2HJBA

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
358
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 92
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hjbA01
3AL9A 4A0AA 3OKTA 3K27A 1XKSA 4CY3A 1TYQC 2G9AA 1JMZB 5K19A 3HFQA 3UKUC 3RRMC 5EMMB 3VH0A 4G56B 3I7NA 3IIYA 3CIKB 2B4EA 2PM7B 3OKYA 1A0RB 4CZXA 3I7OA 3PSLA 3EI2A 4D6VA 4QQEA 5CXCA 4JSPC 4L9OA 2OK6A 2YB8B 4CY2A 4ZOYA 4CI8A 5H14A 4JD2C 2HKRA 2OVRB 4AEZA 4ZOZA 2CN3A 4JXMA 2I3SA 3RN0D 3SMRA 4NSXA 5I5IA 4CI2A 4J79A 2O9KA 2CO0C 2H47A 4FHLA 3MZKA 4A08A 1N6FA 4Y5RD 4EWRA 1N6EA 2OIZA 4GGCA 5IGOA 4GQ1A 4E5ZB 3J80g 4H5IA 3AFCA 3L4MD 1JOFA 5KDOB 5HYNB 2IURA 5B4WA 4LGNA 2I3TA 3RN1D 2J55H 2CE8A 3DM0A 2GNQA 1JMXB 3I8EA 2TRCB 1B9YA 3MZLA 2YNOA 3PSCB 4JSVC 5TEEA 4XEIC 4A7JA 2OJYA 4FA9D 4A08B 5JWZA 1L0QA 4J77A 2PBIB 2OVPB 2AGXA 3SN6B 1VYHC 4CZYA 4PXWA 4JT6C 2CNXA 3OTTA 5H1MA 2H13A 2XU7A 3P4FA 4CY1A 2P9NC 2HJBA 4J84A 4U7AA 2UZXB 5EM2B 5GMKn 5C9ZB 2I0SA 4GM3A 3DXKC 4YVDA 4J82A 3EI1A 4E54B 4A0BA 3OW8A 3E0CA 1OMWB 4LG8A 4CY5A 3L4OD 1GXRA 3RSEC 1R5MA 2CO0A 3PVUB 3RMZD 2CE9A 5C2WB 3C99A 3EG6A 1PBYB 4MK0B 5EAPA 5FXYA 4FA5D 2HXCA 1PI6A 2HKMA 3MXXA 4ERZA 1PEVA 3ORVD 4FA1D 5SXMA 5AJAA 3OL2A 4R7AB 2OK4A 3F3PA 3SBPA 4ES0A 5HE0B 3PXTD 2EBSA 4JT5C 3C5MA 4GM9A 1YFQA 3JZHA 4A09A 3FRXA 4X63B 5AFU3 3SBQA 4J86A 4X60B 3AL8A 5FKSA 2AQ5A 2MTAH 1XIPA 2H6NA 3UVMA 5EMLB 5C2VB 3MKQA 3UKRC 1MG2A 2PM6B 3EWEA 1SQ9A 4A0AB 4OWRA 5FLXg 5FKRA 4AOWA 4D0KA 3PXWD 2HYEA 3C75H 4A2MA 5IGQA 3JPXA 5GXHA 4J0XA 3B7FA 3OKYB 4L3HD 5GSAA 3EI2B 4A09B 5FKTA 5CXCB 3UVNA 3V9FA 4I79A 3F3FA 5IT9g 3ZWLB 3N0EA 3A0FA 3NVXA 3SVWD 5EMKB 4JSXC 4PC0A 3SFZA 1JJUB 4Y7RA 4A2LA 3UVKA 4H5JA 1P22A 1SHYB 3IKOA 2AGYA 5IC7A 4CZVA 3SWSD 5CYKA 5TF2A 4ZOVA 2AGZA 4K3JB 5EARA 5TDHB 2H9LA 2AGLA 3RFGA 1MDAH 3I7PA 4K3ID 4FA4D 3SBRA 2BBKH 3EMHA 3BWSA 2G99A 3I7LA 3EI4A 4ERQA 4J73A 2Q7QA 5EMJB 3MKSB 3ODTA 3AH8B 3I2NA 3SHFA 3CFSB 4JSNC 2XYIA 1XHMA 4GGDA 5CYKB 1GG2B 4ERYA 4OZUA 2H14A 2Z2PA 4Z8LA 3JRPA 2H68A 2XL3A 4PSWB 1K8KC 4LG9A 2AH0A 4QT8A 5A2Qg 2OVQB 2P9LC 2IUQA 1PGUA 2P9SC 3I89A 2P9KC 4J8BA 1NEXB 2YNNA 3SXTD 2P9IC 4GQ2P 1S4UX 4QL1A 3J81g 4FWWA 2PM9A 5H17A 4O1QD 3EI1B 2B5MA 3CFVA 4A0BB 2IWKA 5I5JA 3PE7A 2UZYB 3DSMA 4BUJC 5TEFA 2BCJB 4ESGA 2YBAA 3VGZA 1ERJA 2YNPA 4CC9A 4GZ8A 2Z2OA 2H3XA 3FM0A 4U1EI 4FAVD 4O9DA 2J57G 4GMBA 4UI9R 4PBYA 5GXIA 3JZGA 3GFCA 4CI1A 2H9MA 3UR4A 3JAMg 4GQBB 3JROA 4XYHA 2PM9B 2Z2NA 4E5ZA 5CXBA 1U4CA 3UVOA 4J78A 3JZNA 3OL2B 3W15A 4J81A 2H9PA 4IA9A 3I7KA 3EI3A 2J56H 4XYIA 5FQDA 3U4YA 3I7HA 4ZN4A 4O3UB 4J87A 2H6QA 2I0RA 2W18A 3AL8B 4PNKB 3IIWA 3SCYA 1SQJA 5AMSA 1NR0A 4CI3A 3VA6A 1OLZA 2P9UC 1N6DA 2XL2A 3IJ0A 3IJ1A 5CXBB 3DWLC 3N0DA 2B5LA 1Q47A 4X3EA 3NVNA 5K1CC 3RLMD 4FB1D 5EM2A 1QNIA 4PSXB 1GOTB 3EI3B 2QXVA 4HDJA 2B5NA 3FGBA 4E54A 5FA5B 4J0WA 2IAAA 4L3GD 2H6KA 3JB9L 4BH6A 3C9CA 3KRWB 5EAMA 2IUPA 3MMYA 4BL0A 1GP2B 5IJ7E 2P9PC 3RFHA 4FAND 3IJCA 2YMUA 4TZ4A 4GM8A 3GREA 4A11A 3I8CA 3NVQA 4GGAA 2HESX 3DXMC 2IWFA 2GC7A 3EU7A 2HJ4A 3SJLD 2GC4A 3EI4B 3ULEC 1MG3A 3PVWB 5HE1B 3V5WB 2AH1A 5THAA 4X61B 5HE2B 3BG1A 1TBGA 4J8GA 3KRXB 4ZOXA 4O3TB 1K32A 4IMMA 5IJ8E 3SLED 4L1QD 4N14A 5FKQA 2AGWA 5I5MA 3BG0A 5HQGA 3PXSD 3UVLA 4QRJA 3OKWA 2QC5A 1RI6A 1FWXA 4PBZA 1B9XA 3F3GA 5EALA 4A11B 4O45A 2CN2A 4KFMB 5HE3B 2H9NA 3V7DB 1U2VC 3K26A 2IUVA 2I0TA
chains in the Genus database with same CATH superfamily
3AL9A 4A0AA 3OKTA 3K27A 1E5TA 4WK2A 1XKSA 5M5RA 4CY3A 1TYQC 3IUMA 2G9AA 3FCSA 1JMZB 5K19A 3HFQA 3UKUC 3RRMC 5EMMB 3VH0A 3IUQA 3QI0A 4G56B 1L5GA 3I7NA 3IIYA 3CIKB 1UTCA 2B4EA 2PM7B 3OKYA 1A0RB 4CZXA 3I7OA 4Z7NA 3PSLA 3EI2A 4D6VA 4QQEA 5CXCA 4JSPC 3T3MA 4L9OA 4O02A 5FFOA 1H2ZA 2OK6A 2YB8B 4CY2A 4ZOYA 4CI8A 5H14A 1C9LA 2HKRA 2OVRB 4JD2C 4AEZA 4ZOZA 4AMZA 2CN3A 4JXMA 2I3SA 3RN0D 3SMRA 4NSXA 4MMYA 5I5IA 4CI2A 4J79A 1E8MA 2O9KA 2CO0C 2H47A 4FHLA 3MZKA 4A08A 1N6FA 4Y5RD 4EWRA 1GOFA 1N6EA 2OIZA 4GGCA 5IGOA 1E8NA 4GQ1A 4E5ZB 3J80g 4H5IA 3AFCA 3L4MD 4AN1A 1UOOA 5E6RA 4DNVA 1JOFA 3V4PA 3EQ9A 1O6FA 4NBMA 5KDOB 5HYNB 2IURA 5B4WA 4LGNA 1T2XA 2I3TA 3GC3B 3RN1D 3ZE0A 1U8CA 2J55H 2CE8A 3DM0A 2GNQA 1JMXB 3I8EA 2TRCB 1H2YA 3ZDZA 5C92A 1B9YA 3MZLA 2YNOA 3PSCB 4JSVC 5M5TA 5TEEA 4XEIC 2VDPA 4A7JA 2OJYA 3IULA 4FA9D 4A08B 5JWZA 4NC4A 1L0QA 4J77A 2PBIB 2OVPB 2AGXA 3SN6B 1VYHC 3GD1I 4CZYA 4PXWA 4JT6C 2CNXA 3IURA 3OTTA 4DNUA 1I2MB 5H1MA 4G1MA 2H13A 2XU7A 3P4FA 4CY1A 4D9SA 2P9NC 3IUNA 2HJBA 4J84A 4JHNA 4NAAA 4U7AA 4WJKA 2UZXB 5EM2B 5GMKn 5C9ZB 2WQ8A 4JHPC 2I0SA 4GM3A 3DXKC 4YVDA 4J82A 3EI1A 1BPOA 3NIFA 4E54B 4A0BA 3OW8A 4BP9A 3E0CA 1OMWB 4LG8A 4CY5A 3L4OD 1GXRA 3RSEC 1R5MA 2VDNA 2CO0A 3PVUB 3RMZD 2CE9A 5C2WB 2HU7A 3C99A 3EG6A 1PBYB 4G1EA 2QR5A 4MK0B 2BKLA 5EAPA 5FXYA 4FA5D 2HXCA 1PI6A 2HKMA 3MXXA 4ERZA 1VE7A 1PEVA 3ORVD 3FCUA 4FA1D 5SXMA 5AJAA 3OL2A 4R7AB 2OK4A 3F3PA 3SBPA 4ES0A 5HE0B 3PXTD 2EBSA 4JT5C 3C5MA 4DNWA 4GM9A 3EQ7A 1YFQA 3JZHA 4A09A 1O6GA 3FRXA 3ZDXA 4BCDA 4X63B 2HU8A 5AFU3 3SBQA 4J86A 4X60B 3AL8A 4RE6A 5FKSA 2AQ5A 2MTAH 1XIPA 2H6NA 4MMXA 3UVMA 5EMLB 3VI4A 5C2VB 3MKQA 5E6UA 2HU5A 3UKRC 1MG2A 2PM6B 2EICA 4WK0A 3EWEA 1SQ9A 4A0AB 4OWRA 5FLXg 5FKRA 4AOWA 4D0KA 3PXWD 2HYEA 3C75H 4A2MA 1JTDB 3QHYB 3JPXA 5IGQA 5GXHA 4BP8A 4AX4A 4J0XA 3B7FA 3OKYB 4L3HD 5GSAA 3EI2B 2VDRA 4A09B 5FKTA 5CXCB 3UVNA 2VDKA 3V9FA 4I79A 3O4IA 3IVMA 3F3FA 5IT9g 3ZWLB 3N0EA 3A0FA 3EQ8A 3NVXA 3SVWD 5EMKB 4JSXC 3OF7A 4PC0A 3SFZA 1JJUB 4Y7RA 1YR2A 4A2LA 3UVKA 3IKOA 1P22A 1SHYB 2VZ1A 2AGYA 4H5JA 4WK4A 5IC7A 4CZVA 3SWSD 5CYKA 5TF2A 4ZOVA 2AGZA 4K3JB 5EARA 5TDHB 2H9LA 1QFMA 1H2WA 2AGLA 3RFGA 4Z7QA 1MDAH 3I7PA 4K3ID 4FA4D 3SBRA 2BBKH 2XDWA 3EMHA 3BWSA 2G99A 3I7LA 3EI4A 4ERQA 5M61A 4J73A 2Q7QA 5EMJB 3MKSB 3ODTA 3AH8B 3I2NA 3SHFA 3CFSB 4JSNC 3ZDYA 2XYIA 1A12A 1XHMA 4GGDA 5CYKB 2EIBA 1GG2B 4ERYA 4OZUA 2H14A 2Z2PA 4MMZA 4Z8LA 2VDMA 3JRPA 2H68A 3MVDK 2XL3A 3VI3A 4PSWB 1K8KC 1UOQA 4LG9A 2AH0A 4QT8A 3K72A 3DDUA 5A2Qg 2OVQB 3K71A 2P9LC 2EIDA 2IUQA 1PGUA 2P9SC 3I89A 4NENA 2P9KC 4J8BA 1NEXB 2YNNA 3O4GA 3SXTD 3ZE1A 2P9IC 4GQ2P 1S4UX 4QL1A 3J81g 4FWWA 2PM9A 5H17A 4O1QD 3EI1B 2B5MA 3CFVA 4QAMA 4BCBA 4A0BB 2IWKA 5I5JA 3PE7A 2UZYB 3DSMA 4BUJC 5TEFA 1JV2A 2JKXA 2BCJB 4ESGA 2YBAA 3VGZA 1ERJA 2VDLA 2YNPA 4CC9A 4GZ8A 2Z2OA 4AN0A 2H3XA 3FM0A 4U1EI 4FAVD 4O9DA 5M5SA 2J57G 5M5VA 1VE6A 2VDOA 4GMBA 3V4VA 4UI9R 4PBYA 5GXIA 3JZGA 3GFCA 4CI1A 4RE5A 2H9MA 3UR4A 2XZGA 3JAMg 4GQBB 3JROA 4XYHA 2PM9B 2Z2NA 4E5ZA 5E6SA 5M5UA 5CXBA 1U4CA 3UVOA 4J78A 3T3PA 3JZNA 1VZ2A 3NIGA 3OL2B 4L1MA 3K6SA 4UM8A 3W15A 4AMYA 4J81A 2H9PA 4IA9A 3I7KA 3EI3A 2J56H 4XYIA 5FQDA 3U4YA 3MUOA 3I7HA 4ZN4A 4O3UB 4J87A 2H6QA 2I0RA 2W18A 3AL8B 4PNKB 3IIWA 3SCYA 1SQJA 3IJEA 5AMSA 1NR0A 4CI3A 3VA6A 1OLZA 5FFGA 2VZ3A 1H2XA 2P9UC 1UOPA 1N6DA 3O4HA 2XL2A 1QFSA 3IJ0A 3IJ1A 5CXBB 3DWLC 3N0DA 2B5LA 1Q47A 2VDQA 4X3EA 3NVNA 5K1CC 4G55A 3RLMD 2VC2A 4FB1D 5EM2A 1QNIA 3IUJA 4PSXB 1GOTB 3EI3B 2QXVA 3O4JA 4HDJA 2B5NA 3FGBA 2QZPA 4E54A 5FA5B 4J0WA 2IAAA 1M1XA 4L3GD 2H6KA 3JB9L 4BH6A 3C9CA 3KRWB 5EAMA 1K3IA 1GOHA 2IUPA 3MMYA 4BL0A 1GP2B 4BCCA 5IJ7E 2P9PC 3RFHA 4FAND 3IJCA 2YMUA 4TZ4A 4GM8A 1VZ3A 3GREA 4A11A 5HDBA 3I8CA 4UM9A 3NVQA 4GGAA 2HESX 3DXMC 2IWFA 2GC7A 3EU7A 1GOGA 2HJ4A 3SJLD 3ZE2A 2GC4A 3EI4B 3ULEC 1MG3A 3PVWB 5C86A 5HE1B 3KCIA 3V5WB 2AH1A 1TYEA 5THAA 4X61B 5HE2B 3BG1A 1TBGA 4Z7OA 4J8GA 3NIDA 3KRXB 4ZOXA 2XE4A 4O3TB 1K32A 4IMMA 5IJ8E 3SLED 4L1QD 4N14A 5FKQA 2AGWA 5I5MA 3BG0A 5HQGA 3PXSD 3UVLA 3MUNA 4IRZA 3OKWA 2QC5A 4QRJA 1RI6A 1FWXA 4PBZA 1B9XA 3F3GA 2EIEA 5EALA 4A11B 4O45A 2CN2A 4KFMB 1C9IA 5HE3B 2H9NA 3V7DB 1U2VC 3K26A 4O2WA 2IUVA 2I0TA
chains in the Genus database with same CATH topology
3AL9A 4A0AA 3OKTA 3K27A 1XKSA 4CY3A 1TYQC 2G9AA 1JMZB 5K19A 3HFQA 3UKUC 3RRMC 5EMMB 3VH0A 4G56B 3I7NA 3IIYA 3CIKB 2B4EA 2PM7B 3OKYA 1A0RB 4CZXA 3I7OA 3PSLA 3EI2A 4D6VA 4QQEA 5CXCA 4JSPC 4L9OA 2OK6A 2YB8B 4CY2A 4ZOYA 4CI8A 5H14A 4JD2C 2HKRA 2OVRB 4AEZA 4ZOZA 2CN3A 4JXMA 2I3SA 3RN0D 3SMRA 4NSXA 5I5IA 4CI2A 4J79A 2O9KA 2CO0C 2H47A 4FHLA 3MZKA 4A08A 1N6FA 4Y5RD 4EWRA 1N6EA 2OIZA 4GGCA 5IGOA 4GQ1A 4E5ZB 3J80g 4H5IA 3AFCA 3L4MD 1JOFA 5KDOB 5HYNB 2IURA 5B4WA 4LGNA 2I3TA 3RN1D 2J55H 2CE8A 3DM0A 2GNQA 1JMXB 3I8EA 2TRCB 1B9YA 3MZLA 2YNOA 3PSCB 4JSVC 5TEEA 4XEIC 4A7JA 2OJYA 4FA9D 4A08B 5JWZA 1L0QA 4J77A 2PBIB 2OVPB 2AGXA 3SN6B 1VYHC 4CZYA 4PXWA 4JT6C 2CNXA 3OTTA 5H1MA 2H13A 2XU7A 3P4FA 4CY1A 2P9NC 2HJBA 4J84A 4U7AA 2UZXB 5EM2B 5GMKn 5C9ZB 2I0SA 4GM3A 3DXKC 4YVDA 4J82A 3EI1A 4E54B 4A0BA 3OW8A 3E0CA 1OMWB 4LG8A 4CY5A 3L4OD 1GXRA 3RSEC 1R5MA 2CO0A 3PVUB 3RMZD 2CE9A 5C2WB 3C99A 3EG6A 1PBYB 4MK0B 5EAPA 5FXYA 4FA5D 2HXCA 1PI6A 2HKMA 3MXXA 4ERZA 1PEVA 3ORVD 4FA1D 5SXMA 5AJAA 3OL2A 4R7AB 2OK4A 3F3PA 3SBPA 4ES0A 5HE0B 3PXTD 2EBSA 4JT5C 3C5MA 4GM9A 1YFQA 3JZHA 4A09A 3FRXA 4X63B 5AFU3 3SBQA 4J86A 4X60B 3AL8A 5FKSA 2AQ5A 2MTAH 1XIPA 2H6NA 3UVMA 5EMLB 5C2VB 3MKQA 3UKRC 1MG2A 2PM6B 3EWEA 1SQ9A 4A0AB 4OWRA 5FLXg 5FKRA 4AOWA 4D0KA 3PXWD 2HYEA 3C75H 4A2MA 5IGQA 3JPXA 5GXHA 4J0XA 3B7FA 3OKYB 4L3HD 5GSAA 3EI2B 4A09B 5FKTA 5CXCB 3UVNA 3V9FA 4I79A 3F3FA 5IT9g 3ZWLB 3N0EA 3A0FA 3NVXA 3SVWD 5EMKB 4JSXC 4PC0A 3SFZA 1JJUB 4Y7RA 4A2LA 3UVKA 4H5JA 1P22A 1SHYB 3IKOA 2AGYA 5IC7A 4CZVA 3SWSD 5CYKA 5TF2A 4ZOVA 2AGZA 4K3JB 5EARA 5TDHB 2H9LA 2AGLA 3RFGA 1MDAH 3I7PA 4K3ID 4FA4D 3SBRA 2BBKH 3EMHA 3BWSA 2G99A 3I7LA 3EI4A 4ERQA 4J73A 2Q7QA 5EMJB 3MKSB 3ODTA 3AH8B 3I2NA 3SHFA 3CFSB 4JSNC 2XYIA 1XHMA 4GGDA 5CYKB 1GG2B 4ERYA 4OZUA 2H14A 2Z2PA 4Z8LA 3JRPA 2H68A 2XL3A 4PSWB 1K8KC 4LG9A 2AH0A 4QT8A 5A2Qg 2OVQB 2P9LC 2IUQA 1PGUA 2P9SC 3I89A 2P9KC 4J8BA 1NEXB 2YNNA 3SXTD 2P9IC 4GQ2P 1S4UX 4QL1A 3J81g 4FWWA 2PM9A 5H17A 4O1QD 3EI1B 2B5MA 3CFVA 4A0BB 2IWKA 5I5JA 3PE7A 2UZYB 3DSMA 4BUJC 5TEFA 2BCJB 4ESGA 2YBAA 3VGZA 1ERJA 2YNPA 4CC9A 4GZ8A 2Z2OA 2H3XA 3FM0A 4U1EI 4FAVD 4O9DA 2J57G 4GMBA 4UI9R 4PBYA 5GXIA 3JZGA 3GFCA 4CI1A 2H9MA 3UR4A 3JAMg 4GQBB 3JROA 4XYHA 2PM9B 2Z2NA 4E5ZA 5CXBA 1U4CA 3UVOA 4J78A 3JZNA 3OL2B 3W15A 4J81A 2H9PA 4IA9A 3I7KA 3EI3A 2J56H 4XYIA 5FQDA 3U4YA 3I7HA 4ZN4A 4O3UB 4J87A 2H6QA 2I0RA 2W18A 3AL8B 4PNKB 3IIWA 3SCYA 1SQJA 5AMSA 1NR0A 4CI3A 3VA6A 1OLZA 2P9UC 1N6DA 2XL2A 3IJ0A 3IJ1A 5CXBB 3DWLC 3N0DA 2B5LA 1Q47A 4X3EA 3NVNA 5K1CC 3RLMD 4FB1D 5EM2A 1QNIA 4PSXB 1GOTB 3EI3B 2QXVA 4HDJA 2B5NA 3FGBA 4E54A 5FA5B 4J0WA 2IAAA 4L3GD 2H6KA 3JB9L 4BH6A 3C9CA 3KRWB 5EAMA 2IUPA 3MMYA 4BL0A 1GP2B 5IJ7E 2P9PC 3RFHA 4FAND 3IJCA 2YMUA 4TZ4A 4GM8A 3GREA 4A11A 3I8CA 3NVQA 4GGAA 2HESX 3DXMC 2IWFA 2GC7A 3EU7A 2HJ4A 3SJLD 2GC4A 3EI4B 3ULEC 1MG3A 3PVWB 5HE1B 3V5WB 2AH1A 5THAA 4X61B 5HE2B 3BG1A 1TBGA 4J8GA 3KRXB 4ZOXA 4O3TB 1K32A 4IMMA 5IJ8E 3SLED 4L1QD 4N14A 5FKQA 2AGWA 5I5MA 3BG0A 5HQGA 3PXSD 3UVLA 4QRJA 3OKWA 2QC5A 1RI6A 1FWXA 4PBZA 1B9XA 3F3GA 5EALA 4A11B 4O45A 2CN2A 4KFMB 5HE3B 2H9NA 3V7DB 1U2VC 3K26A 2IUVA 2I0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL9 A;  4A0A A;  3OKT A;  3K27 A;  1XKS A;  4CY3 A;  1TYQ C;  2G9A A;  1JMZ B;  5K19 A;  3HFQ A;  3UKU C;  3RRM C;  5EMM B;  3VH0 A;  4G56 B;  3I7N A;  3IIY A;  3CIK B;  2B4E A;  2PM7 B;  3OKY A;  1A0R B;  4CZX A;  3I7O A;  3PSL A;  3EI2 A;  4D6V A;  4QQE A;  5CXC A;  4JSP C;  4L9O A;  2OK6 A;  2YB8 B;  4CY2 A;  4ZOY A;  4CI8 A;  5H14 A;  4JD2 C;  2HKR A;  2OVR B;  4AEZ A;  4ZOZ A;  2CN3 A;  4JXM A;  2I3S A;  3RN0 D;  3SMR A;  4NSX A;  5I5I A;  4CI2 A;  4J79 A;  2O9K A;  2CO0 C;  2H47 A;  4FHL A;  3MZK A;  4A08 A;  1N6F A;  4Y5R D;  4EWR A;  1N6E A;  2OIZ A;  4GGC A;  5IGO A;  4GQ1 A;  4E5Z B;  3J80 g;  4H5I A;  3AFC A;  3L4M D;  1JOF A;  5KDO B;  5HYN B;  2IUR A;  5B4W A;  4LGN A;  2I3T A;  3RN1 D;  2J55 H;  2CE8 A;  3DM0 A;  2GNQ A;  1JMX B;  3I8E A;  2TRC B;  1B9Y A;  3MZL A;  2YNO A;  3PSC B;  4JSV C;  5TEE A;  4XEI C;  4A7J A;  2OJY A;  4FA9 D;  4A08 B;  5JWZ A;  1L0Q A;  4J77 A;  2PBI B;  2OVP B;  2AGX A;  3SN6 B;  1VYH C;  4CZY A;  4PXW A;  4JT6 C;  2CNX A;  3OTT A;  5H1M A;  2H13 A;  2XU7 A;  3P4F A;  4CY1 A;  2P9N C;  2HJB A;  4J84 A;  4U7A A;  2UZX B;  5EM2 B;  5GMK n;  5C9Z B;  2I0S A;  4GM3 A;  3DXK C;  4YVD A;  4J82 A;  3EI1 A;  4E54 B;  4A0B A;  3OW8 A;  3E0C A;  1OMW B;  4LG8 A;  4CY5 A;  3L4O D;  1GXR A;  3RSE C;  1R5M A;  2CO0 A;  3PVU B;  3RMZ D;  2CE9 A;  5C2W B;  3C99 A;  3EG6 A;  1PBY B;  4MK0 B;  5EAP A;  5FXY A;  4FA5 D;  2HXC A;  1PI6 A;  2HKM A;  3MXX A;  4ERZ A;  1PEV A;  3ORV D;  4FA1 D;  5SXM A;  5AJA A;  3OL2 A;  4R7A B;  2OK4 A;  3F3P A;  3SBP A;  4ES0 A;  5HE0 B;  3PXT D;  2EBS A;  4JT5 C;  3C5M A;  4GM9 A;  1YFQ A;  3JZH A;  4A09 A;  3FRX A;  4X63 B;  5AFU 3;  3SBQ A;  4J86 A;  4X60 B;  3AL8 A;  5FKS A;  2AQ5 A;  2MTA H;  1XIP A;  2H6N A;  3UVM A;  5EML B;  5C2V B;  3MKQ A;  3UKR C;  1MG2 A;  2PM6 B;  3EWE A;  1SQ9 A;  4A0A B;  4OWR A;  5FLX g;  5FKR A;  4AOW A;  4D0K A;  3PXW D;  2HYE A;  3C75 H;  4A2M A;  5IGQ A;  3JPX A;  5GXH A;  4J0X A;  3B7F A;  3OKY B;  4L3H D;  5GSA A;  3EI2 B;  4A09 B;  5FKT A;  5CXC B;  3UVN A;  3V9F A;  4I79 A;  3F3F A;  5IT9 g;  3ZWL B;  3N0E A;  3A0F A;  3NVX A;  3SVW D;  5EMK B;  4JSX C;  4PC0 A;  3SFZ A;  1JJU B;  4Y7R A;  4A2L A;  3UVK A;  4H5J A;  1P22 A;  1SHY B;  3IKO A;  2AGY A;  5IC7 A;  4CZV A;  3SWS D;  5CYK A;  5TF2 A;  4ZOV A;  2AGZ A;  4K3J B;  5EAR A;  5TDH B;  2H9L A;  2AGL A;  3RFG A;  1MDA H;  3I7P A;  4K3I D;  4FA4 D;  3SBR A;  2BBK H;  3EMH A;  3BWS A;  2G99 A;  3I7L A;  3EI4 A;  4ERQ A;  4J73 A;  2Q7Q A;  5EMJ B;  3MKS B;  3ODT A;  3AH8 B;  3I2N A;  3SHF A;  3CFS B;  4JSN C;  2XYI A;  1XHM A;  4GGD A;  5CYK B;  1GG2 B;  4ERY A;  4OZU A;  2H14 A;  2Z2P A;  4Z8L A;  3JRP A;  2H68 A;  2XL3 A;  4PSW B;  1K8K C;  4LG9 A;  2AH0 A;  4QT8 A;  5A2Q g;  2OVQ B;  2P9L C;  2IUQ A;  1PGU A;  2P9S C;  3I89 A;  2P9K C;  4J8B A;  1NEX B;  2YNN A;  3SXT D;  2P9I C;  4GQ2 P;  1S4U X;  4QL1 A;  3J81 g;  4FWW A;  2PM9 A;  5H17 A;  4O1Q D;  3EI1 B;  2B5M A;  3CFV A;  4A0B B;  2IWK A;  5I5J A;  3PE7 A;  2UZY B;  3DSM A;  4BUJ C;  5TEF A;  2BCJ B;  4ESG A;  2YBA A;  3VGZ A;  1ERJ A;  2YNP A;  4CC9 A;  4GZ8 A;  2Z2O A;  2H3X A;  3FM0 A;  4U1E I;  4FAV D;  4O9D A;  2J57 G;  4GMB A;  4UI9 R;  4PBY A;  5GXI A;  3JZG A;  3GFC A;  4CI1 A;  2H9M A;  3UR4 A;  3JAM g;  4GQB B;  3JRO A;  4XYH A;  2PM9 B;  2Z2N A;  4E5Z A;  5CXB A;  1U4C A;  3UVO A;  4J78 A;  3JZN A;  3OL2 B;  3W15 A;  4J81 A;  2H9P A;  4IA9 A;  3I7K A;  3EI3 A;  2J56 H;  4XYI A;  5FQD A;  3U4Y A;  3I7H A;  4ZN4 A;  4O3U B;  4J87 A;  2H6Q A;  2I0R A;  2W18 A;  3AL8 B;  4PNK B;  3IIW A;  3SCY A;  1SQJ A;  5AMS A;  1NR0 A;  4CI3 A;  3VA6 A;  1OLZ A;  2P9U C;  1N6D A;  2XL2 A;  3IJ0 A;  3IJ1 A;  5CXB B;  3DWL C;  3N0D A;  2B5L A;  1Q47 A;  4X3E A;  3NVN A;  5K1C C;  3RLM D;  4FB1 D;  5EM2 A;  1QNI A;  4PSX B;  1GOT B;  3EI3 B;  2QXV A;  4HDJ A;  2B5N A;  3FGB A;  4E54 A;  5FA5 B;  4J0W A;  2IAA A;  4L3G D;  2H6K A;  3JB9 L;  4BH6 A;  3C9C A;  3KRW B;  5EAM A;  2IUP A;  3MMY A;  4BL0 A;  1GP2 B;  5IJ7 E;  2P9P C;  3RFH A;  4FAN D;  3IJC A;  2YMU A;  4TZ4 A;  4GM8 A;  3GRE A;  4A11 A;  3I8C A;  3NVQ A;  4GGA A;  2HES X;  3DXM C;  2IWF A;  2GC7 A;  3EU7 A;  2HJ4 A;  3SJL D;  2GC4 A;  3EI4 B;  3ULE C;  1MG3 A;  3PVW B;  5HE1 B;  3V5W B;  2AH1 A;  5THA A;  4X61 B;  5HE2 B;  3BG1 A;  1TBG A;  4J8G A;  3KRX B;  4ZOX A;  4O3T B;  1K32 A;  4IMM A;  5IJ8 E;  3SLE D;  4L1Q D;  4N14 A;  5FKQ A;  2AGW A;  5I5M A;  3BG0 A;  5HQG A;  3PXS D;  3UVL A;  4QRJ A;  3OKW A;  2QC5 A;  1RI6 A;  1FWX A;  4PBZ A;  1B9X A;  3F3G A;  5EAL A;  4A11 B;  4O45 A;  2CN2 A;  4KFM B;  5HE3 B;  2H9N A;  3V7D B;  1U2V C;  3K26 A;  2IUV A;  2I0T A; 
#chains in the Genus database with same CATH topology
 3AL9 A;  4A0A A;  3OKT A;  3K27 A;  1E5T A;  4WK2 A;  1XKS A;  5M5R A;  4CY3 A;  1TYQ C;  3IUM A;  2G9A A;  3FCS A;  1JMZ B;  5K19 A;  3HFQ A;  3UKU C;  3RRM C;  5EMM B;  3VH0 A;  3IUQ A;  3QI0 A;  4G56 B;  1L5G A;  3I7N A;  3IIY A;  3CIK B;  1UTC A;  2B4E A;  2PM7 B;  3OKY A;  1A0R B;  4CZX A;  3I7O A;  4Z7N A;  3PSL A;  3EI2 A;  4D6V A;  4QQE A;  5CXC A;  4JSP C;  3T3M A;  4L9O A;  4O02 A;  5FFO A;  1H2Z A;  2OK6 A;  2YB8 B;  4CY2 A;  4ZOY A;  4CI8 A;  5H14 A;  1C9L A;  2HKR A;  2OVR B;  4JD2 C;  4AEZ A;  4ZOZ A;  4AMZ A;  2CN3 A;  4JXM A;  2I3S A;  3RN0 D;  3SMR A;  4NSX A;  4MMY A;  5I5I A;  4CI2 A;  4J79 A;  1E8M A;  2O9K A;  2CO0 C;  2H47 A;  4FHL A;  3MZK A;  4A08 A;  1N6F A;  4Y5R D;  4EWR A;  1GOF A;  1N6E A;  2OIZ A;  4GGC A;  5IGO A;  1E8N A;  4GQ1 A;  4E5Z B;  3J80 g;  4H5I A;  3AFC A;  3L4M D;  4AN1 A;  1UOO A;  5E6R A;  4DNV A;  1JOF A;  3V4P A;  3EQ9 A;  1O6F A;  4NBM A;  5KDO B;  5HYN B;  2IUR A;  5B4W A;  4LGN A;  1T2X A;  2I3T A;  3GC3 B;  3RN1 D;  3ZE0 A;  1U8C A;  2J55 H;  2CE8 A;  3DM0 A;  2GNQ A;  1JMX B;  3I8E A;  2TRC B;  1H2Y A;  3ZDZ A;  5C92 A;  1B9Y A;  3MZL A;  2YNO A;  3PSC B;  4JSV C;  5M5T A;  5TEE A;  4XEI C;  2VDP A;  4A7J A;  2OJY A;  3IUL A;  4FA9 D;  4A08 B;  5JWZ A;  4NC4 A;  1L0Q A;  4J77 A;  2PBI B;  2OVP B;  2AGX A;  3SN6 B;  1VYH C;  3GD1 I;  4CZY A;  4PXW A;  4JT6 C;  2CNX A;  3IUR A;  3OTT A;  4DNU A;  1I2M B;  5H1M A;  4G1M A;  2H13 A;  2XU7 A;  3P4F A;  4CY1 A;  4D9S A;  2P9N C;  3IUN A;  2HJB A;  4J84 A;  4JHN A;  4NAA A;  4U7A A;  4WJK A;  2UZX B;  5EM2 B;  5GMK n;  5C9Z B;  2WQ8 A;  4JHP C;  2I0S A;  4GM3 A;  3DXK C;  4YVD A;  4J82 A;  3EI1 A;  1BPO A;  3NIF A;  4E54 B;  4A0B A;  3OW8 A;  4BP9 A;  3E0C A;  1OMW B;  4LG8 A;  4CY5 A;  3L4O D;  1GXR A;  3RSE C;  1R5M A;  2VDN A;  2CO0 A;  3PVU B;  3RMZ D;  2CE9 A;  5C2W B;  2HU7 A;  3C99 A;  3EG6 A;  1PBY B;  4G1E A;  2QR5 A;  4MK0 B;  2BKL A;  5EAP A;  5FXY A;  4FA5 D;  2HXC A;  1PI6 A;  2HKM A;  3MXX A;  4ERZ A;  1VE7 A;  1PEV A;  3ORV D;  3FCU A;  4FA1 D;  5SXM A;  5AJA A;  3OL2 A;  4R7A B;  2OK4 A;  3F3P A;  3SBP A;  4ES0 A;  5HE0 B;  3PXT D;  2EBS A;  4JT5 C;  3C5M A;  4DNW A;  4GM9 A;  3EQ7 A;  1YFQ A;  3JZH A;  4A09 A;  1O6G A;  3FRX A;  3ZDX A;  4BCD A;  4X63 B;  2HU8 A;  5AFU 3;  3SBQ A;  4J86 A;  4X60 B;  3AL8 A;  4RE6 A;  5FKS A;  2AQ5 A;  2MTA H;  1XIP A;  2H6N A;  4MMX A;  3UVM A;  5EML B;  3VI4 A;  5C2V B;  3MKQ A;  5E6U A;  2HU5 A;  3UKR C;  1MG2 A;  2PM6 B;  2EIC A;  4WK0 A;  3EWE A;  1SQ9 A;  4A0A B;  4OWR A;  5FLX g;  5FKR A;  4AOW A;  4D0K A;  3PXW D;  2HYE A;  3C75 H;  4A2M A;  1JTD B;  3QHY B;  3JPX A;  5IGQ A;  5GXH A;  4BP8 A;  4AX4 A;  4J0X A;  3B7F A;  3OKY B;  4L3H D;  5GSA A;  3EI2 B;  2VDR A;  4A09 B;  5FKT A;  5CXC B;  3UVN A;  2VDK A;  3V9F A;  4I79 A;  3O4I A;  3IVM A;  3F3F A;  5IT9 g;  3ZWL B;  3N0E A;  3A0F A;  3EQ8 A;  3NVX A;  3SVW D;  5EMK B;  4JSX C;  3OF7 A;  4PC0 A;  3SFZ A;  1JJU B;  4Y7R A;  1YR2 A;  4A2L A;  3UVK A;  3IKO A;  1P22 A;  1SHY B;  2VZ1 A;  2AGY A;  4H5J A;  4WK4 A;  5IC7 A;  4CZV A;  3SWS D;  5CYK A;  5TF2 A;  4ZOV A;  2AGZ A;  4K3J B;  5EAR A;  5TDH B;  2H9L A;  1QFM A;  1H2W A;  2AGL A;  3RFG A;  4Z7Q A;  1MDA H;  3I7P A;  4K3I D;  4FA4 D;  3SBR A;  2BBK H;  2XDW A;  3EMH A;  3BWS A;  2G99 A;  3I7L A;  3EI4 A;  4ERQ A;  5M61 A;  4J73 A;  2Q7Q A;  5EMJ B;  3MKS B;  3ODT A;  3AH8 B;  3I2N A;  3SHF A;  3CFS B;  4JSN C;  3ZDY A;  2XYI A;  1A12 A;  1XHM A;  4GGD A;  5CYK B;  2EIB A;  1GG2 B;  4ERY A;  4OZU A;  2H14 A;  2Z2P A;  4MMZ A;  4Z8L A;  2VDM A;  3JRP A;  2H68 A;  3MVD K;  2XL3 A;  3VI3 A;  4PSW B;  1K8K C;  1UOQ A;  4LG9 A;  2AH0 A;  4QT8 A;  3K72 A;  3DDU A;  5A2Q g;  2OVQ B;  3K71 A;  2P9L C;  2EID A;  2IUQ A;  1PGU A;  2P9S C;  3I89 A;  4NEN A;  2P9K C;  4J8B A;  1NEX B;  2YNN A;  3O4G A;  3SXT D;  3ZE1 A;  2P9I C;  4GQ2 P;  1S4U X;  4QL1 A;  3J81 g;  4FWW A;  2PM9 A;  5H17 A;  4O1Q D;  3EI1 B;  2B5M A;  3CFV A;  4QAM A;  4BCB A;  4A0B B;  2IWK A;  5I5J A;  3PE7 A;  2UZY B;  3DSM A;  4BUJ C;  5TEF A;  1JV2 A;  2JKX A;  2BCJ B;  4ESG A;  2YBA A;  3VGZ A;  1ERJ A;  2VDL A;  2YNP A;  4CC9 A;  4GZ8 A;  2Z2O A;  4AN0 A;  2H3X A;  3FM0 A;  4U1E I;  4FAV D;  4O9D A;  5M5S A;  2J57 G;  5M5V A;  1VE6 A;  2VDO A;  4GMB A;  3V4V A;  4UI9 R;  4PBY A;  5GXI A;  3JZG A;  3GFC A;  4CI1 A;  4RE5 A;  2H9M A;  3UR4 A;  2XZG A;  3JAM g;  4GQB B;  3JRO A;  4XYH A;  2PM9 B;  2Z2N A;  4E5Z A;  5E6S A;  5M5U A;  5CXB A;  1U4C A;  3UVO A;  4J78 A;  3T3P A;  3JZN A;  1VZ2 A;  3NIG A;  3OL2 B;  4L1M A;  3K6S A;  4UM8 A;  3W15 A;  4AMY A;  4J81 A;  2H9P A;  4IA9 A;  3I7K A;  3EI3 A;  2J56 H;  4XYI A;  5FQD A;  3U4Y A;  3MUO A;  3I7H A;  4ZN4 A;  4O3U B;  4J87 A;  2H6Q A;  2I0R A;  2W18 A;  3AL8 B;  4PNK B;  3IIW A;  3SCY A;  1SQJ A;  3IJE A;  5AMS A;  1NR0 A;  4CI3 A;  3VA6 A;  1OLZ A;  5FFG A;  2VZ3 A;  1H2X A;  2P9U C;  1UOP A;  1N6D A;  3O4H A;  2XL2 A;  1QFS A;  3IJ0 A;  3IJ1 A;  5CXB B;  3DWL C;  3N0D A;  2B5L A;  1Q47 A;  2VDQ A;  4X3E A;  3NVN A;  5K1C C;  4G55 A;  3RLM D;  2VC2 A;  4FB1 D;  5EM2 A;  1QNI A;  3IUJ A;  4PSX B;  1GOT B;  3EI3 B;  2QXV A;  3O4J A;  4HDJ A;  2B5N A;  3FGB A;  2QZP A;  4E54 A;  5FA5 B;  4J0W A;  2IAA A;  1M1X A;  4L3G D;  2H6K A;  3JB9 L;  4BH6 A;  3C9C A;  3KRW B;  5EAM A;  1K3I A;  1GOH A;  2IUP A;  3MMY A;  4BL0 A;  1GP2 B;  4BCC A;  5IJ7 E;  2P9P C;  3RFH A;  4FAN D;  3IJC A;  2YMU A;  4TZ4 A;  4GM8 A;  1VZ3 A;  3GRE A;  4A11 A;  5HDB A;  3I8C A;  4UM9 A;  3NVQ A;  4GGA A;  2HES X;  3DXM C;  2IWF A;  2GC7 A;  3EU7 A;  1GOG A;  2HJ4 A;  3SJL D;  3ZE2 A;  2GC4 A;  3EI4 B;  3ULE C;  1MG3 A;  3PVW B;  5C86 A;  5HE1 B;  3KCI A;  3V5W B;  2AH1 A;  1TYE A;  5THA A;  4X61 B;  5HE2 B;  3BG1 A;  1TBG A;  4Z7O A;  4J8G A;  3NID A;  3KRX B;  4ZOX A;  2XE4 A;  4O3T B;  1K32 A;  4IMM A;  5IJ8 E;  3SLE D;  4L1Q D;  4N14 A;  5FKQ A;  2AGW A;  5I5M A;  3BG0 A;  5HQG A;  3PXS D;  3UVL A;  3MUN A;  4IRZ A;  3OKW A;  2QC5 A;  4QRJ A;  1RI6 A;  1FWX A;  4PBZ A;  1B9X A;  3F3G A;  2EIE A;  5EAL A;  4A11 B;  4O45 A;  2CN2 A;  4KFM B;  1C9I A;  5HE3 B;  2H9N A;  3V7D B;  1U2V C;  3K26 A;  4O2W A;  2IUV A;  2I0T A; 
#chains in the Genus database with same CATH homology
 3AL9 A;  4A0A A;  3OKT A;  3K27 A;  1XKS A;  4CY3 A;  1TYQ C;  2G9A A;  1JMZ B;  5K19 A;  3HFQ A;  3UKU C;  3RRM C;  5EMM B;  3VH0 A;  4G56 B;  3I7N A;  3IIY A;  3CIK B;  2B4E A;  2PM7 B;  3OKY A;  1A0R B;  4CZX A;  3I7O A;  3PSL A;  3EI2 A;  4D6V A;  4QQE A;  5CXC A;  4JSP C;  4L9O A;  2OK6 A;  2YB8 B;  4CY2 A;  4ZOY A;  4CI8 A;  5H14 A;  4JD2 C;  2HKR A;  2OVR B;  4AEZ A;  4ZOZ A;  2CN3 A;  4JXM A;  2I3S A;  3RN0 D;  3SMR A;  4NSX A;  5I5I A;  4CI2 A;  4J79 A;  2O9K A;  2CO0 C;  2H47 A;  4FHL A;  3MZK A;  4A08 A;  1N6F A;  4Y5R D;  4EWR A;  1N6E A;  2OIZ A;  4GGC A;  5IGO A;  4GQ1 A;  4E5Z B;  3J80 g;  4H5I A;  3AFC A;  3L4M D;  1JOF A;  5KDO B;  5HYN B;  2IUR A;  5B4W A;  4LGN A;  2I3T A;  3RN1 D;  2J55 H;  2CE8 A;  3DM0 A;  2GNQ A;  1JMX B;  3I8E A;  2TRC B;  1B9Y A;  3MZL A;  2YNO A;  3PSC B;  4JSV C;  5TEE A;  4XEI C;  4A7J A;  2OJY A;  4FA9 D;  4A08 B;  5JWZ A;  1L0Q A;  4J77 A;  2PBI B;  2OVP B;  2AGX A;  3SN6 B;  1VYH C;  4CZY A;  4PXW A;  4JT6 C;  2CNX A;  3OTT A;  5H1M A;  2H13 A;  2XU7 A;  3P4F A;  4CY1 A;  2P9N C;  2HJB A;  4J84 A;  4U7A A;  2UZX B;  5EM2 B;  5GMK n;  5C9Z B;  2I0S A;  4GM3 A;  3DXK C;  4YVD A;  4J82 A;  3EI1 A;  4E54 B;  4A0B A;  3OW8 A;  3E0C A;  1OMW B;  4LG8 A;  4CY5 A;  3L4O D;  1GXR A;  3RSE C;  1R5M A;  2CO0 A;  3PVU B;  3RMZ D;  2CE9 A;  5C2W B;  3C99 A;  3EG6 A;  1PBY B;  4MK0 B;  5EAP A;  5FXY A;  4FA5 D;  2HXC A;  1PI6 A;  2HKM A;  3MXX A;  4ERZ A;  1PEV A;  3ORV D;  4FA1 D;  5SXM A;  5AJA A;  3OL2 A;  4R7A B;  2OK4 A;  3F3P A;  3SBP A;  4ES0 A;  5HE0 B;  3PXT D;  2EBS A;  4JT5 C;  3C5M A;  4GM9 A;  1YFQ A;  3JZH A;  4A09 A;  3FRX A;  4X63 B;  5AFU 3;  3SBQ A;  4J86 A;  4X60 B;  3AL8 A;  5FKS A;  2AQ5 A;  2MTA H;  1XIP A;  2H6N A;  3UVM A;  5EML B;  5C2V B;  3MKQ A;  3UKR C;  1MG2 A;  2PM6 B;  3EWE A;  1SQ9 A;  4A0A B;  4OWR A;  5FLX g;  5FKR A;  4AOW A;  4D0K A;  3PXW D;  2HYE A;  3C75 H;  4A2M A;  5IGQ A;  3JPX A;  5GXH A;  4J0X A;  3B7F A;  3OKY B;  4L3H D;  5GSA A;  3EI2 B;  4A09 B;  5FKT A;  5CXC B;  3UVN A;  3V9F A;  4I79 A;  3F3F A;  5IT9 g;  3ZWL B;  3N0E A;  3A0F A;  3NVX A;  3SVW D;  5EMK B;  4JSX C;  4PC0 A;  3SFZ A;  1JJU B;  4Y7R A;  4A2L A;  3UVK A;  4H5J A;  1P22 A;  1SHY B;  3IKO A;  2AGY A;  5IC7 A;  4CZV A;  3SWS D;  5CYK A;  5TF2 A;  4ZOV A;  2AGZ A;  4K3J B;  5EAR A;  5TDH B;  2H9L A;  2AGL A;  3RFG A;  1MDA H;  3I7P A;  4K3I D;  4FA4 D;  3SBR A;  2BBK H;  3EMH A;  3BWS A;  2G99 A;  3I7L A;  3EI4 A;  4ERQ A;  4J73 A;  2Q7Q A;  5EMJ B;  3MKS B;  3ODT A;  3AH8 B;  3I2N A;  3SHF A;  3CFS B;  4JSN C;  2XYI A;  1XHM A;  4GGD A;  5CYK B;  1GG2 B;  4ERY A;  4OZU A;  2H14 A;  2Z2P A;  4Z8L A;  3JRP A;  2H68 A;  2XL3 A;  4PSW B;  1K8K C;  4LG9 A;  2AH0 A;  4QT8 A;  5A2Q g;  2OVQ B;  2P9L C;  2IUQ A;  1PGU A;  2P9S C;  3I89 A;  2P9K C;  4J8B A;  1NEX B;  2YNN A;  3SXT D;  2P9I C;  4GQ2 P;  1S4U X;  4QL1 A;  3J81 g;  4FWW A;  2PM9 A;  5H17 A;  4O1Q D;  3EI1 B;  2B5M A;  3CFV A;  4A0B B;  2IWK A;  5I5J A;  3PE7 A;  2UZY B;  3DSM A;  4BUJ C;  5TEF A;  2BCJ B;  4ESG A;  2YBA A;  3VGZ A;  1ERJ A;  2YNP A;  4CC9 A;  4GZ8 A;  2Z2O A;  2H3X A;  3FM0 A;  4U1E I;  4FAV D;  4O9D A;  2J57 G;  4GMB A;  4UI9 R;  4PBY A;  5GXI A;  3JZG A;  3GFC A;  4CI1 A;  2H9M A;  3UR4 A;  3JAM g;  4GQB B;  3JRO A;  4XYH A;  2PM9 B;  2Z2N A;  4E5Z A;  5CXB A;  1U4C A;  3UVO A;  4J78 A;  3JZN A;  3OL2 B;  3W15 A;  4J81 A;  2H9P A;  4IA9 A;  3I7K A;  3EI3 A;  2J56 H;  4XYI A;  5FQD A;  3U4Y A;  3I7H A;  4ZN4 A;  4O3U B;  4J87 A;  2H6Q A;  2I0R A;  2W18 A;  3AL8 B;  4PNK B;  3IIW A;  3SCY A;  1SQJ A;  5AMS A;  1NR0 A;  4CI3 A;  3VA6 A;  1OLZ A;  2P9U C;  1N6D A;  2XL2 A;  3IJ0 A;  3IJ1 A;  5CXB B;  3DWL C;  3N0D A;  2B5L A;  1Q47 A;  4X3E A;  3NVN A;  5K1C C;  3RLM D;  4FB1 D;  5EM2 A;  1QNI A;  4PSX B;  1GOT B;  3EI3 B;  2QXV A;  4HDJ A;  2B5N A;  3FGB A;  4E54 A;  5FA5 B;  4J0W A;  2IAA A;  4L3G D;  2H6K A;  3JB9 L;  4BH6 A;  3C9C A;  3KRW B;  5EAM A;  2IUP A;  3MMY A;  4BL0 A;  1GP2 B;  5IJ7 E;  2P9P C;  3RFH A;  4FAN D;  3IJC A;  2YMU A;  4TZ4 A;  4GM8 A;  3GRE A;  4A11 A;  3I8C A;  3NVQ A;  4GGA A;  2HES X;  3DXM C;  2IWF A;  2GC7 A;  3EU7 A;  2HJ4 A;  3SJL D;  2GC4 A;  3EI4 B;  3ULE C;  1MG3 A;  3PVW B;  5HE1 B;  3V5W B;  2AH1 A;  5THA A;  4X61 B;  5HE2 B;  3BG1 A;  1TBG A;  4J8G A;  3KRX B;  4ZOX A;  4O3T B;  1K32 A;  4IMM A;  5IJ8 E;  3SLE D;  4L1Q D;  4N14 A;  5FKQ A;  2AGW A;  5I5M A;  3BG0 A;  5HQG A;  3PXS D;  3UVL A;  4QRJ A;  3OKW A;  2QC5 A;  1RI6 A;  1FWX A;  4PBZ A;  1B9X A;  3F3G A;  5EAL A;  4A11 B;  4O45 A;  2CN2 A;  4KFM B;  5HE3 B;  2H9N A;  3V7D B;  1U2V C;  3K26 A;  2IUV A;  2I0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...