5HDBA

Integrin alphaiibbeta3 in complex with ro-435054
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title beta-Subunit Binding Is Sufficient for Ligands to Open the Integrin alpha IIb beta 3 Headpiece.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 100
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 5hdbA00
3ZE0A 1L5GA 2VDPA 3FCSA 2VDNA 3T3MA 3NIFA 3V4PA 4Z7QA 2VDKA 2VDLA 4G1MA 2VDQA 3K72A 3FCUA 5FFGA 2VDOA 5E6SA 3NIDA 3V4VA 5E6RA 4MMZA 4G1EA 5FFOA 3K6SA 1JV2A 4NENA 5HDBA 3NIGA 3IJEA 4WJKA 2VDRA 3T3PA 5E6UA 1U8CA 4WK2A 3ZE2A 1TYEA 1M1XA 4O02A 4WK4A 4WK0A 4UM9A 3ZE1A 3K71A 2VDMA 3ZDZA 4MMYA 3ZDYA 2VC2A 4IRZA 4UM8A 3VI4A 4Z7NA 4Z7OA 4MMXA 3VI3A 3ZDXA
chains in the Genus database with same CATH superfamily
4J82A 5C86A 3DWLC 2CN3A 5GXIA 1P22A 1NR0A 5IC7A 4GGCA 1U2VC 2OK6A 4J84A 5FFOA 2HU8A 3O4HA 3NIGA 1GOFA 4QAMA 3F3PA 5AMSA 1MDAH 4FWWA 5IT9g 3K27A 1PGUA 3PVUB 5K1CC 1UOPA 4UM8A 4L1QD 3JPXA 3A0FA 3RN0D 4CI2A 4LGNA 4A0BA 4NBMA 4GMBA 4A08A 1O6GA 1VE6A 3SHFA 2J57G 1VZ3A 4CI1A 2HESX 3IUNA 4LG9A 4J8GA 5E6RA 3UVMA 1SQ9A 4ZOVA 4AEZA 3PXSD 2XZGA 5E6UA 3CIKB 1M1XA 3I7OA 1L0QA 2CO0A 4A09A 4K3JB 3ZWLB 4CZVA 5JWZA 2AH0A 2H13A 4CI8A 4MMYA 1H2ZA 4HDJA 1GOTB 1K3IA 2QR5A 3CFVA 3SBPA 4EWRA 2I0TA 4BL0A 2CNXA 2H14A 4JHNA 2VDOA 5FKRA 1PI6A 4IA9A 3QHYB 1R5MA 4JT5C 5GXHA 1U4CA 4IMMA 1XHMA 1U8CA 3IULA 4WK2A 2PM9B 1E8MA 1PBYB 3K71A 2VDMA 3I8CA 4L3HD 3UKUC 2EBSA 3UVOA 3BG1A 1FWXA 2IAAA 2H9LA 3OKTA 3V4PA 2Q7QA 1H2XA 3F3GA 3FCUA 3SCYA 4E54B 1OLZA 3V4VA 2J56H 3L4OD 4NENA 4JXMA 5M5TA 3DXMC 1PEVA 4O02A 2JKXA 3IJCA 3SN6B 2G9AA 2XL3A 5FLXg 3EQ7A 4ES0A 2P9IC 5M5UA 3IUJA 2W18A 3MZLA 2GC7A 5HQGA 5IGOA 1T2XA 3W15A 4I79A 5M5SA 2OJYA 2P9PC 3F3FA 5CYKB 5I5JA 1VE7A 4U1EI 5H14A 2I0RA 3NVXA 4GQ1A 4GZ8A 2HXCA 3HFQA 3IJEA 4QL1A 3RLMD 2AQ5A 3FRXA 3JRPA 5GSAA 3N0EA 5EMLB 2IWFA 3DM0A 1GG2B 3OW8A 1TYQC 3V9FA 3BWSA 2AGXA 5TEEA 4J78A 3UVLA 4CC9A 3C9CA 3SBRA 2VDPA 4J77A 5CXCB 3DDUA 2CN2A 3C99A 1UOQA 2PM9A 5AJAA 3NIDA 5CXBB 1QNIA 3IIWA 5H1MA 5C9ZB 4YVDA 4FA4D 5IGQA 2TRCB 3OTTA 2OVPB 3SLED 1K32A 4FAVD 4E54A 1QFSA 4CY2A 2YBAA 4O1QD 4XYHA 3V5WB 2VDNA 2WQ8A 3JAMg 3EWEA 3NIFA 4D6VA 4R7AB 4ERQA 4ZOZA 4GM9A 1GOGA 4DNVA 4H5JA 4AMZA 1E8NA 3PXWD 2BBKH 3GFCA 5EMJB 4WJKA 4U7AA 2B5LA 1A12A 5C2VB 3IUMA 5IJ8E 4A0AB 3B7FA 1S4UX 1XIPA 5CYKA 2VC2A 5FA5B 2HKRA 2IURA 1SHYB 3J81g 3IURA 3UVKA 3IJ0A 3O4GA 4ZN4A 2IUPA 2Z2OA 3K72A 4CY3A 5A2Qg 3AH8B 3JZHA 4CY1A 1RI6A 4CI3A 2HU7A 3RSEC 2H6QA 5EALA 4BCBA 2MTAH 3DSMA 3T3PA 5CXCA 2P9SC 4J86A 3C5MA 2J55H 2AGWA 1C9LA 3AFCA 4PSXB 3RN1D 1JMZB 1E5TA 3ZDYA 2VZ3A 5CXBA 3MZKA 3K26A 2XE4A 1MG3A 3RFGA 2EIEA 2YB8B 3SJLD 4X63B 2CE9A 3UR4A 2H9PA 4O2WA 2G99A 3VH0A 3JZNA 4J73A 2B5MA 2H3XA 3EI4B 5TF2A 4MMZA 4UI9R 4D0KA 3J80g 1GXRA 1JV2A 5M5RA 3BG0A 4E5ZB 1NEXB 1SQJA 4BP9A 4NSXA 4G55A 3EMHA 4FAND 4X60B 2EIDA 2AGLA 4PNKB 3MUNA 2XU7A 4A11B 3ZDZA 3EU7A 4IRZA 3SWSD 2BKLA 4LG8A 4J8BA 3IJ1A 3I8EA 2I3SA 3EI1B 2UZXB 3T3MA 2H6KA 1BPOA 4FHLA 5HE2B 3SFZA 2HJBA 4A0AA 5SXMA 5I5IA 4O45A 3MXXA 4J0WA 3PSLA 4Y7RA 4GM8A 3EI2B 1QFMA 3RFHA 4BCCA 2H47A 5THAA 2VZ1A 4J81A 3JROA 3JB9L 3OL2B 2H9NA 3OF7A 4AMYA 4NAAA 5I5MA 1MG2A 3VI4A 4A7JA 1GOHA 4XEIC 4QQEA 4G56B 1UOOA 3PE7A 3GREA 5K19A 3ORVD 1Q47A 3I7NA 2HYEA 3OKYB 4O3TB 2HKMA 2VDQA 4FA5D 2AGZA 2PM7B 5M61A 3SBQA 4K3ID 3KRWB 4Z8LA 1N6EA 4CZXA 5KDOB 4G1EA 5EMKB 3K6SA 3PXTD 5HE0B 3V7DB 3KCIA 3NVQA 2IUVA 1XKSA 2QZPA 3SXTD 3U4YA 3JZGA 2PM6B 2PBIB 2EICA 4BCDA 4Z7NA 5C2WB 3RMZD 2YNPA 3EI3B 1H2WA 3EI4A 3IIYA 4JSVC 3CFSB 3I7LA 1JJUB 4PC0A 4E5ZA 3O4JA 5GMKn 5HE3B 4KFMB 5EM2B 3MMYA 3EQ9A 1N6FA 1K8KC 3I89A 2XDWA 5E6SA 3SVWD 4A11A 4OZUA 3P4FA 4D9SA 4AN1A 3GC3B 4A2MA 4O9DA 3DXKC 3AL8B 4J0XA 4GQBB 3EI1A 5FKSA 3OKWA 3PSCB 2B4EA 1TYEA 4L3GD 4ZOYA 4ERZA 4AN0A 1UTCA 4DNUA 3ODTA 2P9KC 4BH6A 1JMXB 1H2YA 3I7PA 1VZ2A 4JT6C 3EQ8A 4L1MA 1YR2A 2AGYA 4H5IA 1B9YA 3EI2A 3N0DA 4FA9D 4CY5A 2HU5A 4GGAA 4GQ2P 3IUQA 3OL2A 3SMRA 3IVMA 3MKSB 2IUQA 1JTDB 4Y5RD 4JSXC 4JSNC 4TZ4A 4QT8A 4O3UB 5EAMA 2YNOA 3GD1I 3E0CA 3ZE2A 4NC4A 4BUJC 3KRXB 4DNWA 3OKYA 2AH1A 3VA6A 4L9OA 5HYNB 2P9UC 2P9LC 2CE8A 4Z7OA 4OWRA 4BP8A 2I3TA 2H6NA 2OIZA 2Z2NA 5EARA 3FCSA 3VGZA 4Z7QA 1C9IA 5H17A 5FXYA 2I0SA 4G1MA 2H68A 5FFGA 1A0RB 4FB1D 2GC4A 4ESGA 1N6DA 3EI3A 4PBYA 4RE6A 2UZYB 2VDRA 2YNNA 4JHPC 3FM0A 5IJ7E 5EAPA 5EM2A 2OVRB 4WK0A 5FKTA 2EIBA 1ERJA 3MKQA 2IWKA 5FKQA 3RRMC 1VYHC 1JOFA 3UKRC 4FA1D 4AX4A 3O4IA 3I7KA 3AL8A 4N14A 2XL2A 1TBGA 3ULEC 2H9MA 2VDLA 4ZOXA 5TEFA 4AOWA 2QXVA 3NVNA 5M5VA 1I2MB 1GP2B 4GM3A 3PVWB 4X61B 1YFQA 3IKOA 2P9NC 2O9KA 2QC5A 4PXWA 4QRJA 4A0BB 3L4MD 4A08B 3I7HA 4WK4A 2B5NA 4UM9A 3FGBA 3ZE1A 2CO0C 4J79A 5TDHB 4X3EA 3C75H 3MUOA 3MVDK 4PSWB 3ZDXA 4MK0B 1B9XA 4J87A 3ZE0A 1L5GA 4XYIA 2OVQB 3EG6A 4GGDA 5HE1B 1O6FA 5EMMB 4A09B 2Z2PA 2VDKA 4RE5A 5AFU3 2YMUA 5FQDA 3UVNA 2BCJB 2OK4A 5C92A 4JSPC 4CZYA 4JD2C 5HDBA 4A2LA 2XYIA 3QI0A 3I2NA 4PBZA 4ERYA 2HJ4A 1OMWB 4MMXA 3VI3A 5B4WA 3AL9A 2GNQA
chains in the Genus database with same CATH topology
3ZE0A 1L5GA 2VDPA 3FCSA 2VDNA 3T3MA 3NIFA 3V4PA 4Z7QA 2VDKA 2VDLA 4G1MA 2VDQA 3K72A 3FCUA 5FFGA 2VDOA 5E6SA 3NIDA 3V4VA 5E6RA 4MMZA 4G1EA 5FFOA 3K6SA 1JV2A 4NENA 5HDBA 3NIGA 3IJEA 4WJKA 2VDRA 3T3PA 5E6UA 1U8CA 4WK2A 3ZE2A 1TYEA 1M1XA 4O02A 4WK4A 4WK0A 4UM9A 3ZE1A 3K71A 2VDMA 3ZDZA 4MMYA 3ZDYA 2VC2A 4IRZA 4UM8A 3VI4A 4Z7NA 4Z7OA 4MMXA 3VI3A 3ZDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZE0 A;  1L5G A;  2VDP A;  3FCS A;  2VDN A;  3T3M A;  3NIF A;  3V4P A;  4Z7Q A;  2VDK A;  2VDL A;  4G1M A;  2VDQ A;  3K72 A;  3FCU A;  5FFG A;  2VDO A;  5E6S A;  3NID A;  3V4V A;  5E6R A;  4MMZ A;  4G1E A;  5FFO A;  3K6S A;  1JV2 A;  4NEN A;  5HDB A;  3NIG A;  3IJE A;  4WJK A;  2VDR A;  3T3P A;  5E6U A;  1U8C A;  4WK2 A;  3ZE2 A;  1TYE A;  1M1X A;  4O02 A;  4WK4 A;  4WK0 A;  4UM9 A;  3ZE1 A;  3K71 A;  2VDM A;  3ZDZ A;  4MMY A;  3ZDY A;  2VC2 A;  4IRZ A;  4UM8 A;  3VI4 A;  4Z7N A;  4Z7O A;  4MMX A;  3VI3 A;  3ZDX A; 
#chains in the Genus database with same CATH topology
 4J82 A;  5C86 A;  3DWL C;  2CN3 A;  5GXI A;  1P22 A;  1NR0 A;  5IC7 A;  4GGC A;  1U2V C;  2OK6 A;  4J84 A;  5FFO A;  2HU8 A;  3O4H A;  3NIG A;  1GOF A;  4QAM A;  3F3P A;  5AMS A;  1MDA H;  4FWW A;  5IT9 g;  3K27 A;  1PGU A;  3PVU B;  5K1C C;  1UOP A;  4UM8 A;  4L1Q D;  3JPX A;  3A0F A;  3RN0 D;  4CI2 A;  4LGN A;  4A0B A;  4NBM A;  4GMB A;  4A08 A;  1O6G A;  1VE6 A;  3SHF A;  2J57 G;  1VZ3 A;  4CI1 A;  2HES X;  3IUN A;  4LG9 A;  4J8G A;  5E6R A;  3UVM A;  1SQ9 A;  4ZOV A;  4AEZ A;  3PXS D;  2XZG A;  5E6U A;  3CIK B;  1M1X A;  3I7O A;  1L0Q A;  2CO0 A;  4A09 A;  4K3J B;  3ZWL B;  4CZV A;  5JWZ A;  2AH0 A;  2H13 A;  4CI8 A;  4MMY A;  1H2Z A;  4HDJ A;  1GOT B;  1K3I A;  2QR5 A;  3CFV A;  3SBP A;  4EWR A;  2I0T A;  4BL0 A;  2CNX A;  2H14 A;  4JHN A;  2VDO A;  5FKR A;  1PI6 A;  4IA9 A;  3QHY B;  1R5M A;  4JT5 C;  5GXH A;  1U4C A;  4IMM A;  1XHM A;  1U8C A;  3IUL A;  4WK2 A;  2PM9 B;  1E8M A;  1PBY B;  3K71 A;  2VDM A;  3I8C A;  4L3H D;  3UKU C;  2EBS A;  3UVO A;  3BG1 A;  1FWX A;  2IAA A;  2H9L A;  3OKT A;  3V4P A;  2Q7Q A;  1H2X A;  3F3G A;  3FCU A;  3SCY A;  4E54 B;  1OLZ A;  3V4V A;  2J56 H;  3L4O D;  4NEN A;  4JXM A;  5M5T A;  3DXM C;  1PEV A;  4O02 A;  2JKX A;  3IJC A;  3SN6 B;  2G9A A;  2XL3 A;  5FLX g;  3EQ7 A;  4ES0 A;  2P9I C;  5M5U A;  3IUJ A;  2W18 A;  3MZL A;  2GC7 A;  5HQG A;  5IGO A;  1T2X A;  3W15 A;  4I79 A;  5M5S A;  2OJY A;  2P9P C;  3F3F A;  5CYK B;  5I5J A;  1VE7 A;  4U1E I;  5H14 A;  2I0R A;  3NVX A;  4GQ1 A;  4GZ8 A;  2HXC A;  3HFQ A;  3IJE A;  4QL1 A;  3RLM D;  2AQ5 A;  3FRX A;  3JRP A;  5GSA A;  3N0E A;  5EML B;  2IWF A;  3DM0 A;  1GG2 B;  3OW8 A;  1TYQ C;  3V9F A;  3BWS A;  2AGX A;  5TEE A;  4J78 A;  3UVL A;  4CC9 A;  3C9C A;  3SBR A;  2VDP A;  4J77 A;  5CXC B;  3DDU A;  2CN2 A;  3C99 A;  1UOQ A;  2PM9 A;  5AJA A;  3NID A;  5CXB B;  1QNI A;  3IIW A;  5H1M A;  5C9Z B;  4YVD A;  4FA4 D;  5IGQ A;  2TRC B;  3OTT A;  2OVP B;  3SLE D;  1K32 A;  4FAV D;  4E54 A;  1QFS A;  4CY2 A;  2YBA A;  4O1Q D;  4XYH A;  3V5W B;  2VDN A;  2WQ8 A;  3JAM g;  3EWE A;  3NIF A;  4D6V A;  4R7A B;  4ERQ A;  4ZOZ A;  4GM9 A;  1GOG A;  4DNV A;  4H5J A;  4AMZ A;  1E8N A;  3PXW D;  2BBK H;  3GFC A;  5EMJ B;  4WJK A;  4U7A A;  2B5L A;  1A12 A;  5C2V B;  3IUM A;  5IJ8 E;  4A0A B;  3B7F A;  1S4U X;  1XIP A;  5CYK A;  2VC2 A;  5FA5 B;  2HKR A;  2IUR A;  1SHY B;  3J81 g;  3IUR A;  3UVK A;  3IJ0 A;  3O4G A;  4ZN4 A;  2IUP A;  2Z2O A;  3K72 A;  4CY3 A;  5A2Q g;  3AH8 B;  3JZH A;  4CY1 A;  1RI6 A;  4CI3 A;  2HU7 A;  3RSE C;  2H6Q A;  5EAL A;  4BCB A;  2MTA H;  3DSM A;  3T3P A;  5CXC A;  2P9S C;  4J86 A;  3C5M A;  2J55 H;  2AGW A;  1C9L A;  3AFC A;  4PSX B;  3RN1 D;  1JMZ B;  1E5T A;  3ZDY A;  2VZ3 A;  5CXB A;  3MZK A;  3K26 A;  2XE4 A;  1MG3 A;  3RFG A;  2EIE A;  2YB8 B;  3SJL D;  4X63 B;  2CE9 A;  3UR4 A;  2H9P A;  4O2W A;  2G99 A;  3VH0 A;  3JZN A;  4J73 A;  2B5M A;  2H3X A;  3EI4 B;  5TF2 A;  4MMZ A;  4UI9 R;  4D0K A;  3J80 g;  1GXR A;  1JV2 A;  5M5R A;  3BG0 A;  4E5Z B;  1NEX B;  1SQJ A;  4BP9 A;  4NSX A;  4G55 A;  3EMH A;  4FAN D;  4X60 B;  2EID A;  2AGL A;  4PNK B;  3MUN A;  2XU7 A;  4A11 B;  3ZDZ A;  3EU7 A;  4IRZ A;  3SWS D;  2BKL A;  4LG8 A;  4J8B A;  3IJ1 A;  3I8E A;  2I3S A;  3EI1 B;  2UZX B;  3T3M A;  2H6K A;  1BPO A;  4FHL A;  5HE2 B;  3SFZ A;  2HJB A;  4A0A A;  5SXM A;  5I5I A;  4O45 A;  3MXX A;  4J0W A;  3PSL A;  4Y7R A;  4GM8 A;  3EI2 B;  1QFM A;  3RFH A;  4BCC A;  2H47 A;  5THA A;  2VZ1 A;  4J81 A;  3JRO A;  3JB9 L;  3OL2 B;  2H9N A;  3OF7 A;  4AMY A;  4NAA A;  5I5M A;  1MG2 A;  3VI4 A;  4A7J A;  1GOH A;  4XEI C;  4QQE A;  4G56 B;  1UOO A;  3PE7 A;  3GRE A;  5K19 A;  3ORV D;  1Q47 A;  3I7N A;  2HYE A;  3OKY B;  4O3T B;  2HKM A;  2VDQ A;  4FA5 D;  2AGZ A;  2PM7 B;  5M61 A;  3SBQ A;  4K3I D;  3KRW B;  4Z8L A;  1N6E A;  4CZX A;  5KDO B;  4G1E A;  5EMK B;  3K6S A;  3PXT D;  5HE0 B;  3V7D B;  3KCI A;  3NVQ A;  2IUV A;  1XKS A;  2QZP A;  3SXT D;  3U4Y A;  3JZG A;  2PM6 B;  2PBI B;  2EIC A;  4BCD A;  4Z7N A;  5C2W B;  3RMZ D;  2YNP A;  3EI3 B;  1H2W A;  3EI4 A;  3IIY A;  4JSV C;  3CFS B;  3I7L A;  1JJU B;  4PC0 A;  4E5Z A;  3O4J A;  5GMK n;  5HE3 B;  4KFM B;  5EM2 B;  3MMY A;  3EQ9 A;  1N6F A;  1K8K C;  3I89 A;  2XDW A;  5E6S A;  3SVW D;  4A11 A;  4OZU A;  3P4F A;  4D9S A;  4AN1 A;  3GC3 B;  4A2M A;  4O9D A;  3DXK C;  3AL8 B;  4J0X A;  4GQB B;  3EI1 A;  5FKS A;  3OKW A;  3PSC B;  2B4E A;  1TYE A;  4L3G D;  4ZOY A;  4ERZ A;  4AN0 A;  1UTC A;  4DNU A;  3ODT A;  2P9K C;  4BH6 A;  1JMX B;  1H2Y A;  3I7P A;  1VZ2 A;  4JT6 C;  3EQ8 A;  4L1M A;  1YR2 A;  2AGY A;  4H5I A;  1B9Y A;  3EI2 A;  3N0D A;  4FA9 D;  4CY5 A;  2HU5 A;  4GGA A;  4GQ2 P;  3IUQ A;  3OL2 A;  3SMR A;  3IVM A;  3MKS B;  2IUQ A;  1JTD B;  4Y5R D;  4JSX C;  4JSN C;  4TZ4 A;  4QT8 A;  4O3U B;  5EAM A;  2YNO A;  3GD1 I;  3E0C A;  3ZE2 A;  4NC4 A;  4BUJ C;  3KRX B;  4DNW A;  3OKY A;  2AH1 A;  3VA6 A;  4L9O A;  5HYN B;  2P9U C;  2P9L C;  2CE8 A;  4Z7O A;  4OWR A;  4BP8 A;  2I3T A;  2H6N A;  2OIZ A;  2Z2N A;  5EAR A;  3FCS A;  3VGZ A;  4Z7Q A;  1C9I A;  5H17 A;  5FXY A;  2I0S A;  4G1M A;  2H68 A;  5FFG A;  1A0R B;  4FB1 D;  2GC4 A;  4ESG A;  1N6D A;  3EI3 A;  4PBY A;  4RE6 A;  2UZY B;  2VDR A;  2YNN A;  4JHP C;  3FM0 A;  5IJ7 E;  5EAP A;  5EM2 A;  2OVR B;  4WK0 A;  5FKT A;  2EIB A;  1ERJ A;  3MKQ A;  2IWK A;  5FKQ A;  3RRM C;  1VYH C;  1JOF A;  3UKR C;  4FA1 D;  4AX4 A;  3O4I A;  3I7K A;  3AL8 A;  4N14 A;  2XL2 A;  1TBG A;  3ULE C;  2H9M A;  2VDL A;  4ZOX A;  5TEF A;  4AOW A;  2QXV A;  3NVN A;  5M5V A;  1I2M B;  1GP2 B;  4GM3 A;  3PVW B;  4X61 B;  1YFQ A;  3IKO A;  2P9N C;  2O9K A;  2QC5 A;  4PXW A;  4QRJ A;  4A0B B;  3L4M D;  4A08 B;  3I7H A;  4WK4 A;  2B5N A;  4UM9 A;  3FGB A;  3ZE1 A;  2CO0 C;  4J79 A;  5TDH B;  4X3E A;  3C75 H;  3MUO A;  3MVD K;  4PSW B;  3ZDX A;  4MK0 B;  1B9X A;  4J87 A;  3ZE0 A;  1L5G A;  4XYI A;  2OVQ B;  3EG6 A;  4GGD A;  5HE1 B;  1O6F A;  5EMM B;  4A09 B;  2Z2P A;  2VDK A;  4RE5 A;  5AFU 3;  2YMU A;  5FQD A;  3UVN A;  2BCJ B;  2OK4 A;  5C92 A;  4JSP C;  4CZY A;  4JD2 C;  5HDB A;  4A2L A;  2XYI A;  3QI0 A;  3I2N A;  4PBZ A;  4ERY A;  2HJ4 A;  1OMW B;  4MMX A;  3VI3 A;  5B4W A;  3AL9 A;  2GNQ A; 
#chains in the Genus database with same CATH homology
 3ZE0 A;  1L5G A;  2VDP A;  3FCS A;  2VDN A;  3T3M A;  3NIF A;  3V4P A;  4Z7Q A;  2VDK A;  2VDL A;  4G1M A;  2VDQ A;  3K72 A;  3FCU A;  5FFG A;  2VDO A;  5E6S A;  3NID A;  3V4V A;  5E6R A;  4MMZ A;  4G1E A;  5FFO A;  3K6S A;  1JV2 A;  4NEN A;  5HDB A;  3NIG A;  3IJE A;  4WJK A;  2VDR A;  3T3P A;  5E6U A;  1U8C A;  4WK2 A;  3ZE2 A;  1TYE A;  1M1X A;  4O02 A;  4WK4 A;  4WK0 A;  4UM9 A;  3ZE1 A;  3K71 A;  2VDM A;  3ZDZ A;  4MMY A;  3ZDY A;  2VC2 A;  4IRZ A;  4UM8 A;  3VI4 A;  4Z7N A;  4Z7O A;  4MMX A;  3VI3 A;  3ZDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...