5M5RA

Clathrin heavy chain n-terminal domain bound to beta2 adaptin clathrin box motif
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
molecule keywords Clathrin heavy chain 1
molecule tags Endocytosis
source organism Bos taurus
total genus 85
structure length 360
sequence length 360
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5rA00
5M61A 5M5RA 1C9LA 2XZGA 3GC3B 5M5TA 4G55A 1C9IA 5M5UA 5M5SA 1UTCA 5M5VA 1BPOA 3GD1I
chains in the Genus database with same CATH superfamily
5M5UA 2AGLA 5THAA 4BH6A 5GXIA 2H9LA 3PSCB 3DXMC 1OMWB 2HESX 2BBKH 4O3UB 2OK6A 2I0RA 4PC0A 2OJYA 3GC3B 3U4YA 3SWSD 5TDHB 2XYIA 2XL2A 1JMXB 2I0SA 2O9KA 1JJUB 1B9YA 3V4PA 3MVDK 5TEEA 1PGUA 4BL0A 2HKRA 4ERZA 2P9UC 5CXCB 4J84A 1QFSA 4PNKB 3IULA 4HDJA 2H6NA 4GZ8A 5FKTA 5HE3B 3I7HA 4FAND 4L3GD 5AJAA 2JKXA 4ZOXA 2HU8A 5C2VB 4J87A 3PVUB 3I7OA 3JROA 5C9ZB 4WK2A 3OF7A 4ZOYA 2H9NA 2J55H 3I8EA 1UOPA 3UVNA 2OK4A 2AQ5A 2CO0A 3DXKC 4G55A 4G1EA 3AL8A 4WK4A 5TEFA 4OZUA 4E5ZB 5EMMB 2H68A 2W18A 4U7AA 3GFCA 5CYKB 3K26A 1H2ZA 4OWRA 4ZOZA 3ORVD 4A11B 4FB1D 3RN1D 5H17A 4J0XA 2VDOA 4GQBB 5HE2B 3B7FA 3SLED 3OL2A 2YNOA 4IMMA 4MK0B 5EM2A 5FFOA 3UKUC 2EBSA 2P9LC 2J57G 5M61A 3V9FA 2VDLA 4IRZA 3NIFA 5TF2A 1U8CA 2Z2PA 3IUNA 4JD2C 1E8MA 3V4VA 5K1CC 2UZYB 3EWEA 4GM9A 2P9KC 2XL3A 4CC9A 3EMHA 3OKTA 5GXHA 2OIZA 3PXWD 5EARA 2VDPA 3O4JA 2GNQA 4A09B 3ZDZA 3VA6A 1E8NA 3RSEC 2J56H 3ZE2A 4BP8A 1OLZA 4AMZA 2IUPA 1K3IA 4CI1A 4K3ID 3UVLA 3ZWLB 2I3SA 2G9AA 3J81g 4O9DA 1JMZB 1TBGA 2IUVA 3IIYA 4JSNC 2QC5A 4CY5A 4L9OA 4YVDA 3OKYB 3K27A 2BCJB 5H1MA 3FCUA 3ULEC 3F3FA 1A12A 3BG0A 2AGXA 4A08B 1K32A 4NC4A 3IURA 2PM9B 4J78A 4MMZA 3IVMA 2PBIB 4DNUA 4G56B 1JTDB 2B4EA 3EI4A 4PXWA 3RFGA 4FA5D 3VH0A 2EICA 2B5MA 1MG3A 1XIPA 5M5VA 4X61B 1R5MA 5FFGA 4K3JB 5E6RA 4QAMA 5CXBA 2TRCB 2HJ4A 3UR4A 3UKRC 4O1QD 5K19A 4PSWB 3ZDXA 2H6KA 4L3HD 4JT6C 1C9LA 1E5TA 1C9IA 3VGZA 1RI6A 2AGZA 4Y7RA 4BCCA 2CNXA 4O2WA 4GM3A 4RE5A 2WQ8A 3FM0A 4XYHA 3T3PA 2HKMA 3V5WB 5FKSA 3JZGA 3J80g 4A0AA 4AN1A 3UVOA 3SMRA 3T3MA 2VDMA 3N0DA 4TZ4A 3PXSD 4JSPC 1QNIA 3GREA 3GD1I 5IGOA 1H2WA 3AH8B 3RRMC 4AEZA 2YB8B 5E6SA 4GGCA 5C92A 4Z8LA 3MKQA 1L0QA 3L4OD 4O3TB 2P9NC 4FA1D 4JHPC 3CIKB 2AH0A 4ERYA 4UM8A 2XZGA 4A0BB 2YBAA 3EI1B 1VZ2A 3SCYA 2CN3A 1VE6A 4J77A 3O4IA 3SBPA 4X3EA 2XDWA 5FA5B 2EIEA 4E54A 4GGAA 3EI3B 4FHLA 4UI9R 3I7NA 4NAAA 3SBRA 5B4WA 2P9IC 5E6UA 3I89A 5HE0B 1FWXA 4BUJC 4J8BA 1JOFA 5I5IA 2MTAH 3JPXA 4D9SA 4ZN4A 3JZHA 1TYQC 1PEVA 3EI2B 3NIGA 5HDBA 4CZXA 5GSAA 3I8CA 3BG1A 3QI0A 3C75H 2Q7QA 3SFZA 4J79A 4A2MA 4ESGA 1QFMA 5IJ8E 3I2NA 3DDUA 4CY1A 2HXCA 1GP2B 2VC2A 5EMLB 3AL9A 1Q47A 4EWRA 3ZE0A 5KDOB 3RMZD 3EQ7A 1U2VC 5H14A 2B5NA 2GC4A 4RE6A 4J73A 4O45A 2QZPA 3ZE1A 3OTTA 3IJ1A 3MZKA 3IKOA 4AX4A 1BPOA 4GQ2P 4ZOVA 1P22A 4X63B 1GOFA 4WJKA 4FA4D 5IC7A 2HU5A 4NSXA 4DNWA 2CE8A 2VDNA 3AL8B 4LG9A 3PE7A 1VZ3A 1SHYB 4J82A 3F3PA 5EAMA 1MG2A 1B9XA 4ES0A 2EIBA 2H13A 1I2MB 2PM7B 5EAPA 4Z7QA 3EG6A 1VYHC 3CFVA 1L5GA 4JSVC 4GGDA 3SHFA 4JT5C 2OVRB 3ZDYA 5JWZA 3DM0A 3IUMA 4JSXC 2VZ3A 1UOQA 3OL2B 5A2Qg 5CXCA 2G99A 1SQJA 5M5SA 2YMUA 3RN0D 5EM2B 4GM8A 2AGYA 4DNVA 2HYEA 5FKRA 2Z2NA 4MMXA 4Z7NA 3JAMg 1S4UX 2XU7A 4J0WA 3O4GA 3KRWB 4CZYA 4R7AB 2H9MA 4QRJA 2QR5A 4CZVA 3NVNA 3EI1A 5IJ7E 2QXVA 1GOTB 2VDQA 2Z2OA 5FLXg 1GOHA 4L1MA 5IGQA 1YR2A 1ERJA 1GOGA 3JZNA 4H5JA 3VI4A 3OKWA 4BCBA 3MKSB 5HE1B 3PVWB 4H5IA 4PBZA 4E5ZA 5HYNB 1H2XA 1O6GA 4JHNA 2UZXB 3K71A 5I5JA 5EMKB 5CYKA 3EQ8A 4AN0A 2B5LA 4A11A 3K6SA 2I0TA 2IAAA 3EI2A 3P4FA 3MUOA 2IURA 4AMYA 5FKQA 1XKSA 1TYEA 4CI3A 3IJCA 3IUQA 4CY2A 4X60B 3EI4B 3NIDA 5FQDA 5HQGA 4CI8A 2CO0C 4AOWA 4KFMB 5M5RA 2IWFA 3MZLA 2BKLA 4A2LA 3C5MA 4Z7OA 3SVWD 2P9SC 3I7PA 4QL1A 2HJBA 3ODTA 5CXBB 4QQEA 3UVKA 4Y5RD 5GMKn 4MMYA 2H9PA 2VDKA 2P9PC 4N14A 5EMJB 1GXRA 1U4CA 1N6EA 2CE9A 3FRXA 1XHMA 1T2XA 4A09A 2I3TA 2CN2A 4J81A 3SN6B 3CFSB 4A7JA 2H14A 4A0AB 3FCSA 3O4HA 4WK0A 2HU7A 3I7KA 5FXYA 2GC7A 1SQ9A 3NVQA 3IIWA 3OKYA 4G1MA 5C86A 3NVXA 3N0EA 2H6QA 1M1XA 1VE7A 5IT9g 4A08A 3AFCA 2OVQB 3IJ0A 2XE4A 2PM9A 2AH1A 1N6FA 3EQ9A 4LGNA 4BP9A 4GQ1A 3IJEA 4FWWA 3E0CA 3PSLA 4FAVD 3K72A 4UM9A 5SXMA 4XEIC 2AGWA 4JXMA 2VDRA 4I79A 3SXTD 2OVPB 1UTCA 2VZ1A 3KRXB 2PM6B 2YNNA 5I5MA 2EIDA 4L1QD 5EALA 1GG2B 3V7DB 5AFU3 4E54B 2IUQA 3OW8A 1A0RB 1MDAH 2YNPA 4U1EI 3JB9L 4ERQA 1O6FA 1NEXB 3C99A 1UOOA 4XYIA 3UVMA 1K8KC 3HFQA 3MXXA 3EU7A 3FGBA 3IUJA 3F3GA 3RFHA 4FA9D 5M5TA 3VI3A 3SBQA 3PXTD 3L4MD 1JV2A 4J8GA 1NR0A 3DSMA 4NBMA 3QHYB 4GMBA 4IA9A 2H3XA 3RLMD 1PI6A 1H2YA 4NENA 3MMYA 4D0KA 4O02A 3I7LA 3W15A 4PBYA 1PBYB 3MUNA 3BWSA 3C9CA 5AMSA 4A0BA 3DWLC 4D6VA 3SJLD 4J86A 1N6DA 3EI3A 1YFQA 5C2WB 4PSXB 4CY3A 4LG8A 4QT8A 2H47A 2IWKA 4BCDA 3JRPA 3A0FA 4CI2A 3KCIA
chains in the Genus database with same CATH topology
5M61A 5M5RA 1C9LA 2XZGA 3GC3B 5M5TA 4G55A 1C9IA 5M5UA 5M5SA 1UTCA 5M5VA 1BPOA 3GD1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M61 A;  5M5R A;  1C9L A;  2XZG A;  3GC3 B;  5M5T A;  4G55 A;  1C9I A;  5M5U A;  5M5S A;  1UTC A;  5M5V A;  1BPO A;  3GD1 I; 
#chains in the Genus database with same CATH topology
 5M5U A;  2AGL A;  5THA A;  4BH6 A;  5GXI A;  2H9L A;  3PSC B;  3DXM C;  1OMW B;  2HES X;  2BBK H;  4O3U B;  2OK6 A;  2I0R A;  4PC0 A;  2OJY A;  3GC3 B;  3U4Y A;  3SWS D;  5TDH B;  2XYI A;  2XL2 A;  1JMX B;  2I0S A;  2O9K A;  1JJU B;  1B9Y A;  3V4P A;  3MVD K;  5TEE A;  1PGU A;  4BL0 A;  2HKR A;  4ERZ A;  2P9U C;  5CXC B;  4J84 A;  1QFS A;  4PNK B;  3IUL A;  4HDJ A;  2H6N A;  4GZ8 A;  5FKT A;  5HE3 B;  3I7H A;  4FAN D;  4L3G D;  5AJA A;  2JKX A;  4ZOX A;  2HU8 A;  5C2V B;  4J87 A;  3PVU B;  3I7O A;  3JRO A;  5C9Z B;  4WK2 A;  3OF7 A;  4ZOY A;  2H9N A;  2J55 H;  3I8E A;  1UOP A;  3UVN A;  2OK4 A;  2AQ5 A;  2CO0 A;  3DXK C;  4G55 A;  4G1E A;  3AL8 A;  4WK4 A;  5TEF A;  4OZU A;  4E5Z B;  5EMM B;  2H68 A;  2W18 A;  4U7A A;  3GFC A;  5CYK B;  3K26 A;  1H2Z A;  4OWR A;  4ZOZ A;  3ORV D;  4A11 B;  4FB1 D;  3RN1 D;  5H17 A;  4J0X A;  2VDO A;  4GQB B;  5HE2 B;  3B7F A;  3SLE D;  3OL2 A;  2YNO A;  4IMM A;  4MK0 B;  5EM2 A;  5FFO A;  3UKU C;  2EBS A;  2P9L C;  2J57 G;  5M61 A;  3V9F A;  2VDL A;  4IRZ A;  3NIF A;  5TF2 A;  1U8C A;  2Z2P A;  3IUN A;  4JD2 C;  1E8M A;  3V4V A;  5K1C C;  2UZY B;  3EWE A;  4GM9 A;  2P9K C;  2XL3 A;  4CC9 A;  3EMH A;  3OKT A;  5GXH A;  2OIZ A;  3PXW D;  5EAR A;  2VDP A;  3O4J A;  2GNQ A;  4A09 B;  3ZDZ A;  3VA6 A;  1E8N A;  3RSE C;  2J56 H;  3ZE2 A;  4BP8 A;  1OLZ A;  4AMZ A;  2IUP A;  1K3I A;  4CI1 A;  4K3I D;  3UVL A;  3ZWL B;  2I3S A;  2G9A A;  3J81 g;  4O9D A;  1JMZ B;  1TBG A;  2IUV A;  3IIY A;  4JSN C;  2QC5 A;  4CY5 A;  4L9O A;  4YVD A;  3OKY B;  3K27 A;  2BCJ B;  5H1M A;  3FCU A;  3ULE C;  3F3F A;  1A12 A;  3BG0 A;  2AGX A;  4A08 B;  1K32 A;  4NC4 A;  3IUR A;  2PM9 B;  4J78 A;  4MMZ A;  3IVM A;  2PBI B;  4DNU A;  4G56 B;  1JTD B;  2B4E A;  3EI4 A;  4PXW A;  3RFG A;  4FA5 D;  3VH0 A;  2EIC A;  2B5M A;  1MG3 A;  1XIP A;  5M5V A;  4X61 B;  1R5M A;  5FFG A;  4K3J B;  5E6R A;  4QAM A;  5CXB A;  2TRC B;  2HJ4 A;  3UR4 A;  3UKR C;  4O1Q D;  5K19 A;  4PSW B;  3ZDX A;  2H6K A;  4L3H D;  4JT6 C;  1C9L A;  1E5T A;  1C9I A;  3VGZ A;  1RI6 A;  2AGZ A;  4Y7R A;  4BCC A;  2CNX A;  4O2W A;  4GM3 A;  4RE5 A;  2WQ8 A;  3FM0 A;  4XYH A;  3T3P A;  2HKM A;  3V5W B;  5FKS A;  3JZG A;  3J80 g;  4A0A A;  4AN1 A;  3UVO A;  3SMR A;  3T3M A;  2VDM A;  3N0D A;  4TZ4 A;  3PXS D;  4JSP C;  1QNI A;  3GRE A;  3GD1 I;  5IGO A;  1H2W A;  3AH8 B;  3RRM C;  4AEZ A;  2YB8 B;  5E6S A;  4GGC A;  5C92 A;  4Z8L A;  3MKQ A;  1L0Q A;  3L4O D;  4O3T B;  2P9N C;  4FA1 D;  4JHP C;  3CIK B;  2AH0 A;  4ERY A;  4UM8 A;  2XZG A;  4A0B B;  2YBA A;  3EI1 B;  1VZ2 A;  3SCY A;  2CN3 A;  1VE6 A;  4J77 A;  3O4I A;  3SBP A;  4X3E A;  2XDW A;  5FA5 B;  2EIE A;  4E54 A;  4GGA A;  3EI3 B;  4FHL A;  4UI9 R;  3I7N A;  4NAA A;  3SBR A;  5B4W A;  2P9I C;  5E6U A;  3I89 A;  5HE0 B;  1FWX A;  4BUJ C;  4J8B A;  1JOF A;  5I5I A;  2MTA H;  3JPX A;  4D9S A;  4ZN4 A;  3JZH A;  1TYQ C;  1PEV A;  3EI2 B;  3NIG A;  5HDB A;  4CZX A;  5GSA A;  3I8C A;  3BG1 A;  3QI0 A;  3C75 H;  2Q7Q A;  3SFZ A;  4J79 A;  4A2M A;  4ESG A;  1QFM A;  5IJ8 E;  3I2N A;  3DDU A;  4CY1 A;  2HXC A;  1GP2 B;  2VC2 A;  5EML B;  3AL9 A;  1Q47 A;  4EWR A;  3ZE0 A;  5KDO B;  3RMZ D;  3EQ7 A;  1U2V C;  5H14 A;  2B5N A;  2GC4 A;  4RE6 A;  4J73 A;  4O45 A;  2QZP A;  3ZE1 A;  3OTT A;  3IJ1 A;  3MZK A;  3IKO A;  4AX4 A;  1BPO A;  4GQ2 P;  4ZOV A;  1P22 A;  4X63 B;  1GOF A;  4WJK A;  4FA4 D;  5IC7 A;  2HU5 A;  4NSX A;  4DNW A;  2CE8 A;  2VDN A;  3AL8 B;  4LG9 A;  3PE7 A;  1VZ3 A;  1SHY B;  4J82 A;  3F3P A;  5EAM A;  1MG2 A;  1B9X A;  4ES0 A;  2EIB A;  2H13 A;  1I2M B;  2PM7 B;  5EAP A;  4Z7Q A;  3EG6 A;  1VYH C;  3CFV A;  1L5G A;  4JSV C;  4GGD A;  3SHF A;  4JT5 C;  2OVR B;  3ZDY A;  5JWZ A;  3DM0 A;  3IUM A;  4JSX C;  2VZ3 A;  1UOQ A;  3OL2 B;  5A2Q g;  5CXC A;  2G99 A;  1SQJ A;  5M5S A;  2YMU A;  3RN0 D;  5EM2 B;  4GM8 A;  2AGY A;  4DNV A;  2HYE A;  5FKR A;  2Z2N A;  4MMX A;  4Z7N A;  3JAM g;  1S4U X;  2XU7 A;  4J0W A;  3O4G A;  3KRW B;  4CZY A;  4R7A B;  2H9M A;  4QRJ A;  2QR5 A;  4CZV A;  3NVN A;  3EI1 A;  5IJ7 E;  2QXV A;  1GOT B;  2VDQ A;  2Z2O A;  5FLX g;  1GOH A;  4L1M A;  5IGQ A;  1YR2 A;  1ERJ A;  1GOG A;  3JZN A;  4H5J A;  3VI4 A;  3OKW A;  4BCB A;  3MKS B;  5HE1 B;  3PVW B;  4H5I A;  4PBZ A;  4E5Z A;  5HYN B;  1H2X A;  1O6G A;  4JHN A;  2UZX B;  3K71 A;  5I5J A;  5EMK B;  5CYK A;  3EQ8 A;  4AN0 A;  2B5L A;  4A11 A;  3K6S A;  2I0T A;  2IAA A;  3EI2 A;  3P4F A;  3MUO A;  2IUR A;  4AMY A;  5FKQ A;  1XKS A;  1TYE A;  4CI3 A;  3IJC A;  3IUQ A;  4CY2 A;  4X60 B;  3EI4 B;  3NID A;  5FQD A;  5HQG A;  4CI8 A;  2CO0 C;  4AOW A;  4KFM B;  5M5R A;  2IWF A;  3MZL A;  2BKL A;  4A2L A;  3C5M A;  4Z7O A;  3SVW D;  2P9S C;  3I7P A;  4QL1 A;  2HJB A;  3ODT A;  5CXB B;  4QQE A;  3UVK A;  4Y5R D;  5GMK n;  4MMY A;  2H9P A;  2VDK A;  2P9P C;  4N14 A;  5EMJ B;  1GXR A;  1U4C A;  1N6E A;  2CE9 A;  3FRX A;  1XHM A;  1T2X A;  4A09 A;  2I3T A;  2CN2 A;  4J81 A;  3SN6 B;  3CFS B;  4A7J A;  2H14 A;  4A0A B;  3FCS A;  3O4H A;  4WK0 A;  2HU7 A;  3I7K A;  5FXY A;  2GC7 A;  1SQ9 A;  3NVQ A;  3IIW A;  3OKY A;  4G1M A;  5C86 A;  3NVX A;  3N0E A;  2H6Q A;  1M1X A;  1VE7 A;  5IT9 g;  4A08 A;  3AFC A;  2OVQ B;  3IJ0 A;  2XE4 A;  2PM9 A;  2AH1 A;  1N6F A;  3EQ9 A;  4LGN A;  4BP9 A;  4GQ1 A;  3IJE A;  4FWW A;  3E0C A;  3PSL A;  4FAV D;  3K72 A;  4UM9 A;  5SXM A;  4XEI C;  2AGW A;  4JXM A;  2VDR A;  4I79 A;  3SXT D;  2OVP B;  1UTC A;  2VZ1 A;  3KRX B;  2PM6 B;  2YNN A;  5I5M A;  2EID A;  4L1Q D;  5EAL A;  1GG2 B;  3V7D B;  5AFU 3;  4E54 B;  2IUQ A;  3OW8 A;  1A0R B;  1MDA H;  2YNP A;  4U1E I;  3JB9 L;  4ERQ A;  1O6F A;  1NEX B;  3C99 A;  1UOO A;  4XYI A;  3UVM A;  1K8K C;  3HFQ A;  3MXX A;  3EU7 A;  3FGB A;  3IUJ A;  3F3G A;  3RFH A;  4FA9 D;  5M5T A;  3VI3 A;  3SBQ A;  3PXT D;  3L4M D;  1JV2 A;  4J8G A;  1NR0 A;  3DSM A;  4NBM A;  3QHY B;  4GMB A;  4IA9 A;  2H3X A;  3RLM D;  1PI6 A;  1H2Y A;  4NEN A;  3MMY A;  4D0K A;  4O02 A;  3I7L A;  3W15 A;  4PBY A;  1PBY B;  3MUN A;  3BWS A;  3C9C A;  5AMS A;  4A0B A;  3DWL C;  4D6V A;  3SJL D;  4J86 A;  1N6D A;  3EI3 A;  1YFQ A;  5C2W B;  4PSX B;  4CY3 A;  4LG8 A;  4QT8 A;  2H47 A;  2IWK A;  4BCD A;  3JRP A;  3A0F A;  4CI2 A;  3KCI A; 
#chains in the Genus database with same CATH homology
 5M61 A;  5M5R A;  1C9L A;  2XZG A;  3GC3 B;  5M5T A;  4G55 A;  1C9I A;  5M5U A;  5M5S A;  1UTC A;  5M5V A;  1BPO A;  3GD1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...