQA 1L5GA 4MMYA 2VC2A 3NIGA 4MMZA 4WK0A 5FFOA 2VDKA 4WK2A 4Z7OA 1TYEA 2VDLA 5FFGA 3K71A 2VDNA 4WJKA 3ZE0A 3ZE1A 3FCUA 1M1XA 4O02A 1U8CA 3NIDA 2VDRA 4MMXA 4WK4A 3K72A 3V4VA 4Z7QA 4UM9A 4G1MA 1JV2A 3VI4A 2VDMA 4IRZA 3ZDXA 3VI3A 4G1EA 5HDBA 3V4PA 5E6SA 3T3PA 4Z7NA 3NIFA 3ZDYA 3T3MA 3IJEA 2VDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDP A;  3FCS A;  3K6S A;  4UM8 A;  5E6R A;  4NEN A;  3ZDZ A;  3ZE2 A;  5E6U A;  2VDQ A;  1L5G A;  4MMY A;  2VC2 A;  3NIG A;  4MMZ A;  4WK0 A;  5FFO A;  2VDK A;  4WK2 A;  4Z7O A;  1TYE A;  2VDL A;  5FFG A;  3K71 A;  2VDN A;  4WJK A;  3ZE0 A;  3ZE1 A;  3FCU A;  1M1X A;  4O02 A;  1U8C A;  3NID A;  2VDR A;  4MMX A;  4WK4 A;  3K72 A;  3V4V A;  4Z7Q A;  4UM9 A;  4G1M A;  1JV2 A;  3VI4 A;  2VDM A;  4IRZ A;  3ZDX A;  3VI3 A;  4G1E A;  5HDB A;  3V4P A;  5E6S A;  3T3P A;  4Z7N A;  3NIF A;  3ZDY A;  3T3M A;  3IJE A;  2VDO A; 
#chains in the Genus database with same CATH topology
 4FAV D;  4JSX C;  2YNO A;  4ZOX A;  5HE1 B;  5K19 A;  5C92 A;  2CO0 C;  4ERQ A;  4E5Z A;  4L9O A;  4U7A A;  5FFO A;  3GRE A;  4J8B A;  2PM9 A;  5M5V A;  3E0C A;  4MK0 B;  2H9M A;  2OVP B;  1U8C A;  3B7F A;  3QI0 A;  4BP8 A;  5EM2 A;  5GMK n;  4Y5R D;  3I8E A;  4O45 A;  1QFM A;  4J78 A;  3DXM C;  1C9L A;  5I5I A;  4CY5 A;  3JAM g;  5IT9 g;  2IAA A;  3IJC A;  3P4F A;  4FA4 D;  1GP2 B;  2PM7 B;  3MXX A;  3RFG A;  4BL0 A;  4UM8 A;  5E6R A;  3MKS B;  3RRM C;  2EIC A;  3IIY A;  3I89 A;  4FA9 D;  3EWE A;  4MMY A;  1A0R B;  2AH1 A;  3EQ9 A;  3JZH A;  3QHY B;  1M1X A;  4A09 A;  4NSX A;  2B4E A;  5GXH A;  3IUJ A;  4CI2 A;  5IC7 A;  4Z8L A;  3IVM A;  5FA5 B;  3RN0 D;  3RMZ D;  4BCD A;  3PVW B;  3EQ7 A;  3MMY A;  4H5I A;  2Z2N A;  3PXS D;  4O3T B;  4CZV A;  1PEV A;  5A2Q g;  5I5M A;  1VZ3 A;  2VDQ A;  4WK0 A;  4L1Q D;  2AGY A;  4QQE A;  5H17 A;  3OKY A;  3GFC A;  3IUQ A;  4IMM A;  5TEE A;  5C2W B;  3KRW B;  3FCU A;  2AGZ A;  2MTA H;  1H2Y A;  4A11 A;  3FM0 A;  1PI6 A;  4GQB B;  2AGW A;  2OIZ A;  1N6E A;  3AL8 A;  1YR2 A;  3C75 H;  4J73 A;  4JSN C;  2YNP A;  3IJ0 A;  2OVQ B;  2IUQ A;  5CYK B;  3UR4 A;  1C9I A;  4G55 A;  4IA9 A;  2YNN A;  3C9C A;  3JPX A;  3EQ8 A;  3BG1 A;  3RSE C;  3KCI A;  3SLE D;  4EWR A;  2I0T A;  3ORV D;  3UKU C;  4PSX B;  1VZ2 A;  2I3T A;  4A0A B;  3K72 A;  4QT8 A;  4XYI A;  4G1M A;  2CN2 A;  1UOP A;  2J56 H;  4A08 A;  1H2W A;  2XE4 A;  4GQ2 P;  3C5M A;  4D0K A;  5EMM B;  4RE6 A;  4JT6 C;  3EI2 B;  1OLZ A;  4FAN D;  5H1M A;  1K3I A;  3CIK B;  2CNX A;  2QC5 A;  1JMX B;  4NEN A;  4CI8 A;  4YVD A;  1O6G A;  2WQ8 A;  2JKX A;  4OWR A;  4PC0 A;  4QAM A;  4ESG A;  4Z7O A;  5FFG A;  5I5J A;  4H5J A;  4AMY A;  2HKR A;  3NVQ A;  2HU8 A;  2H13 A;  4X60 B;  4E54 B;  5EAM A;  5TEF A;  1VE6 A;  3EI4 A;  3VI3 A;  2B5L A;  3V4P A;  3SVW D;  5C86 A;  1JJU B;  2XDW A;  2YB8 B;  5JWZ A;  1GG2 B;  4J87 A;  5EAL A;  4LGN A;  3V7D B;  4GMB A;  4AEZ A;  3NVX A;  4FA5 D;  1UOQ A;  4L3G D;  2HES X;  4D9S A;  3AL9 A;  4AMZ A;  1VYH C;  2BCJ B;  2GC4 A;  4JT5 C;  3F3P A;  4A7J A;  2B5M A;  4GGD A;  4ZOZ A;  5E6S A;  4N14 A;  3IKO A;  3NIF A;  1BPO A;  4A0B A;  5AJA A;  2EBS A;  2H6Q A;  3K6S A;  1U4C A;  3EI3 B;  4X63 B;  5GXI A;  1GOG A;  3SBR A;  1L5G A;  3N0E A;  2VC2 A;  3EI1 B;  2IUR A;  2QZP A;  3N0D A;  2VDN A;  3DDU A;  2IUV A;  4J8G A;  4O1Q D;  2CE8 A;  2P9K C;  1YFQ A;  4J84 A;  5EML B;  4CI1 A;  5AFU 3;  5IJ7 E;  4JXM A;  1XIP A;  2GC7 A;  5CXC B;  3F3G A;  5CXB B;  3ZDY A;  4AOW A;  4J0X A;  2P9P C;  3EI2 A;  4O2W A;  3IUL A;  3ZDZ A;  5E6U A;  1GOT B;  3SMR A;  3OF7 A;  3SXT D;  2VZ1 A;  1GOH A;  4WK2 A;  4WJK A;  3W15 A;  3ZE0 A;  3ZE1 A;  5M5T A;  4U1E I;  4MMX A;  1UTC A;  5HE2 B;  2O9K A;  3EG6 A;  4J86 A;  3SN6 B;  3VI4 A;  1P22 A;  4JSV C;  3O4G A;  4UI9 R;  3EMH A;  3CFS B;  5C2V B;  2P9N C;  4E5Z B;  2G99 A;  4A2L A;  2XL3 A;  4JHP C;  4RE5 A;  2P9S C;  1S4U X;  3UVO A;  1E5T A;  3JZN A;  1I2M B;  4GQ1 A;  4ERY A;  1PBY B;  5EM2 B;  3K71 A;  1QFS A;  1UOO A;  5EAP A;  5THA A;  3DWL C;  2VDR A;  5IJ8 E;  2Q7Q A;  2VZ3 A;  4HDJ A;  3I7H A;  4UM9 A;  4ZOY A;  1A12 A;  4PSW B;  2BBK H;  3UVN A;  2I3S A;  2Z2P A;  4GM9 A;  2H9P A;  2IUP A;  4LG8 A;  2GNQ A;  2TRC B;  4I79 A;  3PE7 A;  2AGL A;  5M5R A;  5AMS A;  1JTD B;  3EI3 A;  4L1M A;  4JHN A;  2P9L C;  4J0W A;  4LG9 A;  5B4W A;  2Z2O A;  4TZ4 A;  2H9L A;  3NID A;  5FQD A;  1K32 A;  1U2V C;  4R7A B;  3MZK A;  3FGB A;  1H2X A;  3PSL A;  1E8N A;  3SBQ A;  4BH6 A;  3VH0 A;  5TF2 A;  2OJY A;  3OL2 B;  1TBG A;  4AX4 A;  3K26 A;  3I2N A;  3OKT A;  3EU7 A;  3CFV A;  1B9X A;  3OW8 A;  1K8K C;  1JMZ B;  3T3M A;  5FLX g;  3L4O D;  3U4Y A;  1XKS A;  2H14 A;  5CXC A;  4BCB A;  3OKY B;  3GD1 I;  3JZG A;  3MUO A;  3NIG A;  4MMZ A;  4L3H D;  3DXK C;  3I7K A;  2VDK A;  4A11 B;  2VDL A;  5GSA A;  2P9U C;  4K3I D;  1SHY B;  3RN1 D;  2XYI A;  5M5S A;  4XEI C;  1JV2 A;  1N6D A;  4IRZ A;  2AQ5 A;  4CC9 A;  1SQJ A;  4BUJ C;  1R5M A;  4KFM B;  5EMK B;  4PNK B;  5IGO A;  4Z7N A;  3I7L A;  3MUN A;  3BWS A;  2AGX A;  3OKW A;  4FWW A;  4G56 B;  3F3F A;  5C9Z B;  1XHM A;  3OTT A;  1E8M A;  1H2Z A;  4PBY A;  4GM8 A;  3IUM A;  1TYE A;  3I7N A;  5CYK A;  2B5N A;  1RI6 A;  3IUR A;  4Y7R A;  3SJL D;  4NC4 A;  4A08 B;  1VE7 A;  2HYE A;  1MG2 A;  4BCC A;  1L0Q A;  3ULE C;  3UVL A;  3SWS D;  2UZX B;  4FB1 D;  2HXC A;  4K3J B;  2I0R A;  2VDM A;  3UKR C;  5H14 A;  5KDO B;  4A0A A;  4G1E A;  2CO0 A;  2H6K A;  5FKQ A;  2UZY B;  2IWF A;  2H6N A;  4OZU A;  3RFH A;  3SHF A;  3C99 A;  4PXW A;  4BP9 A;  4ZN4 A;  2HU5 A;  4D6V A;  4DNV A;  4J81 A;  3UVK A;  3GC3 B;  1QNI A;  2H9N A;  2HKM A;  1GXR A;  2J57 G;  3L4M D;  2HJ4 A;  3EI4 B;  5K1C C;  4GGA A;  2EIE A;  4WK4 A;  3UVM A;  3V9F A;  4J82 A;  2OVR B;  5TDH B;  1GOF A;  1MDA H;  4Z7Q A;  4A2M A;  4E54 A;  4GZ8 A;  2EID A;  5EMJ B;  2AH0 A;  2IWK A;  1FWX A;  2PM6 B;  1JOF A;  3I8C A;  3IJ1 A;  3ODT A;  4DNU A;  3HFQ A;  3OL2 A;  2H47 A;  2P9I C;  4J79 A;  2VDO A;  3MZL A;  3A0F A;  2HJB A;  2XZG A;  3K27 A;  4X3E A;  2PM9 B;  5FKR A;  1SQ9 A;  5FKS A;  4GM3 A;  1PGU A;  3NVN A;  5HE3 B;  4CY2 A;  3PXW D;  2PBI B;  3BG0 A;  4PBZ A;  2YBA A;  5M5U A;  5EAR A;  4J77 A;  5HE0 B;  4A0B B;  5FKT A;  4O9D A;  5HDB A;  5SXM A;  3J81 g;  4JD2 C;  2OK6 A;  3IJE A;  3IUN A;  4CZY A;  3AFC A;  4CZX A;  3I7O A;  5FXY A;  1MG3 A;  4DNW A;  3ZE2 A;  3PVU B;  3VA6 A;  3O4H A;  1ERJ A;  4ES0 A;  4FHL A;  2XL2 A;  4FA1 D;  2CN3 A;  1Q47 A;  1NEX B;  4A09 B;  2I0S A;  4ERZ A;  3JRP A;  4CY1 A;  3EI1 A;  2CE9 A;  4O02 A;  4XYH A;  3V5W B;  2OK4 A;  3MVD K;  4CY3 A;  4JSP C;  2J55 H;  5HYN B;  4NBM A;  3J80 g;  3SCY A;  3I7P A;  4GGC A;  3SBP A;  2H68 A;  2H3X A;  2HU7 A;  3ZWL B;  2YMU A;  3KRX B;  3MKQ A;  2QR5 A;  3FRX A;  4CI3 A;  2VDP A;  3FCS A;  3PXT D;  1NR0 A;  1OMW B;  5CXB A;  3PSC B;  1T2X A;  3RLM D;  3DSM A;  3JRO A;  4AN1 A;  4AN0 A;  5IGQ A;  2BKL A;  2W18 A;  3JB9 L;  3AH8 B;  3AL8 B;  5M61 A;  1O6F A;  3IIW A;  1N6F A;  4X61 B;  2XU7 A;  4QRJ A;  2EIB A;  3V4V A;  3SFZ A;  1TYQ C;  3DM0 A;  3ZDX A;  3O4J A;  1B9Y A;  4ZOV A;  2QXV A;  3T3P A;  5HQG A;  2G9A A;  3VGZ A;  4NAA A;  4QL1 A;  4O3U B;  3O4I A; 
#chains in the Genus database with same CATH homology
 2VDP A;  3FCS A;  3K6S A;  4UM8 A;  5E6R A;  4NEN A;  3ZDZ A;  3ZE2 A;  5E6U A;  2VDQ A;  1L5G A;  4MMY A;  2VC2 A;  3NIG A;  4MMZ A;  4WK0 A;  5FFO A;  2VDK A;  4WK2 A;  4Z7O A;  1TYE A;  2VDL A;  5FFG A;  3K71 A;  2VDN A;  4WJK A;  3ZE0 A;  3ZE1 A;  3FCU A;  1M1X A;  4O02 A;  1U8C A;  3NID A;  2VDR A;  4MMX A;  4WK4 A;  3K72 A;  3V4V A;  4Z7Q A;  4UM9 A;  4G1M A;  1JV2 A;  3VI4 A;  2VDM A;  4IRZ A;  3ZDX A;  3VI3 A;  4G1E A;  5HDB A;  3V4P A;  5E6S A;  3T3P A;  4Z7N A;  3NIF A;  3ZDY A;  3T3M A;  3IJE A;  2VDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...