2I0RA

Crystal structure of aromatic amine dehydrogenase ttq-formamide adduct
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVADDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic Amine Dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 97
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2i0rA01
3PXWD 3SCYA 3F3PA 3UVKA 4Y7RA 3OKYA 1NR0A 4A0BB 2QXVA 4JT6C 3ZWLB 4QRJA 4IMMA 5THAA 4A11A 4E5ZB 3AL9A 2I3TA 4ES0A 2YMUA 3DSMA 2IURA 1OLZA 2OK4A 3MZKA 5IJ7E 4A2MA 3DM0A 3IJ1A 2XL2A 4X63B 3UVNA 1FWXA 3EI2A 3EI1B 4CZVA 3RMZD 1U2VC 2OVQB 4PSXB 3C75H 2H6NA 5EMJB 4LG9A 2BCJB 2AGXA 1R5MA 2P9IC 5H14A 2CO0C 3JPXA 4IA9A 3BG0A 3JZGA 2I0SA 3NVXA 1GP2B 3BWSA 3K27A 4XYHA 4ZOVA 3SVWD 4U1EI 4PBYA 3NVNA 4CY1A 2J57G 3OW8A 5EMMB 4CY3A 5FXYA 2UZXB 4J78A 4XYIA 4FB1D 4A11B 3SBPA 3F3FA 5KDOB 3V9FA 3RN1D 5HE0B 4FWWA 2P9SC 4L3GD 5FKQA 4ERZA 3JRPA 2PM6B 1JMZB 2AH0A 2H13A 5EARA 3NVQA 4K3JB 4PXWA 3JAMg 5FQDA 1PGUA 2H68A 4R7AB 5K1CC 2OJYA 5CXBA 4J73A 3HFQA 1L0QA 5A2Qg 4J0XA 2H3XA 4GQBB 5IJ8E 4N14A 4FA5D 2PM9A 4NSXA 2QC5A 2YBAA 3IJ0A 3MKQA 5GSAA 3GREA 1GG2B 2XYIA 5C2WB 3SXTD 2H6KA 2H9PA 2YNOA 4GM9A 4TZ4A 2GC7A 2CE9A 5HE1B 3FM0A 4JSXC 4L1QD 3KRXB 5CYKB 3MMYA 1NEXB 3I89A 4QQEA 2P9UC 4CZYA 3OKTA 4Z8LA 2AGYA 5CXCA 2J55H 4A08A 3PVUB 3N0DA 2G99A 2HJBA 5C9ZB 4FA4D 1S4UX 3UVOA 3EMHA 4BUJC 4X61B 4O9DA 4O1QD 3OTTA 2Z2OA 2OVPB 4GMBA 3MXXA 4O3UB 3SBQA 3AL8B 1ERJA 4J81A 2HESX 4I79A 5EMKB 4PSWB 3SMRA 4PNKB 2J56H 4GM8A 1JMXB 4OWRA 1QNIA 3EI4A 5HYNB 5EM2A 1RI6A 2Z2PA 2B4EA 5TF2A 3C9CA 3JROA 4LGNA 1B9YA 2P9KC 2Q7QA 4J0WA 4J8GA 3IKOA 4GGAA 3RRMC 2IUQA 3PSCB 5IT9g 4J8BA 2P9NC 1MG3A 2CN2A 2I0RA 2OIZA 4GGDA 3IIWA 5HE3B 5FKRA 3OKYB 3EU7A 3SBRA 2H9MA 5IC7A 1K32A 2IWKA 4CC9A 2B5LA 3PSLA 3UKRC 3V7DB 4D6VA 4JD2C 3B7FA 3EI4B 1TBGA 4ESGA 1JOFA 1N6FA 3I7PA 1MG2A 2H6QA 4XEIC 3EI2B 1PBYB 3RFGA 4ERYA 4X60B 4ZN4A 1TYQC 4GQ1A 5GXIA 1SQ9A 3EG6A 3FRXA 4FA1D 1PEVA 1MDAH 1U4CA 1XKSA 4GM3A 4E54A 1N6EA 4PC0A 3DXKC 5H1MA 2BBKH 3VGZA 5GMKn 1P22A 5JWZA 5FKSA 3UVLA 1Q47A 3EI3A 3PXTD 2EBSA 2IAAA 2O9KA 3I7LA 2HJ4A 4ZOZA 3U4YA 4BL0A 3VH0A 4A09A 4AOWA 2OK6A 3C99A 2UZYB 4ZOXA 5TEEA 3IJCA 2AGZA 4ERQA 2H14A 5SXMA 4J84A 2YNNA 1GXRA 4H5IA 2YB8B 4LG8A 1OMWB 4H5JA 4O45A 3AH8B 4OZUA 2W18A 3I7NA 5FA5B 4E5ZA 1GOTB 2H47A 4CY5A 3SLED 2AQ5A 3I7OA 3SJLD 1SQJA 2PM7B 2AGWA 3I7KA 4Y5RD 1XHMA 4J86A 2AGLA 5HE2B 1A0RB 3JB9L 4E54B 5CXBB 4J77A 2CO0A 5AFU3 3EI1A 2HKMA 4U7AA 3J80g 4GZ8A 2I0TA 2B5NA 3I8EA 3PE7A 2PM9B 2G9AA 5FLXg 3MKSB 4CZXA 2P9LC 2B5MA 2YNPA 3OL2A 5H17A 5B4WA 5GXHA 4JSVC 3ULEC 5AMSA 2HXCA 4FHLA 1PI6A 3I2NA 4O3TB 4KFMB 1B9XA 2GNQA 3FGBA 1JJUB 4L9OA 4QL1A 2I3SA 4JT5C 3PVWB 3SN6B 3RSEC 2HYEA 5I5IA 5CXCB 4FAND 4A0AA 4A08B 4X3EA 4YVDA 4CI2A 4FAVD 3V5WB 5IGQA 1XIPA 4L3HD 3RLMD 3RFHA 3W15A 4CI3A 4PBZA 2IUVA 2PBIB 4EWRA 4CI1A 2HKRA 4G56B 3UR4A 2Z2NA 3PXSD 5C2VB 4A7JA 3C5MA 5I5JA 4UI9R 3SHFA 2MTAH 4J79A 3OL2B 3CFSB 4FA9D 4JXMA 5EM2B 5IGOA 3CIKB 3F3GA 5TDHB 3UKUC 3ODTA 3EWEA 4A2LA 3AFCA 3BG1A 4HDJA 4JSPC 3DXMC 2GC4A 3JZNA 2P9PC 4A0AB 2OVRB 5CYKA 2CE8A 3L4MD 4GGCA 2IWFA 3GFCA 5EALA 4BH6A 3VA6A 4AEZA 3E0CA 3J81g 2CN3A 5I5MA 4GQ2P 4J82A 3SFZA 5AJAA 3A0FA 5HQGA 4D0KA 2TRCB 2AH1A 2H9NA 4ZOYA 2H9LA 5TEFA 5EMLB 4QT8A 1YFQA 3JZHA 3CFVA 4J87A 4A0BA 3MZLA 3P4FA 3I7HA 3AL8A 4MK0B 2XU7A 3RN0D 4K3ID 3SWSD 5K19A 2CNXA 4CI8A 4CY2A 3L4OD 1N6DA 1SHYB 1K8KC 3DWLC 4JSNC 3N0EA 3K26A 3EI3B 3I8CA 3UVMA 2XL3A 3OKWA 3IIYA 5FKTA 4A09B 5EAPA 1VYHC 5EAMA 2IUPA 3KRWB 3ORVD
chains in the Genus database with same CATH superfamily
3PXWD 3SCYA 1C9IA 3F3PA 3UVKA 4Y7RA 4MMYA 3OKYA 1NR0A 4WK0A 4A0BB 2QXVA 4JT6C 3ZWLB 4QRJA 4IMMA 4L1MA 5THAA 4DNUA 4A11A 4E5ZB 2HU7A 3AL9A 2I3TA 4ES0A 3O4GA 2YMUA 3DSMA 2XE4A 4RE5A 2IURA 1OLZA 2OK4A 3MZKA 5IJ7E 4A2MA 4DNWA 3DM0A 3IJ1A 2XL2A 4X63B 3UVNA 1FWXA 3EI2A 2VDRA 3NIGA 3EI1B 4AMYA 4CZVA 3RMZD 1U2VC 1YR2A 1JTDB 2OVQB 4PSXB 5C86A 3C75H 2H6NA 5EMJB 4LG9A 4AN1A 2BCJB 4DNVA 2AGXA 4D9SA 1R5MA 2P9IC 5H14A 2CO0C 3JPXA 4O02A 1E8MA 4IA9A 3BG0A 3JZGA 2I0SA 3NVXA 3VI3A 1GP2B 3BWSA 3K27A 4XYHA 4WK2A 4ZOVA 3SVWD 4U1EI 5M5VA 4PBYA 3NVNA 4NAAA 4CY1A 2J57G 3OW8A 5EMMB 4CY3A 5FXYA 2UZXB 3MUNA 4J78A 4XYIA 4FB1D 4A11B 3SBPA 3F3FA 5KDOB 3V9FA 2EIEA 1GOHA 3RN1D 5HE0B 4FWWA 2P9SC 4L3GD 5FKQA 4ERZA 3JRPA 4MMXA 2PM6B 2VDMA 1JMZB 2AH0A 2H13A 5EARA 3NVQA 5E6RA 4BP8A 4K3JB 4PXWA 3JAMg 2QZPA 5FQDA 1PGUA 2H68A 4R7AB 5K1CC 2OJYA 5CXBA 4BCBA 4J73A 3HFQA 5HDBA 1L0QA 3FCSA 1I2MB 4J0XA 2H3XA 4GQBB 5A2Qg 5IJ8E 4Z7NA 4N14A 2VDPA 4FA5D 2PM9A 4NSXA 3DDUA 2QC5A 2YBAA 3IJ0A 3MKQA 5GSAA 3GREA 3IUMA 1GG2B 2XYIA 5C2WB 3SXTD 2H6KA 1U8CA 5FFGA 2H9PA 2YNOA 4GM9A 1VZ3A 4TZ4A 2GC7A 3IVMA 2CE9A 5HE1B 3FM0A 4JSXC 4L1QD 3KRXB 5CYKB 3MMYA 1NEXB 3I89A 4QQEA 2P9UC 4CZYA 3OKTA 4Z8LA 5M5RA 2AGYA 5CXCA 2J55H 4A08A 3PVUB 3N0DA 5E6SA 2G99A 2HJBA 5C9ZB 4FA4D 4RE6A 1S4UX 1JV2A 2BKLA 3UVOA 3EMHA 4G55A 4BUJC 4X61B 4O9DA 4AN0A 3ZE2A 4JHPC 4O1QD 3OTTA 2Z2OA 4NBMA 3KCIA 2OVPB 4GMBA 3MXXA 4O3UB 3QHYB 3SBQA 3AL8B 1ERJA 4J81A 2HESX 4I79A 5EMKB 2XZGA 4PSWB 3SMRA 4PNKB 2J56H 4GM8A 1JMXB 1E5TA 4OWRA 1QNIA 3EI4A 5HYNB 5EM2A 3IJEA 1VE7A 3O4HA 1RI6A 2Z2PA 2B4EA 5TF2A 3C9CA 3JROA 4Z7QA 4LGNA 1B9YA 2P9KC 2Q7QA 4J0WA 4WK4A 4J8GA 3IKOA 4GGAA 3IUQA 3RRMC 2IUQA 3PSCB 4WJKA 5IT9g 2EICA 1UOQA 4J8BA 2P9NC 1MG3A 2CN2A 3T3MA 2I0RA 1E8NA 2OIZA 4GGDA 3IIWA 5HE3B 5FKRA 2VDNA 3OKYB 5M5SA 3EU7A 3SBRA 2H9MA 5IC7A 1K32A 2IWKA 4CC9A 2B5LA 3PSLA 3UKRC 3V7DB 4D6VA 1BPOA 4JD2C 3B7FA 1K3IA 3EI4B 1TBGA 4ESGA 1JOFA 5M5TA 1N6FA 3I7PA 1MG2A 2H6QA 4XEIC 3EI2B 1PBYB 3RFGA 4ERYA 4X60B 4ZN4A 1TYQC 4GQ1A 5GXIA 1SQ9A 3EG6A 3FRXA 4BP9A 4FA1D 2EIDA 1PEVA 1MDAH 1U4CA 1XKSA 4GM3A 4E54A 1QFSA 3T3PA 1N6EA 4PC0A 3DXKC 5H1MA 2BBKH 4QAMA 3VGZA 5GMKn 1P22A 5JWZA 5FKSA 3UVLA 3QI0A 1Q47A 3EI3A 3NIFA 3PXTD 2EBSA 2IAAA 2O9KA 3I7LA 2HJ4A 1H2XA 4ZOZA 3U4YA 4BL0A 3FCUA 3VH0A 4A09A 4AOWA 2OK6A 3C99A 3K71A 2UZYB 4ZOXA 5TEEA 3IJCA 4UM8A 2AGZA 4ERQA 2H14A 5SXMA 4BCDA 2VZ1A 4J84A 2YNNA 1GXRA 2XDWA 4H5IA 2YB8B 3IUNA 4LG8A 5FFOA 1OMWB 4H5JA 4O45A 3AH8B 2W18A 3I7NA 4OZUA 5FA5B 3ZDXA 4E5ZA 2HU8A 1GOTB 2H47A 4CY5A 3ZE0A 4IRZA 3SLED 2AQ5A 3I7OA 3SJLD 2QR5A 1SQJA 1VZ2A 2PM7B 2AGWA 3I7KA 4Y5RD 5C92A 1XHMA 4J86A 2AGLA 5HE2B 1A0RB 3ZE1A 3JB9L 1H2WA 4E54B 1UOPA 4NC4A 5CXBB 3O4JA 2CO0A 4J77A 1GOGA 5AFU3 3EI1A 2HKMA 4U7AA 1UTCA 4AX4A 3J80g 4GZ8A 2I0TA 4O2WA 2B5NA 3I8EA 3PE7A 1H2ZA 2PM9B 2G9AA 5FLXg 3MKSB 4CZXA 3NIDA 2P9LC 1A12A 3GD1I 2B5MA 2YNPA 3OL2A 5H17A 5B4WA 5GXHA 4JSVC 3ULEC 3IULA 5AMSA 2HXCA 2VDQA 4FHLA 1PI6A 3I2NA 4O3TB 4KFMB 1B9XA 2GNQA 3FGBA 3MVDK 1JJUB 4L9OA 2EIBA 1H2YA 4QL1A 3V4VA 2I3SA 3EQ9A 4JT5C 3PVWB 3EQ8A 3SN6B 3RSEC 4NENA 3V4PA 5I5IA 5CXCB 2HYEA 1QFMA 3K72A 4FAND 4A0AA 2VC2A 4A08B 4X3EA 4YVDA 4CI2A 4FAVD 3V5WB 5IGQA 1XIPA 4L3HD 3RLMD 3RFHA 3W15A 4CI3A 4PBZA 2IUVA 2PBIB 4EWRA 4CI1A 2HKRA 4G56B 3UR4A 3VI4A 2Z2NA 3PXSD 5C2VB 4A7JA 3C5MA 5I5JA 4UI9R 3SHFA 5M5UA 2JKXA 2MTAH 5E6UA 4J79A 4BCCA 1C9LA 4MMZA 2WQ8A 3OL2B 2VDOA 3CFSB 4JHNA 3EQ7A 4FA9D 4JXMA 5EM2B 5IGOA 3OF7A 3CIKB 3F3GA 5TDHB 3UKUC 3ODTA 1T2XA 4Z7OA 5M61A 3EWEA 4A2LA 3AFCA 3BG1A 4HDJA 4JSPC 3DXMC 2VDKA 2GC4A 3JZNA 2P9PC 4G1MA 4A0AB 2VZ3A 2OVRB 1VE6A 2HU5A 5CYKA 2CE8A 3L4MD 4GGCA 3O4IA 2IWFA 3GFCA 3MUOA 5EALA 4BH6A 3VA6A 4AEZA 3E0CA 3J81g 2CN3A 1GOFA 3ZDZA 5I5MA 4GQ2P 4J82A 3SFZA 5AJAA 3A0FA 5HQGA 4D0KA 2TRCB 2AH1A 2H9NA 4ZOYA 2H9LA 5TEFA 5EMLB 4QT8A 1L5GA 1YFQA 3JZHA 1UOOA 3CFVA 4G1EA 4J87A 4A0BA 3ZDYA 3MZLA 3P4FA 3I7HA 1O6FA 3AL8A 4MK0B 2XU7A 3RN0D 1M1XA 4K3ID 3SWSD 5K19A 2CNXA 4CI8A 4CY2A 3L4OD 1O6GA 1N6DA 1SHYB 1TYEA 1K8KC 3DWLC 4JSNC 4AMZA 3N0EA 3K26A 3EI3B 3I8CA 3UVMA 2XL3A 3OKWA 3IIYA 5FKTA 2VDLA 4A09B 5EAPA 3IUJA 1VYHC 5EAMA 3K6SA 4UM9A 2IUPA 3GC3B 3KRWB 3IURA 3ORVD
chains in the Genus database with same CATH topology
3PXWD 3SCYA 3F3PA 3UVKA 4Y7RA 3OKYA 1NR0A 4A0BB 2QXVA 4JT6C 3ZWLB 4QRJA 4IMMA 5THAA 4A11A 4E5ZB 3AL9A 2I3TA 4ES0A 2YMUA 3DSMA 2IURA 1OLZA 2OK4A 3MZKA 5IJ7E 4A2MA 3DM0A 3IJ1A 2XL2A 4X63B 3UVNA 1FWXA 3EI2A 3EI1B 4CZVA 3RMZD 1U2VC 2OVQB 4PSXB 3C75H 2H6NA 5EMJB 4LG9A 2BCJB 2AGXA 1R5MA 2P9IC 5H14A 2CO0C 3JPXA 4IA9A 3BG0A 3JZGA 2I0SA 3NVXA 1GP2B 3BWSA 3K27A 4XYHA 4ZOVA 3SVWD 4U1EI 4PBYA 3NVNA 4CY1A 2J57G 3OW8A 5EMMB 4CY3A 5FXYA 2UZXB 4J78A 4XYIA 4FB1D 4A11B 3SBPA 3F3FA 5KDOB 3V9FA 3RN1D 5HE0B 4FWWA 2P9SC 4L3GD 5FKQA 4ERZA 3JRPA 2PM6B 1JMZB 2AH0A 2H13A 5EARA 3NVQA 4K3JB 4PXWA 3JAMg 5FQDA 1PGUA 2H68A 4R7AB 5K1CC 2OJYA 5CXBA 4J73A 3HFQA 1L0QA 5A2Qg 4J0XA 2H3XA 4GQBB 5IJ8E 4N14A 4FA5D 2PM9A 4NSXA 2QC5A 2YBAA 3IJ0A 3MKQA 5GSAA 3GREA 1GG2B 2XYIA 5C2WB 3SXTD 2H6KA 2H9PA 2YNOA 4GM9A 4TZ4A 2GC7A 2CE9A 5HE1B 3FM0A 4JSXC 4L1QD 3KRXB 5CYKB 3MMYA 1NEXB 3I89A 4QQEA 2P9UC 4CZYA 3OKTA 4Z8LA 2AGYA 5CXCA 2J55H 4A08A 3PVUB 3N0DA 2G99A 2HJBA 5C9ZB 4FA4D 1S4UX 3UVOA 3EMHA 4BUJC 4X61B 4O9DA 4O1QD 3OTTA 2Z2OA 2OVPB 4GMBA 3MXXA 4O3UB 3SBQA 3AL8B 1ERJA 4J81A 2HESX 4I79A 5EMKB 4PSWB 3SMRA 4PNKB 2J56H 4GM8A 1JMXB 4OWRA 1QNIA 3EI4A 5HYNB 5EM2A 1RI6A 2Z2PA 2B4EA 5TF2A 3C9CA 3JROA 4LGNA 1B9YA 2P9KC 2Q7QA 4J0WA 4J8GA 3IKOA 4GGAA 3RRMC 2IUQA 3PSCB 5IT9g 4J8BA 2P9NC 1MG3A 2CN2A 2I0RA 2OIZA 4GGDA 3IIWA 5HE3B 5FKRA 3OKYB 3EU7A 3SBRA 2H9MA 5IC7A 1K32A 2IWKA 4CC9A 2B5LA 3PSLA 3UKRC 3V7DB 4D6VA 4JD2C 3B7FA 3EI4B 1TBGA 4ESGA 1JOFA 1N6FA 3I7PA 1MG2A 2H6QA 4XEIC 3EI2B 1PBYB 3RFGA 4ERYA 4X60B 4ZN4A 1TYQC 4GQ1A 5GXIA 1SQ9A 3EG6A 3FRXA 4FA1D 1PEVA 1MDAH 1U4CA 1XKSA 4GM3A 4E54A 1N6EA 4PC0A 3DXKC 5H1MA 2BBKH 3VGZA 5GMKn 1P22A 5JWZA 5FKSA 3UVLA 1Q47A 3EI3A 3PXTD 2EBSA 2IAAA 2O9KA 3I7LA 2HJ4A 4ZOZA 3U4YA 4BL0A 3VH0A 4A09A 4AOWA 2OK6A 3C99A 2UZYB 4ZOXA 5TEEA 3IJCA 2AGZA 4ERQA 2H14A 5SXMA 4J84A 2YNNA 1GXRA 4H5IA 2YB8B 4LG8A 1OMWB 4H5JA 4O45A 3AH8B 4OZUA 2W18A 3I7NA 5FA5B 4E5ZA 1GOTB 2H47A 4CY5A 3SLED 2AQ5A 3I7OA 3SJLD 1SQJA 2PM7B 2AGWA 3I7KA 4Y5RD 1XHMA 4J86A 2AGLA 5HE2B 1A0RB 3JB9L 4E54B 5CXBB 4J77A 2CO0A 5AFU3 3EI1A 2HKMA 4U7AA 3J80g 4GZ8A 2I0TA 2B5NA 3I8EA 3PE7A 2PM9B 2G9AA 5FLXg 3MKSB 4CZXA 2P9LC 2B5MA 2YNPA 3OL2A 5H17A 5B4WA 5GXHA 4JSVC 3ULEC 5AMSA 2HXCA 4FHLA 1PI6A 3I2NA 4O3TB 4KFMB 1B9XA 2GNQA 3FGBA 1JJUB 4L9OA 4QL1A 2I3SA 4JT5C 3PVWB 3SN6B 3RSEC 2HYEA 5I5IA 5CXCB 4FAND 4A0AA 4A08B 4X3EA 4YVDA 4CI2A 4FAVD 3V5WB 5IGQA 1XIPA 4L3HD 3RLMD 3RFHA 3W15A 4CI3A 4PBZA 2IUVA 2PBIB 4EWRA 4CI1A 2HKRA 4G56B 3UR4A 2Z2NA 3PXSD 5C2VB 4A7JA 3C5MA 5I5JA 4UI9R 3SHFA 2MTAH 4J79A 3OL2B 3CFSB 4FA9D 4JXMA 5EM2B 5IGOA 3CIKB 3F3GA 5TDHB 3UKUC 3ODTA 3EWEA 4A2LA 3AFCA 3BG1A 4HDJA 4JSPC 3DXMC 2GC4A 3JZNA 2P9PC 4A0AB 2OVRB 5CYKA 2CE8A 3L4MD 4GGCA 2IWFA 3GFCA 5EALA 4BH6A 3VA6A 4AEZA 3E0CA 3J81g 2CN3A 5I5MA 4GQ2P 4J82A 3SFZA 5AJAA 3A0FA 5HQGA 4D0KA 2TRCB 2AH1A 2H9NA 4ZOYA 2H9LA 5TEFA 5EMLB 4QT8A 1YFQA 3JZHA 3CFVA 4J87A 4A0BA 3MZLA 3P4FA 3I7HA 3AL8A 4MK0B 2XU7A 3RN0D 4K3ID 3SWSD 5K19A 2CNXA 4CI8A 4CY2A 3L4OD 1N6DA 1SHYB 1K8KC 3DWLC 4JSNC 3N0EA 3K26A 3EI3B 3I8CA 3UVMA 2XL3A 3OKWA 3IIYA 5FKTA 4A09B 5EAPA 1VYHC 5EAMA 2IUPA 3KRWB 3ORVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW D;  3SCY A;  3F3P A;  3UVK A;  4Y7R A;  3OKY A;  1NR0 A;  4A0B B;  2QXV A;  4JT6 C;  3ZWL B;  4QRJ A;  4IMM A;  5THA A;  4A11 A;  4E5Z B;  3AL9 A;  2I3T A;  4ES0 A;  2YMU A;  3DSM A;  2IUR A;  1OLZ A;  2OK4 A;  3MZK A;  5IJ7 E;  4A2M A;  3DM0 A;  3IJ1 A;  2XL2 A;  4X63 B;  3UVN A;  1FWX A;  3EI2 A;  3EI1 B;  4CZV A;  3RMZ D;  1U2V C;  2OVQ B;  4PSX B;  3C75 H;  2H6N A;  5EMJ B;  4LG9 A;  2BCJ B;  2AGX A;  1R5M A;  2P9I C;  5H14 A;  2CO0 C;  3JPX A;  4IA9 A;  3BG0 A;  3JZG A;  2I0S A;  3NVX A;  1GP2 B;  3BWS A;  3K27 A;  4XYH A;  4ZOV A;  3SVW D;  4U1E I;  4PBY A;  3NVN A;  4CY1 A;  2J57 G;  3OW8 A;  5EMM B;  4CY3 A;  5FXY A;  2UZX B;  4J78 A;  4XYI A;  4FB1 D;  4A11 B;  3SBP A;  3F3F A;  5KDO B;  3V9F A;  3RN1 D;  5HE0 B;  4FWW A;  2P9S C;  4L3G D;  5FKQ A;  4ERZ A;  3JRP A;  2PM6 B;  1JMZ B;  2AH0 A;  2H13 A;  5EAR A;  3NVQ A;  4K3J B;  4PXW A;  3JAM g;  5FQD A;  1PGU A;  2H68 A;  4R7A B;  5K1C C;  2OJY A;  5CXB A;  4J73 A;  3HFQ A;  1L0Q A;  5A2Q g;  4J0X A;  2H3X A;  4GQB B;  5IJ8 E;  4N14 A;  4FA5 D;  2PM9 A;  4NSX A;  2QC5 A;  2YBA A;  3IJ0 A;  3MKQ A;  5GSA A;  3GRE A;  1GG2 B;  2XYI A;  5C2W B;  3SXT D;  2H6K A;  2H9P A;  2YNO A;  4GM9 A;  4TZ4 A;  2GC7 A;  2CE9 A;  5HE1 B;  3FM0 A;  4JSX C;  4L1Q D;  3KRX B;  5CYK B;  3MMY A;  1NEX B;  3I89 A;  4QQE A;  2P9U C;  4CZY A;  3OKT A;  4Z8L A;  2AGY A;  5CXC A;  2J55 H;  4A08 A;  3PVU B;  3N0D A;  2G99 A;  2HJB A;  5C9Z B;  4FA4 D;  1S4U X;  3UVO A;  3EMH A;  4BUJ C;  4X61 B;  4O9D A;  4O1Q D;  3OTT A;  2Z2O A;  2OVP B;  4GMB A;  3MXX A;  4O3U B;  3SBQ A;  3AL8 B;  1ERJ A;  4J81 A;  2HES X;  4I79 A;  5EMK B;  4PSW B;  3SMR A;  4PNK B;  2J56 H;  4GM8 A;  1JMX B;  4OWR A;  1QNI A;  3EI4 A;  5HYN B;  5EM2 A;  1RI6 A;  2Z2P A;  2B4E A;  5TF2 A;  3C9C A;  3JRO A;  4LGN A;  1B9Y A;  2P9K C;  2Q7Q A;  4J0W A;  4J8G A;  3IKO A;  4GGA A;  3RRM C;  2IUQ A;  3PSC B;  5IT9 g;  4J8B A;  2P9N C;  1MG3 A;  2CN2 A;  2I0R A;  2OIZ A;  4GGD A;  3IIW A;  5HE3 B;  5FKR A;  3OKY B;  3EU7 A;  3SBR A;  2H9M A;  5IC7 A;  1K32 A;  2IWK A;  4CC9 A;  2B5L A;  3PSL A;  3UKR C;  3V7D B;  4D6V A;  4JD2 C;  3B7F A;  3EI4 B;  1TBG A;  4ESG A;  1JOF A;  1N6F A;  3I7P A;  1MG2 A;  2H6Q A;  4XEI C;  3EI2 B;  1PBY B;  3RFG A;  4ERY A;  4X60 B;  4ZN4 A;  1TYQ C;  4GQ1 A;  5GXI A;  1SQ9 A;  3EG6 A;  3FRX A;  4FA1 D;  1PEV A;  1MDA H;  1U4C A;  1XKS A;  4GM3 A;  4E54 A;  1N6E A;  4PC0 A;  3DXK C;  5H1M A;  2BBK H;  3VGZ A;  5GMK n;  1P22 A;  5JWZ A;  5FKS A;  3UVL A;  1Q47 A;  3EI3 A;  3PXT D;  2EBS A;  2IAA A;  2O9K A;  3I7L A;  2HJ4 A;  4ZOZ A;  3U4Y A;  4BL0 A;  3VH0 A;  4A09 A;  4AOW A;  2OK6 A;  3C99 A;  2UZY B;  4ZOX A;  5TEE A;  3IJC A;  2AGZ A;  4ERQ A;  2H14 A;  5SXM A;  4J84 A;  2YNN A;  1GXR A;  4H5I A;  2YB8 B;  4LG8 A;  1OMW B;  4H5J A;  4O45 A;  3AH8 B;  4OZU A;  2W18 A;  3I7N A;  5FA5 B;  4E5Z A;  1GOT B;  2H47 A;  4CY5 A;  3SLE D;  2AQ5 A;  3I7O A;  3SJL D;  1SQJ A;  2PM7 B;  2AGW A;  3I7K A;  4Y5R D;  1XHM A;  4J86 A;  2AGL A;  5HE2 B;  1A0R B;  3JB9 L;  4E54 B;  5CXB B;  4J77 A;  2CO0 A;  5AFU 3;  3EI1 A;  2HKM A;  4U7A A;  3J80 g;  4GZ8 A;  2I0T A;  2B5N A;  3I8E A;  3PE7 A;  2PM9 B;  2G9A A;  5FLX g;  3MKS B;  4CZX A;  2P9L C;  2B5M A;  2YNP A;  3OL2 A;  5H17 A;  5B4W A;  5GXH A;  4JSV C;  3ULE C;  5AMS A;  2HXC A;  4FHL A;  1PI6 A;  3I2N A;  4O3T B;  4KFM B;  1B9X A;  2GNQ A;  3FGB A;  1JJU B;  4L9O A;  4QL1 A;  2I3S A;  4JT5 C;  3PVW B;  3SN6 B;  3RSE C;  2HYE A;  5I5I A;  5CXC B;  4FAN D;  4A0A A;  4A08 B;  4X3E A;  4YVD A;  4CI2 A;  4FAV D;  3V5W B;  5IGQ A;  1XIP A;  4L3H D;  3RLM D;  3RFH A;  3W15 A;  4CI3 A;  4PBZ A;  2IUV A;  2PBI B;  4EWR A;  4CI1 A;  2HKR A;  4G56 B;  3UR4 A;  2Z2N A;  3PXS D;  5C2V B;  4A7J A;  3C5M A;  5I5J A;  4UI9 R;  3SHF A;  2MTA H;  4J79 A;  3OL2 B;  3CFS B;  4FA9 D;  4JXM A;  5EM2 B;  5IGO A;  3CIK B;  3F3G A;  5TDH B;  3UKU C;  3ODT A;  3EWE A;  4A2L A;  3AFC A;  3BG1 A;  4HDJ A;  4JSP C;  3DXM C;  2GC4 A;  3JZN A;  2P9P C;  4A0A B;  2OVR B;  5CYK A;  2CE8 A;  3L4M D;  4GGC A;  2IWF A;  3GFC A;  5EAL A;  4BH6 A;  3VA6 A;  4AEZ A;  3E0C A;  3J81 g;  2CN3 A;  5I5M A;  4GQ2 P;  4J82 A;  3SFZ A;  5AJA A;  3A0F A;  5HQG A;  4D0K A;  2TRC B;  2AH1 A;  2H9N A;  4ZOY A;  2H9L A;  5TEF A;  5EML B;  4QT8 A;  1YFQ A;  3JZH A;  3CFV A;  4J87 A;  4A0B A;  3MZL A;  3P4F A;  3I7H A;  3AL8 A;  4MK0 B;  2XU7 A;  3RN0 D;  4K3I D;  3SWS D;  5K19 A;  2CNX A;  4CI8 A;  4CY2 A;  3L4O D;  1N6D A;  1SHY B;  1K8K C;  3DWL C;  4JSN C;  3N0E A;  3K26 A;  3EI3 B;  3I8C A;  3UVM A;  2XL3 A;  3OKW A;  3IIY A;  5FKT A;  4A09 B;  5EAP A;  1VYH C;  5EAM A;  2IUP A;  3KRW B;  3ORV D; 
#chains in the Genus database with same CATH topology
 3PXW D;  3SCY A;  1C9I A;  3F3P A;  3UVK A;  4Y7R A;  4MMY A;  3OKY A;  1NR0 A;  4WK0 A;  4A0B B;  2QXV A;  4JT6 C;  3ZWL B;  4QRJ A;  4IMM A;  4L1M A;  5THA A;  4DNU A;  4A11 A;  4E5Z B;  2HU7 A;  3AL9 A;  2I3T A;  4ES0 A;  3O4G A;  2YMU A;  3DSM A;  2XE4 A;  4RE5 A;  2IUR A;  1OLZ A;  2OK4 A;  3MZK A;  5IJ7 E;  4A2M A;  4DNW A;  3DM0 A;  3IJ1 A;  2XL2 A;  4X63 B;  3UVN A;  1FWX A;  3EI2 A;  2VDR A;  3NIG A;  3EI1 B;  4AMY A;  4CZV A;  3RMZ D;  1U2V C;  1YR2 A;  1JTD B;  2OVQ B;  4PSX B;  5C86 A;  3C75 H;  2H6N A;  5EMJ B;  4LG9 A;  4AN1 A;  2BCJ B;  4DNV A;  2AGX A;  4D9S A;  1R5M A;  2P9I C;  5H14 A;  2CO0 C;  3JPX A;  4O02 A;  1E8M A;  4IA9 A;  3BG0 A;  3JZG A;  2I0S A;  3NVX A;  3VI3 A;  1GP2 B;  3BWS A;  3K27 A;  4XYH A;  4WK2 A;  4ZOV A;  3SVW D;  4U1E I;  5M5V A;  4PBY A;  3NVN A;  4NAA A;  4CY1 A;  2J57 G;  3OW8 A;  5EMM B;  4CY3 A;  5FXY A;  2UZX B;  3MUN A;  4J78 A;  4XYI A;  4FB1 D;  4A11 B;  3SBP A;  3F3F A;  5KDO B;  3V9F A;  2EIE A;  1GOH A;  3RN1 D;  5HE0 B;  4FWW A;  2P9S C;  4L3G D;  5FKQ A;  4ERZ A;  3JRP A;  4MMX A;  2PM6 B;  2VDM A;  1JMZ B;  2AH0 A;  2H13 A;  5EAR A;  3NVQ A;  5E6R A;  4BP8 A;  4K3J B;  4PXW A;  3JAM g;  2QZP A;  5FQD A;  1PGU A;  2H68 A;  4R7A B;  5K1C C;  2OJY A;  5CXB A;  4BCB A;  4J73 A;  3HFQ A;  5HDB A;  1L0Q A;  3FCS A;  1I2M B;  4J0X A;  2H3X A;  4GQB B;  5A2Q g;  5IJ8 E;  4Z7N A;  4N14 A;  2VDP A;  4FA5 D;  2PM9 A;  4NSX A;  3DDU A;  2QC5 A;  2YBA A;  3IJ0 A;  3MKQ A;  5GSA A;  3GRE A;  3IUM A;  1GG2 B;  2XYI A;  5C2W B;  3SXT D;  2H6K A;  1U8C A;  5FFG A;  2H9P A;  2YNO A;  4GM9 A;  1VZ3 A;  4TZ4 A;  2GC7 A;  3IVM A;  2CE9 A;  5HE1 B;  3FM0 A;  4JSX C;  4L1Q D;  3KRX B;  5CYK B;  3MMY A;  1NEX B;  3I89 A;  4QQE A;  2P9U C;  4CZY A;  3OKT A;  4Z8L A;  5M5R A;  2AGY A;  5CXC A;  2J55 H;  4A08 A;  3PVU B;  3N0D A;  5E6S A;  2G99 A;  2HJB A;  5C9Z B;  4FA4 D;  4RE6 A;  1S4U X;  1JV2 A;  2BKL A;  3UVO A;  3EMH A;  4G55 A;  4BUJ C;  4X61 B;  4O9D A;  4AN0 A;  3ZE2 A;  4JHP C;  4O1Q D;  3OTT A;  2Z2O A;  4NBM A;  3KCI A;  2OVP B;  4GMB A;  3MXX A;  4O3U B;  3QHY B;  3SBQ A;  3AL8 B;  1ERJ A;  4J81 A;  2HES X;  4I79 A;  5EMK B;  2XZG A;  4PSW B;  3SMR A;  4PNK B;  2J56 H;  4GM8 A;  1JMX B;  1E5T A;  4OWR A;  1QNI A;  3EI4 A;  5HYN B;  5EM2 A;  3IJE A;  1VE7 A;  3O4H A;  1RI6 A;  2Z2P A;  2B4E A;  5TF2 A;  3C9C A;  3JRO A;  4Z7Q A;  4LGN A;  1B9Y A;  2P9K C;  2Q7Q A;  4J0W A;  4WK4 A;  4J8G A;  3IKO A;  4GGA A;  3IUQ A;  3RRM C;  2IUQ A;  3PSC B;  4WJK A;  5IT9 g;  2EIC A;  1UOQ A;  4J8B A;  2P9N C;  1MG3 A;  2CN2 A;  3T3M A;  2I0R A;  1E8N A;  2OIZ A;  4GGD A;  3IIW A;  5HE3 B;  5FKR A;  2VDN A;  3OKY B;  5M5S A;  3EU7 A;  3SBR A;  2H9M A;  5IC7 A;  1K32 A;  2IWK A;  4CC9 A;  2B5L A;  3PSL A;  3UKR C;  3V7D B;  4D6V A;  1BPO A;  4JD2 C;  3B7F A;  1K3I A;  3EI4 B;  1TBG A;  4ESG A;  1JOF A;  5M5T A;  1N6F A;  3I7P A;  1MG2 A;  2H6Q A;  4XEI C;  3EI2 B;  1PBY B;  3RFG A;  4ERY A;  4X60 B;  4ZN4 A;  1TYQ C;  4GQ1 A;  5GXI A;  1SQ9 A;  3EG6 A;  3FRX A;  4BP9 A;  4FA1 D;  2EID A;  1PEV A;  1MDA H;  1U4C A;  1XKS A;  4GM3 A;  4E54 A;  1QFS A;  3T3P A;  1N6E A;  4PC0 A;  3DXK C;  5H1M A;  2BBK H;  4QAM A;  3VGZ A;  5GMK n;  1P22 A;  5JWZ A;  5FKS A;  3UVL A;  3QI0 A;  1Q47 A;  3EI3 A;  3NIF A;  3PXT D;  2EBS A;  2IAA A;  2O9K A;  3I7L A;  2HJ4 A;  1H2X A;  4ZOZ A;  3U4Y A;  4BL0 A;  3FCU A;  3VH0 A;  4A09 A;  4AOW A;  2OK6 A;  3C99 A;  3K71 A;  2UZY B;  4ZOX A;  5TEE A;  3IJC A;  4UM8 A;  2AGZ A;  4ERQ A;  2H14 A;  5SXM A;  4BCD A;  2VZ1 A;  4J84 A;  2YNN A;  1GXR A;  2XDW A;  4H5I A;  2YB8 B;  3IUN A;  4LG8 A;  5FFO A;  1OMW B;  4H5J A;  4O45 A;  3AH8 B;  2W18 A;  3I7N A;  4OZU A;  5FA5 B;  3ZDX A;  4E5Z A;  2HU8 A;  1GOT B;  2H47 A;  4CY5 A;  3ZE0 A;  4IRZ A;  3SLE D;  2AQ5 A;  3I7O A;  3SJL D;  2QR5 A;  1SQJ A;  1VZ2 A;  2PM7 B;  2AGW A;  3I7K A;  4Y5R D;  5C92 A;  1XHM A;  4J86 A;  2AGL A;  5HE2 B;  1A0R B;  3ZE1 A;  3JB9 L;  1H2W A;  4E54 B;  1UOP A;  4NC4 A;  5CXB B;  3O4J A;  2CO0 A;  4J77 A;  1GOG A;  5AFU 3;  3EI1 A;  2HKM A;  4U7A A;  1UTC A;  4AX4 A;  3J80 g;  4GZ8 A;  2I0T A;  4O2W A;  2B5N A;  3I8E A;  3PE7 A;  1H2Z A;  2PM9 B;  2G9A A;  5FLX g;  3MKS B;  4CZX A;  3NID A;  2P9L C;  1A12 A;  3GD1 I;  2B5M A;  2YNP A;  3OL2 A;  5H17 A;  5B4W A;  5GXH A;  4JSV C;  3ULE C;  3IUL A;  5AMS A;  2HXC A;  2VDQ A;  4FHL A;  1PI6 A;  3I2N A;  4O3T B;  4KFM B;  1B9X A;  2GNQ A;  3FGB A;  3MVD K;  1JJU B;  4L9O A;  2EIB A;  1H2Y A;  4QL1 A;  3V4V A;  2I3S A;  3EQ9 A;  4JT5 C;  3PVW B;  3EQ8 A;  3SN6 B;  3RSE C;  4NEN A;  3V4P A;  5I5I A;  5CXC B;  2HYE A;  1QFM A;  3K72 A;  4FAN D;  4A0A A;  2VC2 A;  4A08 B;  4X3E A;  4YVD A;  4CI2 A;  4FAV D;  3V5W B;  5IGQ A;  1XIP A;  4L3H D;  3RLM D;  3RFH A;  3W15 A;  4CI3 A;  4PBZ A;  2IUV A;  2PBI B;  4EWR A;  4CI1 A;  2HKR A;  4G56 B;  3UR4 A;  3VI4 A;  2Z2N A;  3PXS D;  5C2V B;  4A7J A;  3C5M A;  5I5J A;  4UI9 R;  3SHF A;  5M5U A;  2JKX A;  2MTA H;  5E6U A;  4J79 A;  4BCC A;  1C9L A;  4MMZ A;  2WQ8 A;  3OL2 B;  2VDO A;  3CFS B;  4JHN A;  3EQ7 A;  4FA9 D;  4JXM A;  5EM2 B;  5IGO A;  3OF7 A;  3CIK B;  3F3G A;  5TDH B;  3UKU C;  3ODT A;  1T2X A;  4Z7O A;  5M61 A;  3EWE A;  4A2L A;  3AFC A;  3BG1 A;  4HDJ A;  4JSP C;  3DXM C;  2VDK A;  2GC4 A;  3JZN A;  2P9P C;  4G1M A;  4A0A B;  2VZ3 A;  2OVR B;  1VE6 A;  2HU5 A;  5CYK A;  2CE8 A;  3L4M D;  4GGC A;  3O4I A;  2IWF A;  3GFC A;  3MUO A;  5EAL A;  4BH6 A;  3VA6 A;  4AEZ A;  3E0C A;  3J81 g;  2CN3 A;  1GOF A;  3ZDZ A;  5I5M A;  4GQ2 P;  4J82 A;  3SFZ A;  5AJA A;  3A0F A;  5HQG A;  4D0K A;  2TRC B;  2AH1 A;  2H9N A;  4ZOY A;  2H9L A;  5TEF A;  5EML B;  4QT8 A;  1L5G A;  1YFQ A;  3JZH A;  1UOO A;  3CFV A;  4G1E A;  4J87 A;  4A0B A;  3ZDY A;  3MZL A;  3P4F A;  3I7H A;  1O6F A;  3AL8 A;  4MK0 B;  2XU7 A;  3RN0 D;  1M1X A;  4K3I D;  3SWS D;  5K19 A;  2CNX A;  4CI8 A;  4CY2 A;  3L4O D;  1O6G A;  1N6D A;  1SHY B;  1TYE A;  1K8K C;  3DWL C;  4JSN C;  4AMZ A;  3N0E A;  3K26 A;  3EI3 B;  3I8C A;  3UVM A;  2XL3 A;  3OKW A;  3IIY A;  5FKT A;  2VDL A;  4A09 B;  5EAP A;  3IUJ A;  1VYH C;  5EAM A;  3K6S A;  4UM9 A;  2IUP A;  3GC3 B;  3KRW B;  3IUR A;  3ORV D; 
#chains in the Genus database with same CATH homology
 3PXW D;  3SCY A;  3F3P A;  3UVK A;  4Y7R A;  3OKY A;  1NR0 A;  4A0B B;  2QXV A;  4JT6 C;  3ZWL B;  4QRJ A;  4IMM A;  5THA A;  4A11 A;  4E5Z B;  3AL9 A;  2I3T A;  4ES0 A;  2YMU A;  3DSM A;  2IUR A;  1OLZ A;  2OK4 A;  3MZK A;  5IJ7 E;  4A2M A;  3DM0 A;  3IJ1 A;  2XL2 A;  4X63 B;  3UVN A;  1FWX A;  3EI2 A;  3EI1 B;  4CZV A;  3RMZ D;  1U2V C;  2OVQ B;  4PSX B;  3C75 H;  2H6N A;  5EMJ B;  4LG9 A;  2BCJ B;  2AGX A;  1R5M A;  2P9I C;  5H14 A;  2CO0 C;  3JPX A;  4IA9 A;  3BG0 A;  3JZG A;  2I0S A;  3NVX A;  1GP2 B;  3BWS A;  3K27 A;  4XYH A;  4ZOV A;  3SVW D;  4U1E I;  4PBY A;  3NVN A;  4CY1 A;  2J57 G;  3OW8 A;  5EMM B;  4CY3 A;  5FXY A;  2UZX B;  4J78 A;  4XYI A;  4FB1 D;  4A11 B;  3SBP A;  3F3F A;  5KDO B;  3V9F A;  3RN1 D;  5HE0 B;  4FWW A;  2P9S C;  4L3G D;  5FKQ A;  4ERZ A;  3JRP A;  2PM6 B;  1JMZ B;  2AH0 A;  2H13 A;  5EAR A;  3NVQ A;  4K3J B;  4PXW A;  3JAM g;  5FQD A;  1PGU A;  2H68 A;  4R7A B;  5K1C C;  2OJY A;  5CXB A;  4J73 A;  3HFQ A;  1L0Q A;  5A2Q g;  4J0X A;  2H3X A;  4GQB B;  5IJ8 E;  4N14 A;  4FA5 D;  2PM9 A;  4NSX A;  2QC5 A;  2YBA A;  3IJ0 A;  3MKQ A;  5GSA A;  3GRE A;  1GG2 B;  2XYI A;  5C2W B;  3SXT D;  2H6K A;  2H9P A;  2YNO A;  4GM9 A;  4TZ4 A;  2GC7 A;  2CE9 A;  5HE1 B;  3FM0 A;  4JSX C;  4L1Q D;  3KRX B;  5CYK B;  3MMY A;  1NEX B;  3I89 A;  4QQE A;  2P9U C;  4CZY A;  3OKT A;  4Z8L A;  2AGY A;  5CXC A;  2J55 H;  4A08 A;  3PVU B;  3N0D A;  2G99 A;  2HJB A;  5C9Z B;  4FA4 D;  1S4U X;  3UVO A;  3EMH A;  4BUJ C;  4X61 B;  4O9D A;  4O1Q D;  3OTT A;  2Z2O A;  2OVP B;  4GMB A;  3MXX A;  4O3U B;  3SBQ A;  3AL8 B;  1ERJ A;  4J81 A;  2HES X;  4I79 A;  5EMK B;  4PSW B;  3SMR A;  4PNK B;  2J56 H;  4GM8 A;  1JMX B;  4OWR A;  1QNI A;  3EI4 A;  5HYN B;  5EM2 A;  1RI6 A;  2Z2P A;  2B4E A;  5TF2 A;  3C9C A;  3JRO A;  4LGN A;  1B9Y A;  2P9K C;  2Q7Q A;  4J0W A;  4J8G A;  3IKO A;  4GGA A;  3RRM C;  2IUQ A;  3PSC B;  5IT9 g;  4J8B A;  2P9N C;  1MG3 A;  2CN2 A;  2I0R A;  2OIZ A;  4GGD A;  3IIW A;  5HE3 B;  5FKR A;  3OKY B;  3EU7 A;  3SBR A;  2H9M A;  5IC7 A;  1K32 A;  2IWK A;  4CC9 A;  2B5L A;  3PSL A;  3UKR C;  3V7D B;  4D6V A;  4JD2 C;  3B7F A;  3EI4 B;  1TBG A;  4ESG A;  1JOF A;  1N6F A;  3I7P A;  1MG2 A;  2H6Q A;  4XEI C;  3EI2 B;  1PBY B;  3RFG A;  4ERY A;  4X60 B;  4ZN4 A;  1TYQ C;  4GQ1 A;  5GXI A;  1SQ9 A;  3EG6 A;  3FRX A;  4FA1 D;  1PEV A;  1MDA H;  1U4C A;  1XKS A;  4GM3 A;  4E54 A;  1N6E A;  4PC0 A;  3DXK C;  5H1M A;  2BBK H;  3VGZ A;  5GMK n;  1P22 A;  5JWZ A;  5FKS A;  3UVL A;  1Q47 A;  3EI3 A;  3PXT D;  2EBS A;  2IAA A;  2O9K A;  3I7L A;  2HJ4 A;  4ZOZ A;  3U4Y A;  4BL0 A;  3VH0 A;  4A09 A;  4AOW A;  2OK6 A;  3C99 A;  2UZY B;  4ZOX A;  5TEE A;  3IJC A;  2AGZ A;  4ERQ A;  2H14 A;  5SXM A;  4J84 A;  2YNN A;  1GXR A;  4H5I A;  2YB8 B;  4LG8 A;  1OMW B;  4H5J A;  4O45 A;  3AH8 B;  4OZU A;  2W18 A;  3I7N A;  5FA5 B;  4E5Z A;  1GOT B;  2H47 A;  4CY5 A;  3SLE D;  2AQ5 A;  3I7O A;  3SJL D;  1SQJ A;  2PM7 B;  2AGW A;  3I7K A;  4Y5R D;  1XHM A;  4J86 A;  2AGL A;  5HE2 B;  1A0R B;  3JB9 L;  4E54 B;  5CXB B;  4J77 A;  2CO0 A;  5AFU 3;  3EI1 A;  2HKM A;  4U7A A;  3J80 g;  4GZ8 A;  2I0T A;  2B5N A;  3I8E A;  3PE7 A;  2PM9 B;  2G9A A;  5FLX g;  3MKS B;  4CZX A;  2P9L C;  2B5M A;  2YNP A;  3OL2 A;  5H17 A;  5B4W A;  5GXH A;  4JSV C;  3ULE C;  5AMS A;  2HXC A;  4FHL A;  1PI6 A;  3I2N A;  4O3T B;  4KFM B;  1B9X A;  2GNQ A;  3FGB A;  1JJU B;  4L9O A;  4QL1 A;  2I3S A;  4JT5 C;  3PVW B;  3SN6 B;  3RSE C;  2HYE A;  5I5I A;  5CXC B;  4FAN D;  4A0A A;  4A08 B;  4X3E A;  4YVD A;  4CI2 A;  4FAV D;  3V5W B;  5IGQ A;  1XIP A;  4L3H D;  3RLM D;  3RFH A;  3W15 A;  4CI3 A;  4PBZ A;  2IUV A;  2PBI B;  4EWR A;  4CI1 A;  2HKR A;  4G56 B;  3UR4 A;  2Z2N A;  3PXS D;  5C2V B;  4A7J A;  3C5M A;  5I5J A;  4UI9 R;  3SHF A;  2MTA H;  4J79 A;  3OL2 B;  3CFS B;  4FA9 D;  4JXM A;  5EM2 B;  5IGO A;  3CIK B;  3F3G A;  5TDH B;  3UKU C;  3ODT A;  3EWE A;  4A2L A;  3AFC A;  3BG1 A;  4HDJ A;  4JSP C;  3DXM C;  2GC4 A;  3JZN A;  2P9P C;  4A0A B;  2OVR B;  5CYK A;  2CE8 A;  3L4M D;  4GGC A;  2IWF A;  3GFC A;  5EAL A;  4BH6 A;  3VA6 A;  4AEZ A;  3E0C A;  3J81 g;  2CN3 A;  5I5M A;  4GQ2 P;  4J82 A;  3SFZ A;  5AJA A;  3A0F A;  5HQG A;  4D0K A;  2TRC B;  2AH1 A;  2H9N A;  4ZOY A;  2H9L A;  5TEF A;  5EML B;  4QT8 A;  1YFQ A;  3JZH A;  3CFV A;  4J87 A;  4A0B A;  3MZL A;  3P4F A;  3I7H A;  3AL8 A;  4MK0 B;  2XU7 A;  3RN0 D;  4K3I D;  3SWS D;  5K19 A;  2CNX A;  4CI8 A;  4CY2 A;  3L4O D;  1N6D A;  1SHY B;  1K8K C;  3DWL C;  4JSN C;  3N0E A;  3K26 A;  3EI3 B;  3I8C A;  3UVM A;  2XL3 A;  3OKW A;  3IIY A;  5FKT A;  4A09 B;  5EAP A;  1VYH C;  5EAM A;  2IUP A;  3KRW B;  3ORV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...