5EMLB

Crystal structure of prmt5:mep50 with compound 10 and sam
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
LPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5emlB00
4AEZA 4JSXC 4GM8A 4CZYA 2H6QA 4CY5A 4ZOXA 4QL1A 3SN6B 5HYNB 5EAPA 2AH0A 3OL2A 3MXXA 3RRMC 5JWZA 1K8KC 4XEIC 4GGDA 2I3TA 2P9UC 4OWRA 4L1QD 2J55H 3PSCB 5FKTA 2H14A 5AFU3 4X60B 4A0BB 5IJ8E 3OKYA 4XYIA 2UZXB 4PBYA 2HESX 2IWFA 3ORVD 4AOWA 3P4FA 2OVRB 5AJAA 3ZWLB 4O3TB 2J56H 4OZUA 3EI2B 4G56B 3F3PA 3MZLA 4A0BA 4CZXA 2H9MA 5CXCA 2IUPA 4CY1A 3C99A 1JOFA 4ZOYA 1PGUA 3I8CA 2HKMA 4Y7RA 5CYKB 4A09A 3KRWB 4E5ZB 5EAMA 5FKQA 4YVDA 3B7FA 1NR0A 3JZHA 2IURA 4BH6A 1NEXB 5THAA 2I3SA 4ZOVA 2EBSA 4KFMB 3AL8A 1XIPA 4A2LA 4E5ZA 3K27A 3UKRC 4A7JA 1MG3A 3I7KA 3RFHA 3OTTA 4GQ2P 3HFQA 4IA9A 1SQ9A 3GREA 3BG0A 3ULEC 5FKSA 4FHLA 4CI1A 2H6KA 2P9NC 4JD2C 2I0TA 4QRJA 3RLMD 1U2VC 3EMHA 4BUJC 4J86A 1S4UX 4CY3A 3RFGA 4GMBA 3SVWD 2Z2NA 4ZOZA 3IIYA 5HE1B 3N0DA 5TDHB 4O45A 3NVNA 5EMJB 3JROA 4O3UB 2MTAH 4U7AA 2P9KC 3I7PA 2CN2A 4Z8LA 1JJUB 1Q47A 2H6NA 3FM0A 2AGXA 3AFCA 3OKWA 4A11B 3I7OA 1U4CA 4PSWB 2H13A 5A2Qg 4IMMA 4H5IA 3AL9A 5IJ7E 5TF2A 1RI6A 3VGZA 5HE3B 2P9SC 4O1QD 2HJBA 2OK6A 2B5LA 4EWRA 4JXMA 2PM6B 5IGQA 5EMKB 3A0FA 3F3FA 2AQ5A 5TEFA 3V7DB 4U1EI 2CO0C 2BCJB 2W18A 3SWSD 3JZGA 3IKOA 2H9PA 5EMMB 3VH0A 4X61B 2IAAA 1PBYB 2QXVA 4UI9R 4L3GD 5K19A 4R7AB 2PBIB 4J87A 1SHYB 2G99A 2PM9B 3C5MA 5IC7A 4CZVA 2O9KA 5EALA 1N6FA 2OK4A 1PEVA 4JSNC 4J79A 1R5MA 5FQDA 2BBKH 4E54B 1YFQA 3SLED 3BG1A 3JZNA 1VYHC 4N14A 3CFVA 1TYQC 2YB8B 2HKRA 3MKSB 3J80g 4TZ4A 1GXRA 5IGOA 3EI2A 5FKRA 4L9OA 3RN0D 2AGLA 5GSAA 2XYIA 3I2NA 5HE0B 2IUVA 1JMZB 5GXIA 1SQJA 3OW8A 3SBPA 5CYKA 2Z2OA 1N6EA 2I0SA 3SBQA 4H5JA 2YNNA 1K32A 2OJYA 3UVKA 4A2MA 2HYEA 3PXSD 4HDJA 2HJ4A 3I7NA 3SFZA 1FWXA 5GXHA 3PXWD 2CO0A 4A08B 4FA1D 3EI3B 3SXTD 1L0QA 2GC4A 4FB1D 2B5MA 3RSEC 3FRXA 1OMWB 4PSXB 2AH1A 2Z2PA 5EARA 3PSLA 3IJ1A 4D6VA 4ZN4A 4BL0A 3FGBA 4ES0A 3C75H 4CI2A 2YBAA 2OVQB 4J0WA 1A0RB 5EM2B 3UVOA 4JSVC 3C9CA 3DSMA 3UKUC 1MDAH 3PE7A 4FAVD 4ERQA 3EI4B 3CFSB 3MKQA 3GFCA 5B4WA 3RMZD 1JMXB 4GZ8A 5HQGA 2CE9A 3IJCA 1TBGA 2H9NA 3W15A 1N6DA 4GGCA 2CN3A 4ERZA 4Y5RD 1GP2B 2CNXA 3NVQA 3SJLD 4FA9D 3EI1B 4A0AB 3JAMg 4A11A 1OLZA 2P9PC 1B9YA 2J57G 3PVWB 3SBRA 3EWEA 3RN1D 3KRXB 3EI1A 4CI3A 4A0AA 5KDOB 2I0RA 2YNPA 3NVXA 4GM3A 2G9AA 4GQBB 5FXYA 3SHFA 1PI6A 3I7HA 1GG2B 4J78A 2B4EA 4LG8A 2Q7QA 4LG9A 3JRPA 3OL2B 3EU7A 4J73A 5C9ZB 5C2WB 2B5NA 3MZKA 4J8BA 2IWKA 4I79A 4J0XA 3DWLC 5EMLB 4GM9A 2AGZA 4FAND 2PM9A 1B9XA 4K3ID 2XL3A 2GC7A 3OKYB 3L4OD 3VA6A 2P9LC 5HE2B 3I89A 3UR4A 2XU7A 2AGWA 4LGNA 3AH8B 5SXMA 3UVLA 4E54A 1XKSA 4QQEA 3DM0A 5CXCB 2YMUA 3OKTA 5IT9g 5I5IA 4JT6C 3PVUB 3CIKB 3UVMA 3U4YA 3BWSA 2GNQA 4A09B 2TRCB 4FA5D 4X63B 3I8EA 4FWWA 3SCYA 4PC0A 5FA5B 3J81g 1GOTB 2PM7B 5I5MA 2H68A 2OVPB 3AL8B 5CXBB 5GMKn 3ODTA 3DXKC 1MG2A 2OIZA 5AMSA 4JT5C 5C2VB 3EG6A 2P9IC 4PNKB 4J8GA 4FA4D 5FLXg 4JSPC 5CXBA 4PXWA 3L4MD 4ESGA 3N0EA 1ERJA 3JB9L 3JPXA 4A08A 4XYHA 2QC5A 3EI3A 3V9FA 3SMRA 2UZYB 2H47A 4L3HD 4J77A 3IJ0A 5K1CC 2XL2A 3IIWA 2IUQA 2H3XA 3PXTD 4D0KA 4GQ1A 3E0CA 2YNOA 5EM2A 4GGAA 1XHMA 4O9DA 4QT8A 4ERYA 4J81A 3I7LA 5TEEA 1P22A 3MMYA 5H1MA 4K3JB 1QNIA 4J82A 3EI4A 4J84A 3K26A 4PBZA 3F3GA 2CE8A 4CI8A 2H9LA 4MK0B 4CY2A 3UVNA 2HXCA 4NSXA 4CC9A 5I5JA 5H14A 5H17A 2AGYA 3V5WB 3DXMC 4X3EA
chains in the Genus database with same CATH superfamily
4AEZA 2HU7A 4G55A 4BP9A 4JSXC 4MMZA 4GM8A 4CZYA 2H6QA 4CY5A 4O2WA 4QL1A 4ZOXA 3SN6B 5HYNB 3ZDZA 5EAPA 2AH0A 3OL2A 3MXXA 3RRMC 5JWZA 1K8KC 4XEIC 4GGDA 2I3TA 2P9UC 1JV2A 4OWRA 3T3PA 1I2MB 4L1QD 1E8NA 2J55H 1VE7A 3PSCB 5FKTA 2H14A 5AFU3 4X60B 4A0BB 5IJ8E 3OKYA 4XYIA 2UZXB 4PBYA 2HESX 2IWFA 3ORVD 4AOWA 1JTDB 3P4FA 2OVRB 5AJAA 3DDUA 3ZWLB 4O3TB 2J56H 4OZUA 3EI2B 4G56B 3F3PA 3MZLA 4WK4A 4A0BA 4CZXA 2H9MA 5CXCA 2IUPA 4CY1A 3C99A 1JOFA 4ZOYA 1PGUA 3I8CA 4JHNA 2HKMA 3MUNA 4Y7RA 4JHPC 5CYKB 4A09A 3KRWB 4E5ZB 5EAMA 5FKQA 3K6SA 4YVDA 3B7FA 1NR0A 3JZHA 2IURA 3EQ9A 4BH6A 1NEXB 5THAA 2I3SA 4ZOVA 2EBSA 3VI3A 4KFMB 3AL8A 3ZDXA 1K3IA 1XIPA 1YR2A 4BCBA 4A2LA 1O6FA 4E5ZA 1VE6A 3K27A 3IURA 3UKRC 4A7JA 1MG3A 3I7KA 3RFHA 3OTTA 4GQ2P 3HFQA 4IA9A 1SQ9A 1GOGA 3BG0A 3GREA 3ULEC 5FKSA 4FHLA 4CI1A 3O4GA 2H6KA 2P9NC 4JD2C 1QFSA 2I0TA 4QRJA 3RLMD 1TYEA 1U2VC 3EMHA 4BUJC 4J86A 1S4UX 4D9SA 3MVDK 3NIFA 4CY3A 3RFGA 4GMBA 3SVWD 3GC3B 2Z2NA 4ZOZA 3IIYA 5HE1B 3N0DA 4UM9A 4WJKA 5TDHB 4O45A 3NVNA 5EMJB 3JROA 4O3UB 2MTAH 4U7AA 4AMZA 2P9KC 3I7PA 2CN2A 4Z8LA 1JJUB 1Q47A 2H6NA 3VI4A 3FM0A 2EICA 3EQ7A 2AGXA 3AFCA 3OKWA 4A11B 3I7OA 1U4CA 4PSWB 2QZPA 2H13A 3ZE2A 5A2Qg 4IMMA 4H5IA 3AL9A 5IJ7E 5TF2A 1RI6A 4AX4A 3VGZA 5HE3B 2P9SC 4DNWA 4NBMA 4O1QD 1UOPA 2HJBA 2OK6A 2B5LA 3QHYB 4EWRA 5HDBA 5C86A 4JXMA 2PM6B 2HU8A 5IGQA 5EMKB 3A0FA 4AN0A 3F3FA 2AQ5A 5TEFA 3V7DB 4U1EI 4MMXA 2CO0C 2BCJB 2W18A 3SWSD 3JZGA 3IKOA 2H9PA 5EMMB 3VH0A 4X61B 3V4VA 5M5SA 2IAAA 1PBYB 2QXVA 4UI9R 4G1MA 4L3GD 5K19A 2VDKA 2PBIB 4R7AB 4J87A 1SHYB 2G99A 2PM9B 3C5MA 4WK0A 2XZGA 1H2WA 3IULA 2O9KA 5EALA 5IC7A 4CZVA 1N6FA 2OK4A 1PEVA 3IJEA 3ZE1A 4JSNC 4Z7OA 4J79A 1R5MA 5FQDA 2BBKH 4E54B 1YFQA 3SLED 3BG1A 3JZNA 1VYHC 4N14A 2VDPA 3CFVA 1TYQC 2VZ1A 2HKRA 2YB8B 3KCIA 3NIGA 3MKSB 3J80g 4TZ4A 3QI0A 4O02A 1GXRA 5IGOA 3EI2A 5FKRA 1M1XA 4L9OA 3RN0D 2AGLA 1GOFA 2EIBA 5GSAA 2VDNA 2XYIA 3I2NA 2JKXA 2IUVA 5HE0B 1JMZB 5GXIA 2EIEA 1SQJA 3OW8A 3SBPA 5CYKA 4MMYA 2Z2OA 1N6EA 2I0SA 3SBQA 4H5JA 2YNNA 1K32A 3OF7A 1H2ZA 2OJYA 3UVKA 4A2MA 4DNUA 2HYEA 3ZE0A 4DNVA 3PXSD 4HDJA 2HJ4A 3I7NA 3SFZA 1FWXA 3MUOA 3PXWD 2CO0A 5GXHA 4A08B 4FA1D 2XDWA 3EI3B 3SXTD 1L0QA 2GC4A 3FCUA 1UOOA 4FB1D 2B5MA 3RSEC 3FRXA 1OMWB 4WK2A 4PSXB 3EQ8A 2AH1A 2Z2PA 5EARA 3PSLA 3IJ1A 4IRZA 4D6VA 4ZN4A 4BL0A 3FGBA 4ES0A 1QFMA 3C75H 4CI2A 2YBAA 2OVQB 4J0WA 1A0RB 2QR5A 5EM2B 3UVOA 5M5RA 4JSVC 1UOQA 3C9CA 3O4HA 3DSMA 3UKUC 1MDAH 3PE7A 4FAVD 4ERQA 3EI4B 3IUQA 3CFSB 3MKQA 3GFCA 5B4WA 3NIDA 3RMZD 1JMXB 4GZ8A 5HQGA 4BCDA 2CE9A 3IJCA 1TBGA 2H9NA 4G1EA 1N6DA 4GGCA 2CN3A 3W15A 4Y5RD 1GP2B 4ERZA 2CNXA 3NVQA 3SJLD 4FA9D 2BKLA 4AMYA 3EI1B 4A0AB 3JAMg 4A11A 1OLZA 2P9PC 1B9YA 2J57G 3PVWB 3SBRA 3EWEA 3RN1D 3K71A 4RE5A 3KRXB 4NC4A 4CI3A 3IUJA 3EI1A 4A0AA 5KDOB 5E6RA 2I0RA 2YNPA 5M5VA 3NVXA 4GM3A 2G9AA 4GQBB 1T2XA 5FXYA 3SHFA 1PI6A 4BCCA 3I7HA 1GG2B 4J78A 1A12A 2B4EA 4LG8A 2Q7QA 4LG9A 3JRPA 3OL2B 2WQ8A 3EU7A 3V4PA 3IVMA 4J73A 5C9ZB 5C2WB 2B5NA 3MZKA 4J8BA 2IWKA 2VDQA 4I79A 4J0XA 3DWLC 5EMLB 3K72A 4GM9A 2AGZA 4FAND 2PM9A 1B9XA 4K3ID 2XL3A 2GC7A 3OKYB 3L4OD 3VA6A 2P9LC 5HE2B 3I89A 3UR4A 2XU7A 2AGWA 4LGNA 3O4IA 5E6UA 3AH8B 5SXMA 3UVLA 3FCSA 1XKSA 4E54A 4QQEA 4QAMA 1O6GA 3DM0A 5CXCB 2YMUA 3OKTA 5M5UA 1VZ2A 5I5IA 5IT9g 4JT6C 2VDOA 3PVUB 3CIKB 3UVMA 3U4YA 5FFOA 2HU5A 3BWSA 2GNQA 4L1MA 3GD1I 4A09B 2TRCB 4FA5D 4X63B 3I8EA 4FWWA 3SCYA 4PC0A 5FA5B 3J81g 1GOTB 2PM7B 5I5MA 2H68A 2OVPB 3AL8B 5CXBB 5GMKn 4NAAA 3ODTA 3DXKC 1MG2A 2OIZA 1GOHA 5AMSA 4JT5C 5C2VB 3EG6A 4NENA 2P9IC 4PNKB 4J8GA 1L5GA 4FA4D 5FLXg 4JSPC 5CXBA 4PXWA 3IUMA 3L4MD 4ESGA 2VC2A 1H2YA 3N0EA 5E6SA 1ERJA 3JB9L 1E5TA 3JPXA 4A08A 4XYHA 2QC5A 3EI3A 3V9FA 3SMRA 3O4JA 2UZYB 2H47A 4L3HD 4J77A 3IJ0A 5K1CC 2XE4A 4RE6A 2XL2A 5FFGA 3IIWA 2IUQA 2EIDA 2H3XA 3PXTD 4D0KA 4GQ1A 3E0CA 1U8CA 2YNOA 4Z7NA 5EM2A 4GGAA 1XHMA 5M61A 1C9LA 4O9DA 4UM8A 4QT8A 4ERYA 4J81A 3I7LA 5TEEA 1H2XA 1BPOA 1P22A 3MMYA 4K3JB 5H1MA 5C92A 1QNIA 2VDRA 4J82A 3EI4A 1UTCA 4J84A 3K26A 4PBZA 3F3GA 2CE8A 4CI8A 2VDLA 2H9LA 1VZ3A 4MK0B 4CY2A 4BP8A 1C9IA 3IUNA 4Z7QA 3UVNA 2HXCA 4NSXA 4AN1A 4CC9A 3ZDYA 5I5JA 5H14A 1E8MA 2VDMA 5H17A 2AGYA 3V5WB 3DXMC 3T3MA 2VZ3A 5M5TA 4X3EA
chains in the Genus database with same CATH topology
4AEZA 4JSXC 4GM8A 4CZYA 2H6QA 4CY5A 4ZOXA 4QL1A 3SN6B 5HYNB 5EAPA 2AH0A 3OL2A 3MXXA 3RRMC 5JWZA 1K8KC 4XEIC 4GGDA 2I3TA 2P9UC 4OWRA 4L1QD 2J55H 3PSCB 5FKTA 2H14A 5AFU3 4X60B 4A0BB 5IJ8E 3OKYA 4XYIA 2UZXB 4PBYA 2HESX 2IWFA 3ORVD 4AOWA 3P4FA 2OVRB 5AJAA 3ZWLB 4O3TB 2J56H 4OZUA 3EI2B 4G56B 3F3PA 3MZLA 4A0BA 4CZXA 2H9MA 5CXCA 2IUPA 4CY1A 3C99A 1JOFA 4ZOYA 1PGUA 3I8CA 2HKMA 4Y7RA 5CYKB 4A09A 3KRWB 4E5ZB 5EAMA 5FKQA 4YVDA 3B7FA 1NR0A 3JZHA 2IURA 4BH6A 1NEXB 5THAA 2I3SA 4ZOVA 2EBSA 4KFMB 3AL8A 1XIPA 4A2LA 4E5ZA 3K27A 3UKRC 4A7JA 1MG3A 3I7KA 3RFHA 3OTTA 4GQ2P 3HFQA 4IA9A 1SQ9A 3GREA 3BG0A 3ULEC 5FKSA 4FHLA 4CI1A 2H6KA 2P9NC 4JD2C 2I0TA 4QRJA 3RLMD 1U2VC 3EMHA 4BUJC 4J86A 1S4UX 4CY3A 3RFGA 4GMBA 3SVWD 2Z2NA 4ZOZA 3IIYA 5HE1B 3N0DA 5TDHB 4O45A 3NVNA 5EMJB 3JROA 4O3UB 2MTAH 4U7AA 2P9KC 3I7PA 2CN2A 4Z8LA 1JJUB 1Q47A 2H6NA 3FM0A 2AGXA 3AFCA 3OKWA 4A11B 3I7OA 1U4CA 4PSWB 2H13A 5A2Qg 4IMMA 4H5IA 3AL9A 5IJ7E 5TF2A 1RI6A 3VGZA 5HE3B 2P9SC 4O1QD 2HJBA 2OK6A 2B5LA 4EWRA 4JXMA 2PM6B 5IGQA 5EMKB 3A0FA 3F3FA 2AQ5A 5TEFA 3V7DB 4U1EI 2CO0C 2BCJB 2W18A 3SWSD 3JZGA 3IKOA 2H9PA 5EMMB 3VH0A 4X61B 2IAAA 1PBYB 2QXVA 4UI9R 4L3GD 5K19A 4R7AB 2PBIB 4J87A 1SHYB 2G99A 2PM9B 3C5MA 5IC7A 4CZVA 2O9KA 5EALA 1N6FA 2OK4A 1PEVA 4JSNC 4J79A 1R5MA 5FQDA 2BBKH 4E54B 1YFQA 3SLED 3BG1A 3JZNA 1VYHC 4N14A 3CFVA 1TYQC 2YB8B 2HKRA 3MKSB 3J80g 4TZ4A 1GXRA 5IGOA 3EI2A 5FKRA 4L9OA 3RN0D 2AGLA 5GSAA 2XYIA 3I2NA 5HE0B 2IUVA 1JMZB 5GXIA 1SQJA 3OW8A 3SBPA 5CYKA 2Z2OA 1N6EA 2I0SA 3SBQA 4H5JA 2YNNA 1K32A 2OJYA 3UVKA 4A2MA 2HYEA 3PXSD 4HDJA 2HJ4A 3I7NA 3SFZA 1FWXA 5GXHA 3PXWD 2CO0A 4A08B 4FA1D 3EI3B 3SXTD 1L0QA 2GC4A 4FB1D 2B5MA 3RSEC 3FRXA 1OMWB 4PSXB 2AH1A 2Z2PA 5EARA 3PSLA 3IJ1A 4D6VA 4ZN4A 4BL0A 3FGBA 4ES0A 3C75H 4CI2A 2YBAA 2OVQB 4J0WA 1A0RB 5EM2B 3UVOA 4JSVC 3C9CA 3DSMA 3UKUC 1MDAH 3PE7A 4FAVD 4ERQA 3EI4B 3CFSB 3MKQA 3GFCA 5B4WA 3RMZD 1JMXB 4GZ8A 5HQGA 2CE9A 3IJCA 1TBGA 2H9NA 3W15A 1N6DA 4GGCA 2CN3A 4ERZA 4Y5RD 1GP2B 2CNXA 3NVQA 3SJLD 4FA9D 3EI1B 4A0AB 3JAMg 4A11A 1OLZA 2P9PC 1B9YA 2J57G 3PVWB 3SBRA 3EWEA 3RN1D 3KRXB 3EI1A 4CI3A 4A0AA 5KDOB 2I0RA 2YNPA 3NVXA 4GM3A 2G9AA 4GQBB 5FXYA 3SHFA 1PI6A 3I7HA 1GG2B 4J78A 2B4EA 4LG8A 2Q7QA 4LG9A 3JRPA 3OL2B 3EU7A 4J73A 5C9ZB 5C2WB 2B5NA 3MZKA 4J8BA 2IWKA 4I79A 4J0XA 3DWLC 5EMLB 4GM9A 2AGZA 4FAND 2PM9A 1B9XA 4K3ID 2XL3A 2GC7A 3OKYB 3L4OD 3VA6A 2P9LC 5HE2B 3I89A 3UR4A 2XU7A 2AGWA 4LGNA 3AH8B 5SXMA 3UVLA 4E54A 1XKSA 4QQEA 3DM0A 5CXCB 2YMUA 3OKTA 5IT9g 5I5IA 4JT6C 3PVUB 3CIKB 3UVMA 3U4YA 3BWSA 2GNQA 4A09B 2TRCB 4FA5D 4X63B 3I8EA 4FWWA 3SCYA 4PC0A 5FA5B 3J81g 1GOTB 2PM7B 5I5MA 2H68A 2OVPB 3AL8B 5CXBB 5GMKn 3ODTA 3DXKC 1MG2A 2OIZA 5AMSA 4JT5C 5C2VB 3EG6A 2P9IC 4PNKB 4J8GA 4FA4D 5FLXg 4JSPC 5CXBA 4PXWA 3L4MD 4ESGA 3N0EA 1ERJA 3JB9L 3JPXA 4A08A 4XYHA 2QC5A 3EI3A 3V9FA 3SMRA 2UZYB 2H47A 4L3HD 4J77A 3IJ0A 5K1CC 2XL2A 3IIWA 2IUQA 2H3XA 3PXTD 4D0KA 4GQ1A 3E0CA 2YNOA 5EM2A 4GGAA 1XHMA 4O9DA 4QT8A 4ERYA 4J81A 3I7LA 5TEEA 1P22A 3MMYA 5H1MA 4K3JB 1QNIA 4J82A 3EI4A 4J84A 3K26A 4PBZA 3F3GA 2CE8A 4CI8A 2H9LA 4MK0B 4CY2A 3UVNA 2HXCA 4NSXA 4CC9A 5I5JA 5H14A 5H17A 2AGYA 3V5WB 3DXMC 4X3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEZ A;  4JSX C;  4GM8 A;  4CZY A;  2H6Q A;  4CY5 A;  4ZOX A;  4QL1 A;  3SN6 B;  5HYN B;  5EAP A;  2AH0 A;  3OL2 A;  3MXX A;  3RRM C;  5JWZ A;  1K8K C;  4XEI C;  4GGD A;  2I3T A;  2P9U C;  4OWR A;  4L1Q D;  2J55 H;  3PSC B;  5FKT A;  2H14 A;  5AFU 3;  4X60 B;  4A0B B;  5IJ8 E;  3OKY A;  4XYI A;  2UZX B;  4PBY A;  2HES X;  2IWF A;  3ORV D;  4AOW A;  3P4F A;  2OVR B;  5AJA A;  3ZWL B;  4O3T B;  2J56 H;  4OZU A;  3EI2 B;  4G56 B;  3F3P A;  3MZL A;  4A0B A;  4CZX A;  2H9M A;  5CXC A;  2IUP A;  4CY1 A;  3C99 A;  1JOF A;  4ZOY A;  1PGU A;  3I8C A;  2HKM A;  4Y7R A;  5CYK B;  4A09 A;  3KRW B;  4E5Z B;  5EAM A;  5FKQ A;  4YVD A;  3B7F A;  1NR0 A;  3JZH A;  2IUR A;  4BH6 A;  1NEX B;  5THA A;  2I3S A;  4ZOV A;  2EBS A;  4KFM B;  3AL8 A;  1XIP A;  4A2L A;  4E5Z A;  3K27 A;  3UKR C;  4A7J A;  1MG3 A;  3I7K A;  3RFH A;  3OTT A;  4GQ2 P;  3HFQ A;  4IA9 A;  1SQ9 A;  3GRE A;  3BG0 A;  3ULE C;  5FKS A;  4FHL A;  4CI1 A;  2H6K A;  2P9N C;  4JD2 C;  2I0T A;  4QRJ A;  3RLM D;  1U2V C;  3EMH A;  4BUJ C;  4J86 A;  1S4U X;  4CY3 A;  3RFG A;  4GMB A;  3SVW D;  2Z2N A;  4ZOZ A;  3IIY A;  5HE1 B;  3N0D A;  5TDH B;  4O45 A;  3NVN A;  5EMJ B;  3JRO A;  4O3U B;  2MTA H;  4U7A A;  2P9K C;  3I7P A;  2CN2 A;  4Z8L A;  1JJU B;  1Q47 A;  2H6N A;  3FM0 A;  2AGX A;  3AFC A;  3OKW A;  4A11 B;  3I7O A;  1U4C A;  4PSW B;  2H13 A;  5A2Q g;  4IMM A;  4H5I A;  3AL9 A;  5IJ7 E;  5TF2 A;  1RI6 A;  3VGZ A;  5HE3 B;  2P9S C;  4O1Q D;  2HJB A;  2OK6 A;  2B5L A;  4EWR A;  4JXM A;  2PM6 B;  5IGQ A;  5EMK B;  3A0F A;  3F3F A;  2AQ5 A;  5TEF A;  3V7D B;  4U1E I;  2CO0 C;  2BCJ B;  2W18 A;  3SWS D;  3JZG A;  3IKO A;  2H9P A;  5EMM B;  3VH0 A;  4X61 B;  2IAA A;  1PBY B;  2QXV A;  4UI9 R;  4L3G D;  5K19 A;  4R7A B;  2PBI B;  4J87 A;  1SHY B;  2G99 A;  2PM9 B;  3C5M A;  5IC7 A;  4CZV A;  2O9K A;  5EAL A;  1N6F A;  2OK4 A;  1PEV A;  4JSN C;  4J79 A;  1R5M A;  5FQD A;  2BBK H;  4E54 B;  1YFQ A;  3SLE D;  3BG1 A;  3JZN A;  1VYH C;  4N14 A;  3CFV A;  1TYQ C;  2YB8 B;  2HKR A;  3MKS B;  3J80 g;  4TZ4 A;  1GXR A;  5IGO A;  3EI2 A;  5FKR A;  4L9O A;  3RN0 D;  2AGL A;  5GSA A;  2XYI A;  3I2N A;  5HE0 B;  2IUV A;  1JMZ B;  5GXI A;  1SQJ A;  3OW8 A;  3SBP A;  5CYK A;  2Z2O A;  1N6E A;  2I0S A;  3SBQ A;  4H5J A;  2YNN A;  1K32 A;  2OJY A;  3UVK A;  4A2M A;  2HYE A;  3PXS D;  4HDJ A;  2HJ4 A;  3I7N A;  3SFZ A;  1FWX A;  5GXH A;  3PXW D;  2CO0 A;  4A08 B;  4FA1 D;  3EI3 B;  3SXT D;  1L0Q A;  2GC4 A;  4FB1 D;  2B5M A;  3RSE C;  3FRX A;  1OMW B;  4PSX B;  2AH1 A;  2Z2P A;  5EAR A;  3PSL A;  3IJ1 A;  4D6V A;  4ZN4 A;  4BL0 A;  3FGB A;  4ES0 A;  3C75 H;  4CI2 A;  2YBA A;  2OVQ B;  4J0W A;  1A0R B;  5EM2 B;  3UVO A;  4JSV C;  3C9C A;  3DSM A;  3UKU C;  1MDA H;  3PE7 A;  4FAV D;  4ERQ A;  3EI4 B;  3CFS B;  3MKQ A;  3GFC A;  5B4W A;  3RMZ D;  1JMX B;  4GZ8 A;  5HQG A;  2CE9 A;  3IJC A;  1TBG A;  2H9N A;  3W15 A;  1N6D A;  4GGC A;  2CN3 A;  4ERZ A;  4Y5R D;  1GP2 B;  2CNX A;  3NVQ A;  3SJL D;  4FA9 D;  3EI1 B;  4A0A B;  3JAM g;  4A11 A;  1OLZ A;  2P9P C;  1B9Y A;  2J57 G;  3PVW B;  3SBR A;  3EWE A;  3RN1 D;  3KRX B;  3EI1 A;  4CI3 A;  4A0A A;  5KDO B;  2I0R A;  2YNP A;  3NVX A;  4GM3 A;  2G9A A;  4GQB B;  5FXY A;  3SHF A;  1PI6 A;  3I7H A;  1GG2 B;  4J78 A;  2B4E A;  4LG8 A;  2Q7Q A;  4LG9 A;  3JRP A;  3OL2 B;  3EU7 A;  4J73 A;  5C9Z B;  5C2W B;  2B5N A;  3MZK A;  4J8B A;  2IWK A;  4I79 A;  4J0X A;  3DWL C;  5EML B;  4GM9 A;  2AGZ A;  4FAN D;  2PM9 A;  1B9X A;  4K3I D;  2XL3 A;  2GC7 A;  3OKY B;  3L4O D;  3VA6 A;  2P9L C;  5HE2 B;  3I89 A;  3UR4 A;  2XU7 A;  2AGW A;  4LGN A;  3AH8 B;  5SXM A;  3UVL A;  4E54 A;  1XKS A;  4QQE A;  3DM0 A;  5CXC B;  2YMU A;  3OKT A;  5IT9 g;  5I5I A;  4JT6 C;  3PVU B;  3CIK B;  3UVM A;  3U4Y A;  3BWS A;  2GNQ A;  4A09 B;  2TRC B;  4FA5 D;  4X63 B;  3I8E A;  4FWW A;  3SCY A;  4PC0 A;  5FA5 B;  3J81 g;  1GOT B;  2PM7 B;  5I5M A;  2H68 A;  2OVP B;  3AL8 B;  5CXB B;  5GMK n;  3ODT A;  3DXK C;  1MG2 A;  2OIZ A;  5AMS A;  4JT5 C;  5C2V B;  3EG6 A;  2P9I C;  4PNK B;  4J8G A;  4FA4 D;  5FLX g;  4JSP C;  5CXB A;  4PXW A;  3L4M D;  4ESG A;  3N0E A;  1ERJ A;  3JB9 L;  3JPX A;  4A08 A;  4XYH A;  2QC5 A;  3EI3 A;  3V9F A;  3SMR A;  2UZY B;  2H47 A;  4L3H D;  4J77 A;  3IJ0 A;  5K1C C;  2XL2 A;  3IIW A;  2IUQ A;  2H3X A;  3PXT D;  4D0K A;  4GQ1 A;  3E0C A;  2YNO A;  5EM2 A;  4GGA A;  1XHM A;  4O9D A;  4QT8 A;  4ERY A;  4J81 A;  3I7L A;  5TEE A;  1P22 A;  3MMY A;  5H1M A;  4K3J B;  1QNI A;  4J82 A;  3EI4 A;  4J84 A;  3K26 A;  4PBZ A;  3F3G A;  2CE8 A;  4CI8 A;  2H9L A;  4MK0 B;  4CY2 A;  3UVN A;  2HXC A;  4NSX A;  4CC9 A;  5I5J A;  5H14 A;  5H17 A;  2AGY A;  3V5W B;  3DXM C;  4X3E A; 
#chains in the Genus database with same CATH topology
 4AEZ A;  2HU7 A;  4G55 A;  4BP9 A;  4JSX C;  4MMZ A;  4GM8 A;  4CZY A;  2H6Q A;  4CY5 A;  4O2W A;  4QL1 A;  4ZOX A;  3SN6 B;  5HYN B;  3ZDZ A;  5EAP A;  2AH0 A;  3OL2 A;  3MXX A;  3RRM C;  5JWZ A;  1K8K C;  4XEI C;  4GGD A;  2I3T A;  2P9U C;  1JV2 A;  4OWR A;  3T3P A;  1I2M B;  4L1Q D;  1E8N A;  2J55 H;  1VE7 A;  3PSC B;  5FKT A;  2H14 A;  5AFU 3;  4X60 B;  4A0B B;  5IJ8 E;  3OKY A;  4XYI A;  2UZX B;  4PBY A;  2HES X;  2IWF A;  3ORV D;  4AOW A;  1JTD B;  3P4F A;  2OVR B;  5AJA A;  3DDU A;  3ZWL B;  4O3T B;  2J56 H;  4OZU A;  3EI2 B;  4G56 B;  3F3P A;  3MZL A;  4WK4 A;  4A0B A;  4CZX A;  2H9M A;  5CXC A;  2IUP A;  4CY1 A;  3C99 A;  1JOF A;  4ZOY A;  1PGU A;  3I8C A;  4JHN A;  2HKM A;  3MUN A;  4Y7R A;  4JHP C;  5CYK B;  4A09 A;  3KRW B;  4E5Z B;  5EAM A;  5FKQ A;  3K6S A;  4YVD A;  3B7F A;  1NR0 A;  3JZH A;  2IUR A;  3EQ9 A;  4BH6 A;  1NEX B;  5THA A;  2I3S A;  4ZOV A;  2EBS A;  3VI3 A;  4KFM B;  3AL8 A;  3ZDX A;  1K3I A;  1XIP A;  1YR2 A;  4BCB A;  4A2L A;  1O6F A;  4E5Z A;  1VE6 A;  3K27 A;  3IUR A;  3UKR C;  4A7J A;  1MG3 A;  3I7K A;  3RFH A;  3OTT A;  4GQ2 P;  3HFQ A;  4IA9 A;  1SQ9 A;  1GOG A;  3BG0 A;  3GRE A;  3ULE C;  5FKS A;  4FHL A;  4CI1 A;  3O4G A;  2H6K A;  2P9N C;  4JD2 C;  1QFS A;  2I0T A;  4QRJ A;  3RLM D;  1TYE A;  1U2V C;  3EMH A;  4BUJ C;  4J86 A;  1S4U X;  4D9S A;  3MVD K;  3NIF A;  4CY3 A;  3RFG A;  4GMB A;  3SVW D;  3GC3 B;  2Z2N A;  4ZOZ A;  3IIY A;  5HE1 B;  3N0D A;  4UM9 A;  4WJK A;  5TDH B;  4O45 A;  3NVN A;  5EMJ B;  3JRO A;  4O3U B;  2MTA H;  4U7A A;  4AMZ A;  2P9K C;  3I7P A;  2CN2 A;  4Z8L A;  1JJU B;  1Q47 A;  2H6N A;  3VI4 A;  3FM0 A;  2EIC A;  3EQ7 A;  2AGX A;  3AFC A;  3OKW A;  4A11 B;  3I7O A;  1U4C A;  4PSW B;  2QZP A;  2H13 A;  3ZE2 A;  5A2Q g;  4IMM A;  4H5I A;  3AL9 A;  5IJ7 E;  5TF2 A;  1RI6 A;  4AX4 A;  3VGZ A;  5HE3 B;  2P9S C;  4DNW A;  4NBM A;  4O1Q D;  1UOP A;  2HJB A;  2OK6 A;  2B5L A;  3QHY B;  4EWR A;  5HDB A;  5C86 A;  4JXM A;  2PM6 B;  2HU8 A;  5IGQ A;  5EMK B;  3A0F A;  4AN0 A;  3F3F A;  2AQ5 A;  5TEF A;  3V7D B;  4U1E I;  4MMX A;  2CO0 C;  2BCJ B;  2W18 A;  3SWS D;  3JZG A;  3IKO A;  2H9P A;  5EMM B;  3VH0 A;  4X61 B;  3V4V A;  5M5S A;  2IAA A;  1PBY B;  2QXV A;  4UI9 R;  4G1M A;  4L3G D;  5K19 A;  2VDK A;  2PBI B;  4R7A B;  4J87 A;  1SHY B;  2G99 A;  2PM9 B;  3C5M A;  4WK0 A;  2XZG A;  1H2W A;  3IUL A;  2O9K A;  5EAL A;  5IC7 A;  4CZV A;  1N6F A;  2OK4 A;  1PEV A;  3IJE A;  3ZE1 A;  4JSN C;  4Z7O A;  4J79 A;  1R5M A;  5FQD A;  2BBK H;  4E54 B;  1YFQ A;  3SLE D;  3BG1 A;  3JZN A;  1VYH C;  4N14 A;  2VDP A;  3CFV A;  1TYQ C;  2VZ1 A;  2HKR A;  2YB8 B;  3KCI A;  3NIG A;  3MKS B;  3J80 g;  4TZ4 A;  3QI0 A;  4O02 A;  1GXR A;  5IGO A;  3EI2 A;  5FKR A;  1M1X A;  4L9O A;  3RN0 D;  2AGL A;  1GOF A;  2EIB A;  5GSA A;  2VDN A;  2XYI A;  3I2N A;  2JKX A;  2IUV A;  5HE0 B;  1JMZ B;  5GXI A;  2EIE A;  1SQJ A;  3OW8 A;  3SBP A;  5CYK A;  4MMY A;  2Z2O A;  1N6E A;  2I0S A;  3SBQ A;  4H5J A;  2YNN A;  1K32 A;  3OF7 A;  1H2Z A;  2OJY A;  3UVK A;  4A2M A;  4DNU A;  2HYE A;  3ZE0 A;  4DNV A;  3PXS D;  4HDJ A;  2HJ4 A;  3I7N A;  3SFZ A;  1FWX A;  3MUO A;  3PXW D;  2CO0 A;  5GXH A;  4A08 B;  4FA1 D;  2XDW A;  3EI3 B;  3SXT D;  1L0Q A;  2GC4 A;  3FCU A;  1UOO A;  4FB1 D;  2B5M A;  3RSE C;  3FRX A;  1OMW B;  4WK2 A;  4PSX B;  3EQ8 A;  2AH1 A;  2Z2P A;  5EAR A;  3PSL A;  3IJ1 A;  4IRZ A;  4D6V A;  4ZN4 A;  4BL0 A;  3FGB A;  4ES0 A;  1QFM A;  3C75 H;  4CI2 A;  2YBA A;  2OVQ B;  4J0W A;  1A0R B;  2QR5 A;  5EM2 B;  3UVO A;  5M5R A;  4JSV C;  1UOQ A;  3C9C A;  3O4H A;  3DSM A;  3UKU C;  1MDA H;  3PE7 A;  4FAV D;  4ERQ A;  3EI4 B;  3IUQ A;  3CFS B;  3MKQ A;  3GFC A;  5B4W A;  3NID A;  3RMZ D;  1JMX B;  4GZ8 A;  5HQG A;  4BCD A;  2CE9 A;  3IJC A;  1TBG A;  2H9N A;  4G1E A;  1N6D A;  4GGC A;  2CN3 A;  3W15 A;  4Y5R D;  1GP2 B;  4ERZ A;  2CNX A;  3NVQ A;  3SJL D;  4FA9 D;  2BKL A;  4AMY A;  3EI1 B;  4A0A B;  3JAM g;  4A11 A;  1OLZ A;  2P9P C;  1B9Y A;  2J57 G;  3PVW B;  3SBR A;  3EWE A;  3RN1 D;  3K71 A;  4RE5 A;  3KRX B;  4NC4 A;  4CI3 A;  3IUJ A;  3EI1 A;  4A0A A;  5KDO B;  5E6R A;  2I0R A;  2YNP A;  5M5V A;  3NVX A;  4GM3 A;  2G9A A;  4GQB B;  1T2X A;  5FXY A;  3SHF A;  1PI6 A;  4BCC A;  3I7H A;  1GG2 B;  4J78 A;  1A12 A;  2B4E A;  4LG8 A;  2Q7Q A;  4LG9 A;  3JRP A;  3OL2 B;  2WQ8 A;  3EU7 A;  3V4P A;  3IVM A;  4J73 A;  5C9Z B;  5C2W B;  2B5N A;  3MZK A;  4J8B A;  2IWK A;  2VDQ A;  4I79 A;  4J0X A;  3DWL C;  5EML B;  3K72 A;  4GM9 A;  2AGZ A;  4FAN D;  2PM9 A;  1B9X A;  4K3I D;  2XL3 A;  2GC7 A;  3OKY B;  3L4O D;  3VA6 A;  2P9L C;  5HE2 B;  3I89 A;  3UR4 A;  2XU7 A;  2AGW A;  4LGN A;  3O4I A;  5E6U A;  3AH8 B;  5SXM A;  3UVL A;  3FCS A;  1XKS A;  4E54 A;  4QQE A;  4QAM A;  1O6G A;  3DM0 A;  5CXC B;  2YMU A;  3OKT A;  5M5U A;  1VZ2 A;  5I5I A;  5IT9 g;  4JT6 C;  2VDO A;  3PVU B;  3CIK B;  3UVM A;  3U4Y A;  5FFO A;  2HU5 A;  3BWS A;  2GNQ A;  4L1M A;  3GD1 I;  4A09 B;  2TRC B;  4FA5 D;  4X63 B;  3I8E A;  4FWW A;  3SCY A;  4PC0 A;  5FA5 B;  3J81 g;  1GOT B;  2PM7 B;  5I5M A;  2H68 A;  2OVP B;  3AL8 B;  5CXB B;  5GMK n;  4NAA A;  3ODT A;  3DXK C;  1MG2 A;  2OIZ A;  1GOH A;  5AMS A;  4JT5 C;  5C2V B;  3EG6 A;  4NEN A;  2P9I C;  4PNK B;  4J8G A;  1L5G A;  4FA4 D;  5FLX g;  4JSP C;  5CXB A;  4PXW A;  3IUM A;  3L4M D;  4ESG A;  2VC2 A;  1H2Y A;  3N0E A;  5E6S A;  1ERJ A;  3JB9 L;  1E5T A;  3JPX A;  4A08 A;  4XYH A;  2QC5 A;  3EI3 A;  3V9F A;  3SMR A;  3O4J A;  2UZY B;  2H47 A;  4L3H D;  4J77 A;  3IJ0 A;  5K1C C;  2XE4 A;  4RE6 A;  2XL2 A;  5FFG A;  3IIW A;  2IUQ A;  2EID A;  2H3X A;  3PXT D;  4D0K A;  4GQ1 A;  3E0C A;  1U8C A;  2YNO A;  4Z7N A;  5EM2 A;  4GGA A;  1XHM A;  5M61 A;  1C9L A;  4O9D A;  4UM8 A;  4QT8 A;  4ERY A;  4J81 A;  3I7L A;  5TEE A;  1H2X A;  1BPO A;  1P22 A;  3MMY A;  4K3J B;  5H1M A;  5C92 A;  1QNI A;  2VDR A;  4J82 A;  3EI4 A;  1UTC A;  4J84 A;  3K26 A;  4PBZ A;  3F3G A;  2CE8 A;  4CI8 A;  2VDL A;  2H9L A;  1VZ3 A;  4MK0 B;  4CY2 A;  4BP8 A;  1C9I A;  3IUN A;  4Z7Q A;  3UVN A;  2HXC A;  4NSX A;  4AN1 A;  4CC9 A;  3ZDY A;  5I5J A;  5H14 A;  1E8M A;  2VDM A;  5H17 A;  2AGY A;  3V5W B;  3DXM C;  3T3M A;  2VZ3 A;  5M5T A;  4X3E A; 
#chains in the Genus database with same CATH homology
 4AEZ A;  4JSX C;  4GM8 A;  4CZY A;  2H6Q A;  4CY5 A;  4ZOX A;  4QL1 A;  3SN6 B;  5HYN B;  5EAP A;  2AH0 A;  3OL2 A;  3MXX A;  3RRM C;  5JWZ A;  1K8K C;  4XEI C;  4GGD A;  2I3T A;  2P9U C;  4OWR A;  4L1Q D;  2J55 H;  3PSC B;  5FKT A;  2H14 A;  5AFU 3;  4X60 B;  4A0B B;  5IJ8 E;  3OKY A;  4XYI A;  2UZX B;  4PBY A;  2HES X;  2IWF A;  3ORV D;  4AOW A;  3P4F A;  2OVR B;  5AJA A;  3ZWL B;  4O3T B;  2J56 H;  4OZU A;  3EI2 B;  4G56 B;  3F3P A;  3MZL A;  4A0B A;  4CZX A;  2H9M A;  5CXC A;  2IUP A;  4CY1 A;  3C99 A;  1JOF A;  4ZOY A;  1PGU A;  3I8C A;  2HKM A;  4Y7R A;  5CYK B;  4A09 A;  3KRW B;  4E5Z B;  5EAM A;  5FKQ A;  4YVD A;  3B7F A;  1NR0 A;  3JZH A;  2IUR A;  4BH6 A;  1NEX B;  5THA A;  2I3S A;  4ZOV A;  2EBS A;  4KFM B;  3AL8 A;  1XIP A;  4A2L A;  4E5Z A;  3K27 A;  3UKR C;  4A7J A;  1MG3 A;  3I7K A;  3RFH A;  3OTT A;  4GQ2 P;  3HFQ A;  4IA9 A;  1SQ9 A;  3GRE A;  3BG0 A;  3ULE C;  5FKS A;  4FHL A;  4CI1 A;  2H6K A;  2P9N C;  4JD2 C;  2I0T A;  4QRJ A;  3RLM D;  1U2V C;  3EMH A;  4BUJ C;  4J86 A;  1S4U X;  4CY3 A;  3RFG A;  4GMB A;  3SVW D;  2Z2N A;  4ZOZ A;  3IIY A;  5HE1 B;  3N0D A;  5TDH B;  4O45 A;  3NVN A;  5EMJ B;  3JRO A;  4O3U B;  2MTA H;  4U7A A;  2P9K C;  3I7P A;  2CN2 A;  4Z8L A;  1JJU B;  1Q47 A;  2H6N A;  3FM0 A;  2AGX A;  3AFC A;  3OKW A;  4A11 B;  3I7O A;  1U4C A;  4PSW B;  2H13 A;  5A2Q g;  4IMM A;  4H5I A;  3AL9 A;  5IJ7 E;  5TF2 A;  1RI6 A;  3VGZ A;  5HE3 B;  2P9S C;  4O1Q D;  2HJB A;  2OK6 A;  2B5L A;  4EWR A;  4JXM A;  2PM6 B;  5IGQ A;  5EMK B;  3A0F A;  3F3F A;  2AQ5 A;  5TEF A;  3V7D B;  4U1E I;  2CO0 C;  2BCJ B;  2W18 A;  3SWS D;  3JZG A;  3IKO A;  2H9P A;  5EMM B;  3VH0 A;  4X61 B;  2IAA A;  1PBY B;  2QXV A;  4UI9 R;  4L3G D;  5K19 A;  4R7A B;  2PBI B;  4J87 A;  1SHY B;  2G99 A;  2PM9 B;  3C5M A;  5IC7 A;  4CZV A;  2O9K A;  5EAL A;  1N6F A;  2OK4 A;  1PEV A;  4JSN C;  4J79 A;  1R5M A;  5FQD A;  2BBK H;  4E54 B;  1YFQ A;  3SLE D;  3BG1 A;  3JZN A;  1VYH C;  4N14 A;  3CFV A;  1TYQ C;  2YB8 B;  2HKR A;  3MKS B;  3J80 g;  4TZ4 A;  1GXR A;  5IGO A;  3EI2 A;  5FKR A;  4L9O A;  3RN0 D;  2AGL A;  5GSA A;  2XYI A;  3I2N A;  5HE0 B;  2IUV A;  1JMZ B;  5GXI A;  1SQJ A;  3OW8 A;  3SBP A;  5CYK A;  2Z2O A;  1N6E A;  2I0S A;  3SBQ A;  4H5J A;  2YNN A;  1K32 A;  2OJY A;  3UVK A;  4A2M A;  2HYE A;  3PXS D;  4HDJ A;  2HJ4 A;  3I7N A;  3SFZ A;  1FWX A;  5GXH A;  3PXW D;  2CO0 A;  4A08 B;  4FA1 D;  3EI3 B;  3SXT D;  1L0Q A;  2GC4 A;  4FB1 D;  2B5M A;  3RSE C;  3FRX A;  1OMW B;  4PSX B;  2AH1 A;  2Z2P A;  5EAR A;  3PSL A;  3IJ1 A;  4D6V A;  4ZN4 A;  4BL0 A;  3FGB A;  4ES0 A;  3C75 H;  4CI2 A;  2YBA A;  2OVQ B;  4J0W A;  1A0R B;  5EM2 B;  3UVO A;  4JSV C;  3C9C A;  3DSM A;  3UKU C;  1MDA H;  3PE7 A;  4FAV D;  4ERQ A;  3EI4 B;  3CFS B;  3MKQ A;  3GFC A;  5B4W A;  3RMZ D;  1JMX B;  4GZ8 A;  5HQG A;  2CE9 A;  3IJC A;  1TBG A;  2H9N A;  3W15 A;  1N6D A;  4GGC A;  2CN3 A;  4ERZ A;  4Y5R D;  1GP2 B;  2CNX A;  3NVQ A;  3SJL D;  4FA9 D;  3EI1 B;  4A0A B;  3JAM g;  4A11 A;  1OLZ A;  2P9P C;  1B9Y A;  2J57 G;  3PVW B;  3SBR A;  3EWE A;  3RN1 D;  3KRX B;  3EI1 A;  4CI3 A;  4A0A A;  5KDO B;  2I0R A;  2YNP A;  3NVX A;  4GM3 A;  2G9A A;  4GQB B;  5FXY A;  3SHF A;  1PI6 A;  3I7H A;  1GG2 B;  4J78 A;  2B4E A;  4LG8 A;  2Q7Q A;  4LG9 A;  3JRP A;  3OL2 B;  3EU7 A;  4J73 A;  5C9Z B;  5C2W B;  2B5N A;  3MZK A;  4J8B A;  2IWK A;  4I79 A;  4J0X A;  3DWL C;  5EML B;  4GM9 A;  2AGZ A;  4FAN D;  2PM9 A;  1B9X A;  4K3I D;  2XL3 A;  2GC7 A;  3OKY B;  3L4O D;  3VA6 A;  2P9L C;  5HE2 B;  3I89 A;  3UR4 A;  2XU7 A;  2AGW A;  4LGN A;  3AH8 B;  5SXM A;  3UVL A;  4E54 A;  1XKS A;  4QQE A;  3DM0 A;  5CXC B;  2YMU A;  3OKT A;  5IT9 g;  5I5I A;  4JT6 C;  3PVU B;  3CIK B;  3UVM A;  3U4Y A;  3BWS A;  2GNQ A;  4A09 B;  2TRC B;  4FA5 D;  4X63 B;  3I8E A;  4FWW A;  3SCY A;  4PC0 A;  5FA5 B;  3J81 g;  1GOT B;  2PM7 B;  5I5M A;  2H68 A;  2OVP B;  3AL8 B;  5CXB B;  5GMK n;  3ODT A;  3DXK C;  1MG2 A;  2OIZ A;  5AMS A;  4JT5 C;  5C2V B;  3EG6 A;  2P9I C;  4PNK B;  4J8G A;  4FA4 D;  5FLX g;  4JSP C;  5CXB A;  4PXW A;  3L4M D;  4ESG A;  3N0E A;  1ERJ A;  3JB9 L;  3JPX A;  4A08 A;  4XYH A;  2QC5 A;  3EI3 A;  3V9F A;  3SMR A;  2UZY B;  2H47 A;  4L3H D;  4J77 A;  3IJ0 A;  5K1C C;  2XL2 A;  3IIW A;  2IUQ A;  2H3X A;  3PXT D;  4D0K A;  4GQ1 A;  3E0C A;  2YNO A;  5EM2 A;  4GGA A;  1XHM A;  4O9D A;  4QT8 A;  4ERY A;  4J81 A;  3I7L A;  5TEE A;  1P22 A;  3MMY A;  5H1M A;  4K3J B;  1QNI A;  4J82 A;  3EI4 A;  4J84 A;  3K26 A;  4PBZ A;  3F3G A;  2CE8 A;  4CI8 A;  2H9L A;  4MK0 B;  4CY2 A;  3UVN A;  2HXC A;  4NSX A;  4CC9 A;  5I5J A;  5H14 A;  5H17 A;  2AGY A;  3V5W B;  3DXM C;  4X3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...