2HJBA

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
358
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 92
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hjbA01
3ULEC 5EM2B 2PM9B 1N6DA 5IT9g 4CZXA 3SHFA 5EMKB 3V7DB 4LGNA 2IUQA 5FKTA 4Y5RD 5EAMA 4MK0B 4E5ZA 1XIPA 2I0SA 5GSAA 5KDOB 4ZOYA 4LG8A 1TBGA 3UVKA 2TRCB 2H6KA 2P9UC 4GM3A 2AGZA 3JZHA 2CE8A 4A0BB 4CI8A 4L1QD 4ZOVA 4J82A 2O9KA 4N14A 3BG0A 5EMMB 2AH1A 2HYEA 4NSXA 2H9LA 3PVWB 2I3SA 3UVMA 3RN1D 3I89A 2H9NA 3A0FA 4ES0A 3PXSD 4ZOZA 4K3ID 2BCJB 5HYNB 3SBQA 3VGZA 5C9ZB 4ZN4A 4EWRA 4A0AB 2IUPA 2UZYB 3SN6B 2H13A 1R5MA 4A11A 5IC7A 4PC0A 3EWEA 2OK4A 4GM9A 4O1QD 1OLZA 3CIKB 3EG6A 5HE3B 4GQ1A 2AQ5A 1XHMA 2H3XA 4L9OA 3SWSD 4X61B 3OL2A 3RMZD 2YNOA 3ZWLB 3MKQA 3OKYA 4CZVA 3V9FA 4CI1A 3JRPA 3N0DA 3C5MA 3NVQA 2QC5A 4A2LA 3AFCA 3AH8B 3AL9A 2HKMA 4JSNC 3RN0D 2OVRB 3I7LA 4X63B 3FGBA 5K1CC 3KRWB 2YNNA 2MTAH 1PGUA 5A2Qg 3UKRC 5SXMA 5HE1B 4J81A 5EMLB 2Q7QA 5FXYA 1QNIA 4XEIC 4A09A 2IUVA 5I5MA 5EARA 4E54B 4GGCA 3GFCA 3I8CA 4XYHA 2PBIB 5IJ8E 4CI2A 2B5MA 4HDJA 3N0EA 5TEEA 3PXWD 3JB9L 1SQ9A 4O3UB 5EMJB 1MDAH 3OW8A 5AJAA 4PSXB 3NVXA 1SQJA 2G9AA 3PE7A 4ERQA 2CE9A 5CYKB 2H9MA 4BH6A 4K3JB 4CZYA 4FA9D 2CN2A 2AGLA 4A0BA 3DXMC 5I5JA 4A08A 3UKUC 2G99A 2HJ4A 5K19A 2H9PA 4FAND 3VH0A 3EU7A 3EI2B 2AGYA 4FA4D 5HE0B 4CY2A 3U4YA 2H68A 2I3TA 4J87A 3VA6A 5B4WA 2B5NA 3OTTA 2Z2NA 3E0CA 4YVDA 3DXKC 3MMYA 4PXWA 4A0AA 2HESX 3K27A 3EMHA 2P9KC 3I2NA 1B9YA 3PXTD 2YMUA 5GXHA 3I7OA 5FLXg 2W18A 3SLED 2I0RA 3ORVD 5CXBB 3C99A 2P9LC 4I79A 2B5LA 1A0RB 3AL8A 4GGAA 3BG1A 2YB8B 3IJCA 3IKOA 3HFQA 3J81g 2P9NC 4J78A 3EI2A 5EALA 4L3HD 3F3FA 3RSEC 5TEFA 2PM6B 2QXVA 2P9IC 1Q47A 4JSPC 4D0KA 3IIYA 2HJBA 4PBYA 1S4UX 2J56H 5CXCA 3V5WB 3EI4B 2GC7A 5TF2A 3JROA 3L4MD 1P22A 3MKSB 5HQGA 5FKQA 1B9XA 3MZLA 3JPXA 2CN3A 3JZNA 5AMSA 5FA5B 2OK6A 2GNQA 3MXXA 4GGDA 3SMRA 4FA1D 3RLMD 2OVPB 4X3EA 4O9DA 2H47A 4A7JA 1OMWB 4AEZA 3I8EA 1XKSA 4OZUA 2Z2OA 3MZKA 2PM9A 3PSCB 1GP2B 4D6VA 1MG3A 3OKWA 4L3GD 4U7AA 5H1MA 1JJUB 3UVLA 4QT8A 4H5JA 2UZXB 2XL3A 1PI6A 2OVQB 3I7KA 4JSVC 5GXIA 3OKTA 2AGXA 2H6QA 4J86A 5GMKn 3SFZA 4A11B 4GMBA 4AOWA 2B4EA 2OIZA 3FRXA 3OL2B 4ZOXA 4X60B 4GZ8A 4TZ4A 3SBRA 1MG2A 2HKRA 4UI9R 3SCYA 4J77A 5FQDA 4ERZA 4PNKB 4O45A 3K26A 2IAAA 2AGWA 4GM8A 3IJ0A 4IA9A 3P4FA 1VYHC 3I7HA 3F3PA 4JT6C 3BWSA 1U2VC 3B7FA 4JSXC 4ESGA 2AH0A 4BL0A 2J57G 3DM0A 4FWWA 3JZGA 2PM7B 4FA5D 4CI3A 1K8KC 4E54A 1GXRA 4ERYA 3IJ1A 2P9SC 3I7NA 3CFSB 4BUJC 4J84A 3JAMg 4CY1A 3UR4A 2CO0A 4A09B 5TDHB 4KFMB 3DWLC 2YBAA 5HE2B 1N6EA 3OKYB 4XYIA 5H14A 5EAPA 5C2WB 3SJLD 3SVWD 3SBPA 1PEVA 3EI4A 4JXMA 5H17A 4FAVD 1N6FA 4GQBB 4IMMA 3SXTD 3EI1B 4FHLA 5JWZA 2XU7A 4GQ2P 2OJYA 3EI3A 4CY5A 1NR0A 3KRXB 1RI6A 2IWKA 4J0WA 2P9PC 1TYQC 5FKRA 1NEXB 4LG9A 4J79A 3PVUB 1GOTB 3PSLA 2H6NA 4U1EI 2IWFA 4Z8LA 2GC4A 4PBZA 2Z2PA 3GREA 2J55H 4JD2C 3J80g 2CNXA 2IURA 2I0TA 4J0XA 3RRMC 4G56B 5CXCB 1K32A 5CXBA 5FKSA 4A08B 1JMXB 5CYKA 3EI3B 2XL2A 4FB1D 5AFU3 4J73A 3DSMA 1JMZB 1L0QA 1YFQA 3EI1A 5C2VB 4QL1A 3AL8B 3L4OD 1GG2B 4J8GA 5EM2A 3FM0A 4R7AB 3I7PA 4H5IA 5I5IA 3CFVA 3C9CA 4A2MA 4O3TB 2HXCA 3IIWA 4JT5C 3UVNA 4OWRA 3RFGA 2BBKH 4CY3A 1U4CA 5IGQA 4QQEA 4Y7RA 4E5ZB 2YNPA 2EBSA 5IGOA 4J8BA 4CC9A 3NVNA 3UVOA 3F3GA 1JOFA 3C75H 1PBYB 2CO0C 1SHYB 3RFHA 3W15A 5THAA 1FWXA 2H14A 3ODTA 5IJ7E 1ERJA 4QRJA 4PSWB 2XYIA
chains in the Genus database with same CATH superfamily
3ULEC 5EM2B 1VZ2A 2PM9B 4AN0A 1N6DA 5IT9g 4CZXA 3SHFA 5EMKB 3V7DB 4LGNA 4BCCA 4MMYA 2IUQA 5FKTA 4Y5RD 5EAMA 4MK0B 4E5ZA 1XIPA 2I0SA 5GSAA 5E6UA 3K71A 1U8CA 4G1EA 5KDOB 4ZOYA 4LG8A 1TBGA 3UVKA 2EIEA 2H6KA 2P9UC 2TRCB 4GM3A 2AGZA 3JZHA 2CE8A 4RE6A 4A0BB 4CI8A 4L1QD 5M61A 4ZOVA 4J82A 2O9KA 4N14A 3BG0A 5EMMB 2AH1A 1JTDB 3K6SA 2HYEA 5C86A 4NSXA 2EIBA 2H9LA 3GD1I 3PVWB 1E5TA 5M5VA 2I3SA 3IJEA 3UVMA 3RN1D 2VZ3A 3I89A 3GC3B 2HU5A 2H9NA 3A0FA 4ES0A 2VDNA 3PXSD 4ZOZA 4K3ID 1C9LA 2BCJB 5HYNB 4DNWA 3IUMA 3SBQA 3VGZA 3ZDXA 5C9ZB 4ZN4A 4EWRA 1E8MA 3O4JA 4A0AB 2IUPA 2UZYB 3SN6B 2H13A 3EQ9A 1R5MA 4WK4A 4A11A 5IC7A 4PC0A 2BKLA 4L1MA 3EWEA 2OK4A 3FCUA 4GM9A 4O1QD 1OLZA 3CIKB 3EG6A 5HE3B 1H2XA 1UOPA 4GQ1A 2AQ5A 1XHMA 2H3XA 4L9OA 1VE7A 4X61B 3SWSD 3OL2A 3RMZD 4G1MA 4DNUA 1O6FA 2YNOA 1C9IA 3ZWLB 3MKQA 3OKYA 4CZVA 4DNVA 5M5UA 1GOFA 3V9FA 4CI1A 3JRPA 3N0DA 3C5MA 3NVQA 2QC5A 4A2LA 3AFCA 3AH8B 3AL9A 2HKMA 1UOQA 4JSNC 3RN0D 2OVRB 3I7LA 4X63B 3FGBA 5K1CC 3KRWB 2YNNA 2MTAH 1PGUA 5A2Qg 3UKRC 5SXMA 5HE1B 3QI0A 4J81A 5EMLB 2Q7QA 5FFOA 5FXYA 1QNIA 4XEIC 4A09A 2IUVA 5I5MA 5EARA 4E54B 4GGCA 3GFCA 1H2WA 3I8CA 4XYHA 2PBIB 5IJ8E 4CI2A 2B5MA 4HDJA 3N0EA 5TEEA 3PXWD 3JB9L 1SQ9A 4O3UB 5EMJB 1MDAH 2XE4A 2HU8A 3OW8A 4PSXB 3NVXA 5AJAA 3ZDZA 1SQJA 2G9AA 3PE7A 4ERQA 2CE9A 5CYKB 2H9MA 4AMYA 4BH6A 4K3JB 4CZYA 4FA9D 2CN2A 2AGLA 4A0BA 3DXMC 5I5JA 4A08A 3IUJA 3IUQA 3K72A 1VE6A 3UKUC 2G99A 2HJ4A 4NC4A 5K19A 2H9PA 4FAND 3VH0A 3EU7A 3EI2B 1BPOA 2AGYA 4FA4D 5HE0B 4CY2A 3U4YA 2H68A 2I3TA 4J87A 3VA6A 5B4WA 2B5NA 3OTTA 2Z2NA 1GOHA 2VDQA 3QHYB 3E0CA 4YVDA 3DXKC 3MMYA 4PXWA 4A0AA 4WK0A 2HESX 1H2ZA 3K27A 3V4VA 3EMHA 2P9KC 3I2NA 1B9YA 3PXTD 2YMUA 5GXHA 3I7OA 3O4GA 2W18A 3O4HA 3SLED 5FLXg 2I0RA 3ORVD 4NAAA 5CXBB 3C99A 3FCSA 2P9LC 4I79A 2B5LA 3EQ7A 1A0RB 3AL8A 4GGAA 4RE5A 3BG1A 2YB8B 3IJCA 3IKOA 1TYEA 3EQ8A 5E6RA 3HFQA 3J81g 2P9NC 4J78A 4Z7QA 3EI2A 2EIDA 2VDKA 5EALA 4L3HD 3F3FA 3RSEC 5TEFA 2PM6B 4NENA 2QXVA 3V4PA 3IURA 4G55A 2P9IC 1Q47A 4JSPC 1H2YA 4D0KA 4MMZA 3IIYA 2HJBA 4PBYA 1S4UX 2J56H 5CXCA 3V5WB 3EI4B 2GC7A 5TF2A 3JROA 3L4MD 5C92A 4JHNA 1P22A 3MKSB 5HQGA 5FKQA 1B9XA 1A12A 3MZLA 3JPXA 3T3MA 2CN3A 3JZNA 5AMSA 5FA5B 2OK6A 2VC2A 2GNQA 3MXXA 2VDMA 4GGDA 3SMRA 4FA1D 3RLMD 4AX4A 2OVPB 4X3EA 4O9DA 3NIGA 2H47A 4A7JA 1OMWB 4AEZA 3I8EA 4QAMA 3ZE1A 1XKSA 4OZUA 3T3PA 2Z2OA 3MZKA 2PM9A 3PSCB 1GP2B 2VDPA 4D6VA 1MG3A 3OKWA 4IRZA 4L3GD 3MUOA 4U7AA 5H1MA 1JJUB 3UVLA 4QT8A 2JKXA 4H5JA 5HDBA 2UZXB 2XL3A 1PI6A 1E8NA 2XZGA 3IVMA 2OVQB 3I7KA 4JSVC 5GXIA 3OKTA 2AGXA 2H6QA 4J86A 5GMKn 3SFZA 4A11B 4GMBA 4AOWA 2B4EA 2OIZA 1O6GA 3FRXA 4BCDA 3OL2B 2WQ8A 4ZOXA 1L5GA 3IULA 4X60B 4GZ8A 4TZ4A 2XDWA 1MG2A 2HKRA 3SBRA 4UI9R 3SCYA 4J77A 5FQDA 4ERZA 4PNKB 4O45A 1VZ3A 3K26A 2IAAA 2AGWA 4GM8A 3IJ0A 3P4FA 4IA9A 1VYHC 3I7HA 3F3PA 2VDRA 4JT6C 3BWSA 1U2VC 3B7FA 5M5RA 2EICA 4JSXC 4ESGA 2AH0A 2HU7A 3KCIA 1K3IA 4BL0A 4Z7OA 2J57G 3DM0A 4FWWA 3JZGA 2PM7B 4FA5D 4CI3A 1K8KC 3VI3A 4E54A 1GXRA 4ERYA 3IJ1A 2P9SC 3I7NA 3CFSB 4BP9A 4AN1A 4BUJC 4J84A 3JAMg 4CY1A 3UR4A 2CO0A 4A09B 4O02A 5TDHB 4KFMB 3OF7A 3DWLC 2YBAA 3NIFA 5HE2B 1N6EA 3OKYB 4XYIA 3MUNA 4WK2A 5H14A 5EAPA 5C2WB 3SJLD 4A08B 3SVWD 3SBPA 1PEVA 3EI4A 4JXMA 5H17A 1M1XA 1N6FA 4GQBB 4IMMA 3SXTD 4FAVD 3EI1B 4FHLA 5JWZA 2XU7A 4GQ2P 2OJYA 3EI3A 4CY5A 1NR0A 3KRXB 1RI6A 3O4IA 2IWKA 4J0WA 2P9PC 1TYQC 3VI4A 4D9SA 5FKRA 1NEXB 4LG9A 4J79A 3DDUA 3PVUB 1GOTB 3PSLA 1QFSA 2H6NA 4U1EI 2IWFA 4NBMA 4Z8LA 2GC4A 4PBZA 4BCBA 2Z2PA 5M5SA 3GREA 2J55H 4JD2C 3J80g 2CNXA 2IURA 5E6SA 1I2MB 2I0TA 4J0XA 3RRMC 4G56B 5CXCB 3NIDA 1K32A 1UTCA 5CXBA 1JMXB 5FKSA 5CYKA 3EI3B 2XL2A 4FB1D 5AFU3 2VDOA 3ZDYA 4J73A 3DSMA 4UM8A 1JV2A 1JMZB 1L0QA 4MMXA 1YFQA 3EI1A 5C2VB 4QL1A 2QR5A 3AL8B 3L4OD 4WJKA 1GG2B 5FFGA 4BP8A 4J8GA 5EM2A 4AMZA 3FM0A 4R7AB 3I7PA 4H5IA 2VDLA 3ZE0A 3ZE2A 2QZPA 5I5IA 4Z7NA 3CFVA 3C9CA 4UM9A 4O3TB 2HXCA 4A2MA 1UOOA 3IIWA 4JT5C 3UVNA 4OWRA 3IUNA 3RFGA 4O2WA 2BBKH 2VZ1A 4CY3A 1U4CA 4JHPC 5IGQA 4QQEA 4Y7RA 4E5ZB 2YNPA 2EBSA 5IGOA 4J8BA 4CC9A 3NVNA 1YR2A 3UVOA 1GOGA 5M5TA 3F3GA 1JOFA 3C75H 1PBYB 2CO0C 1SHYB 3RFHA 1T2XA 3W15A 5THAA 1FWXA 2H14A 3MVDK 3ODTA 5IJ7E 1ERJA 4QRJA 4PSWB 2XYIA 1QFMA
chains in the Genus database with same CATH topology
3ULEC 5EM2B 2PM9B 1N6DA 5IT9g 4CZXA 3SHFA 5EMKB 3V7DB 4LGNA 2IUQA 5FKTA 4Y5RD 5EAMA 4MK0B 4E5ZA 1XIPA 2I0SA 5GSAA 5KDOB 4ZOYA 4LG8A 1TBGA 3UVKA 2TRCB 2H6KA 2P9UC 4GM3A 2AGZA 3JZHA 2CE8A 4A0BB 4CI8A 4L1QD 4ZOVA 4J82A 2O9KA 4N14A 3BG0A 5EMMB 2AH1A 2HYEA 4NSXA 2H9LA 3PVWB 2I3SA 3UVMA 3RN1D 3I89A 2H9NA 3A0FA 4ES0A 3PXSD 4ZOZA 4K3ID 2BCJB 5HYNB 3SBQA 3VGZA 5C9ZB 4ZN4A 4EWRA 4A0AB 2IUPA 2UZYB 3SN6B 2H13A 1R5MA 4A11A 5IC7A 4PC0A 3EWEA 2OK4A 4GM9A 4O1QD 1OLZA 3CIKB 3EG6A 5HE3B 4GQ1A 2AQ5A 1XHMA 2H3XA 4L9OA 3SWSD 4X61B 3OL2A 3RMZD 2YNOA 3ZWLB 3MKQA 3OKYA 4CZVA 3V9FA 4CI1A 3JRPA 3N0DA 3C5MA 3NVQA 2QC5A 4A2LA 3AFCA 3AH8B 3AL9A 2HKMA 4JSNC 3RN0D 2OVRB 3I7LA 4X63B 3FGBA 5K1CC 3KRWB 2YNNA 2MTAH 1PGUA 5A2Qg 3UKRC 5SXMA 5HE1B 4J81A 5EMLB 2Q7QA 5FXYA 1QNIA 4XEIC 4A09A 2IUVA 5I5MA 5EARA 4E54B 4GGCA 3GFCA 3I8CA 4XYHA 2PBIB 5IJ8E 4CI2A 2B5MA 4HDJA 3N0EA 5TEEA 3PXWD 3JB9L 1SQ9A 4O3UB 5EMJB 1MDAH 3OW8A 5AJAA 4PSXB 3NVXA 1SQJA 2G9AA 3PE7A 4ERQA 2CE9A 5CYKB 2H9MA 4BH6A 4K3JB 4CZYA 4FA9D 2CN2A 2AGLA 4A0BA 3DXMC 5I5JA 4A08A 3UKUC 2G99A 2HJ4A 5K19A 2H9PA 4FAND 3VH0A 3EU7A 3EI2B 2AGYA 4FA4D 5HE0B 4CY2A 3U4YA 2H68A 2I3TA 4J87A 3VA6A 5B4WA 2B5NA 3OTTA 2Z2NA 3E0CA 4YVDA 3DXKC 3MMYA 4PXWA 4A0AA 2HESX 3K27A 3EMHA 2P9KC 3I2NA 1B9YA 3PXTD 2YMUA 5GXHA 3I7OA 5FLXg 2W18A 3SLED 2I0RA 3ORVD 5CXBB 3C99A 2P9LC 4I79A 2B5LA 1A0RB 3AL8A 4GGAA 3BG1A 2YB8B 3IJCA 3IKOA 3HFQA 3J81g 2P9NC 4J78A 3EI2A 5EALA 4L3HD 3F3FA 3RSEC 5TEFA 2PM6B 2QXVA 2P9IC 1Q47A 4JSPC 4D0KA 3IIYA 2HJBA 4PBYA 1S4UX 2J56H 5CXCA 3V5WB 3EI4B 2GC7A 5TF2A 3JROA 3L4MD 1P22A 3MKSB 5HQGA 5FKQA 1B9XA 3MZLA 3JPXA 2CN3A 3JZNA 5AMSA 5FA5B 2OK6A 2GNQA 3MXXA 4GGDA 3SMRA 4FA1D 3RLMD 2OVPB 4X3EA 4O9DA 2H47A 4A7JA 1OMWB 4AEZA 3I8EA 1XKSA 4OZUA 2Z2OA 3MZKA 2PM9A 3PSCB 1GP2B 4D6VA 1MG3A 3OKWA 4L3GD 4U7AA 5H1MA 1JJUB 3UVLA 4QT8A 4H5JA 2UZXB 2XL3A 1PI6A 2OVQB 3I7KA 4JSVC 5GXIA 3OKTA 2AGXA 2H6QA 4J86A 5GMKn 3SFZA 4A11B 4GMBA 4AOWA 2B4EA 2OIZA 3FRXA 3OL2B 4ZOXA 4X60B 4GZ8A 4TZ4A 3SBRA 1MG2A 2HKRA 4UI9R 3SCYA 4J77A 5FQDA 4ERZA 4PNKB 4O45A 3K26A 2IAAA 2AGWA 4GM8A 3IJ0A 4IA9A 3P4FA 1VYHC 3I7HA 3F3PA 4JT6C 3BWSA 1U2VC 3B7FA 4JSXC 4ESGA 2AH0A 4BL0A 2J57G 3DM0A 4FWWA 3JZGA 2PM7B 4FA5D 4CI3A 1K8KC 4E54A 1GXRA 4ERYA 3IJ1A 2P9SC 3I7NA 3CFSB 4BUJC 4J84A 3JAMg 4CY1A 3UR4A 2CO0A 4A09B 5TDHB 4KFMB 3DWLC 2YBAA 5HE2B 1N6EA 3OKYB 4XYIA 5H14A 5EAPA 5C2WB 3SJLD 3SVWD 3SBPA 1PEVA 3EI4A 4JXMA 5H17A 4FAVD 1N6FA 4GQBB 4IMMA 3SXTD 3EI1B 4FHLA 5JWZA 2XU7A 4GQ2P 2OJYA 3EI3A 4CY5A 1NR0A 3KRXB 1RI6A 2IWKA 4J0WA 2P9PC 1TYQC 5FKRA 1NEXB 4LG9A 4J79A 3PVUB 1GOTB 3PSLA 2H6NA 4U1EI 2IWFA 4Z8LA 2GC4A 4PBZA 2Z2PA 3GREA 2J55H 4JD2C 3J80g 2CNXA 2IURA 2I0TA 4J0XA 3RRMC 4G56B 5CXCB 1K32A 5CXBA 5FKSA 4A08B 1JMXB 5CYKA 3EI3B 2XL2A 4FB1D 5AFU3 4J73A 3DSMA 1JMZB 1L0QA 1YFQA 3EI1A 5C2VB 4QL1A 3AL8B 3L4OD 1GG2B 4J8GA 5EM2A 3FM0A 4R7AB 3I7PA 4H5IA 5I5IA 3CFVA 3C9CA 4A2MA 4O3TB 2HXCA 3IIWA 4JT5C 3UVNA 4OWRA 3RFGA 2BBKH 4CY3A 1U4CA 5IGQA 4QQEA 4Y7RA 4E5ZB 2YNPA 2EBSA 5IGOA 4J8BA 4CC9A 3NVNA 3UVOA 3F3GA 1JOFA 3C75H 1PBYB 2CO0C 1SHYB 3RFHA 3W15A 5THAA 1FWXA 2H14A 3ODTA 5IJ7E 1ERJA 4QRJA 4PSWB 2XYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULE C;  5EM2 B;  2PM9 B;  1N6D A;  5IT9 g;  4CZX A;  3SHF A;  5EMK B;  3V7D B;  4LGN A;  2IUQ A;  5FKT A;  4Y5R D;  5EAM A;  4MK0 B;  4E5Z A;  1XIP A;  2I0S A;  5GSA A;  5KDO B;  4ZOY A;  4LG8 A;  1TBG A;  3UVK A;  2TRC B;  2H6K A;  2P9U C;  4GM3 A;  2AGZ A;  3JZH A;  2CE8 A;  4A0B B;  4CI8 A;  4L1Q D;  4ZOV A;  4J82 A;  2O9K A;  4N14 A;  3BG0 A;  5EMM B;  2AH1 A;  2HYE A;  4NSX A;  2H9L A;  3PVW B;  2I3S A;  3UVM A;  3RN1 D;  3I89 A;  2H9N A;  3A0F A;  4ES0 A;  3PXS D;  4ZOZ A;  4K3I D;  2BCJ B;  5HYN B;  3SBQ A;  3VGZ A;  5C9Z B;  4ZN4 A;  4EWR A;  4A0A B;  2IUP A;  2UZY B;  3SN6 B;  2H13 A;  1R5M A;  4A11 A;  5IC7 A;  4PC0 A;  3EWE A;  2OK4 A;  4GM9 A;  4O1Q D;  1OLZ A;  3CIK B;  3EG6 A;  5HE3 B;  4GQ1 A;  2AQ5 A;  1XHM A;  2H3X A;  4L9O A;  3SWS D;  4X61 B;  3OL2 A;  3RMZ D;  2YNO A;  3ZWL B;  3MKQ A;  3OKY A;  4CZV A;  3V9F A;  4CI1 A;  3JRP A;  3N0D A;  3C5M A;  3NVQ A;  2QC5 A;  4A2L A;  3AFC A;  3AH8 B;  3AL9 A;  2HKM A;  4JSN C;  3RN0 D;  2OVR B;  3I7L A;  4X63 B;  3FGB A;  5K1C C;  3KRW B;  2YNN A;  2MTA H;  1PGU A;  5A2Q g;  3UKR C;  5SXM A;  5HE1 B;  4J81 A;  5EML B;  2Q7Q A;  5FXY A;  1QNI A;  4XEI C;  4A09 A;  2IUV A;  5I5M A;  5EAR A;  4E54 B;  4GGC A;  3GFC A;  3I8C A;  4XYH A;  2PBI B;  5IJ8 E;  4CI2 A;  2B5M A;  4HDJ A;  3N0E A;  5TEE A;  3PXW D;  3JB9 L;  1SQ9 A;  4O3U B;  5EMJ B;  1MDA H;  3OW8 A;  5AJA A;  4PSX B;  3NVX A;  1SQJ A;  2G9A A;  3PE7 A;  4ERQ A;  2CE9 A;  5CYK B;  2H9M A;  4BH6 A;  4K3J B;  4CZY A;  4FA9 D;  2CN2 A;  2AGL A;  4A0B A;  3DXM C;  5I5J A;  4A08 A;  3UKU C;  2G99 A;  2HJ4 A;  5K19 A;  2H9P A;  4FAN D;  3VH0 A;  3EU7 A;  3EI2 B;  2AGY A;  4FA4 D;  5HE0 B;  4CY2 A;  3U4Y A;  2H68 A;  2I3T A;  4J87 A;  3VA6 A;  5B4W A;  2B5N A;  3OTT A;  2Z2N A;  3E0C A;  4YVD A;  3DXK C;  3MMY A;  4PXW A;  4A0A A;  2HES X;  3K27 A;  3EMH A;  2P9K C;  3I2N A;  1B9Y A;  3PXT D;  2YMU A;  5GXH A;  3I7O A;  5FLX g;  2W18 A;  3SLE D;  2I0R A;  3ORV D;  5CXB B;  3C99 A;  2P9L C;  4I79 A;  2B5L A;  1A0R B;  3AL8 A;  4GGA A;  3BG1 A;  2YB8 B;  3IJC A;  3IKO A;  3HFQ A;  3J81 g;  2P9N C;  4J78 A;  3EI2 A;  5EAL A;  4L3H D;  3F3F A;  3RSE C;  5TEF A;  2PM6 B;  2QXV A;  2P9I C;  1Q47 A;  4JSP C;  4D0K A;  3IIY A;  2HJB A;  4PBY A;  1S4U X;  2J56 H;  5CXC A;  3V5W B;  3EI4 B;  2GC7 A;  5TF2 A;  3JRO A;  3L4M D;  1P22 A;  3MKS B;  5HQG A;  5FKQ A;  1B9X A;  3MZL A;  3JPX A;  2CN3 A;  3JZN A;  5AMS A;  5FA5 B;  2OK6 A;  2GNQ A;  3MXX A;  4GGD A;  3SMR A;  4FA1 D;  3RLM D;  2OVP B;  4X3E A;  4O9D A;  2H47 A;  4A7J A;  1OMW B;  4AEZ A;  3I8E A;  1XKS A;  4OZU A;  2Z2O A;  3MZK A;  2PM9 A;  3PSC B;  1GP2 B;  4D6V A;  1MG3 A;  3OKW A;  4L3G D;  4U7A A;  5H1M A;  1JJU B;  3UVL A;  4QT8 A;  4H5J A;  2UZX B;  2XL3 A;  1PI6 A;  2OVQ B;  3I7K A;  4JSV C;  5GXI A;  3OKT A;  2AGX A;  2H6Q A;  4J86 A;  5GMK n;  3SFZ A;  4A11 B;  4GMB A;  4AOW A;  2B4E A;  2OIZ A;  3FRX A;  3OL2 B;  4ZOX A;  4X60 B;  4GZ8 A;  4TZ4 A;  3SBR A;  1MG2 A;  2HKR A;  4UI9 R;  3SCY A;  4J77 A;  5FQD A;  4ERZ A;  4PNK B;  4O45 A;  3K26 A;  2IAA A;  2AGW A;  4GM8 A;  3IJ0 A;  4IA9 A;  3P4F A;  1VYH C;  3I7H A;  3F3P A;  4JT6 C;  3BWS A;  1U2V C;  3B7F A;  4JSX C;  4ESG A;  2AH0 A;  4BL0 A;  2J57 G;  3DM0 A;  4FWW A;  3JZG A;  2PM7 B;  4FA5 D;  4CI3 A;  1K8K C;  4E54 A;  1GXR A;  4ERY A;  3IJ1 A;  2P9S C;  3I7N A;  3CFS B;  4BUJ C;  4J84 A;  3JAM g;  4CY1 A;  3UR4 A;  2CO0 A;  4A09 B;  5TDH B;  4KFM B;  3DWL C;  2YBA A;  5HE2 B;  1N6E A;  3OKY B;  4XYI A;  5H14 A;  5EAP A;  5C2W B;  3SJL D;  3SVW D;  3SBP A;  1PEV A;  3EI4 A;  4JXM A;  5H17 A;  4FAV D;  1N6F A;  4GQB B;  4IMM A;  3SXT D;  3EI1 B;  4FHL A;  5JWZ A;  2XU7 A;  4GQ2 P;  2OJY A;  3EI3 A;  4CY5 A;  1NR0 A;  3KRX B;  1RI6 A;  2IWK A;  4J0W A;  2P9P C;  1TYQ C;  5FKR A;  1NEX B;  4LG9 A;  4J79 A;  3PVU B;  1GOT B;  3PSL A;  2H6N A;  4U1E I;  2IWF A;  4Z8L A;  2GC4 A;  4PBZ A;  2Z2P A;  3GRE A;  2J55 H;  4JD2 C;  3J80 g;  2CNX A;  2IUR A;  2I0T A;  4J0X A;  3RRM C;  4G56 B;  5CXC B;  1K32 A;  5CXB A;  5FKS A;  4A08 B;  1JMX B;  5CYK A;  3EI3 B;  2XL2 A;  4FB1 D;  5AFU 3;  4J73 A;  3DSM A;  1JMZ B;  1L0Q A;  1YFQ A;  3EI1 A;  5C2V B;  4QL1 A;  3AL8 B;  3L4O D;  1GG2 B;  4J8G A;  5EM2 A;  3FM0 A;  4R7A B;  3I7P A;  4H5I A;  5I5I A;  3CFV A;  3C9C A;  4A2M A;  4O3T B;  2HXC A;  3IIW A;  4JT5 C;  3UVN A;  4OWR A;  3RFG A;  2BBK H;  4CY3 A;  1U4C A;  5IGQ A;  4QQE A;  4Y7R A;  4E5Z B;  2YNP A;  2EBS A;  5IGO A;  4J8B A;  4CC9 A;  3NVN A;  3UVO A;  3F3G A;  1JOF A;  3C75 H;  1PBY B;  2CO0 C;  1SHY B;  3RFH A;  3W15 A;  5THA A;  1FWX A;  2H14 A;  3ODT A;  5IJ7 E;  1ERJ A;  4QRJ A;  4PSW B;  2XYI A; 
#chains in the Genus database with same CATH topology
 3ULE C;  5EM2 B;  1VZ2 A;  2PM9 B;  4AN0 A;  1N6D A;  5IT9 g;  4CZX A;  3SHF A;  5EMK B;  3V7D B;  4LGN A;  4BCC A;  4MMY A;  2IUQ A;  5FKT A;  4Y5R D;  5EAM A;  4MK0 B;  4E5Z A;  1XIP A;  2I0S A;  5GSA A;  5E6U A;  3K71 A;  1U8C A;  4G1E A;  5KDO B;  4ZOY A;  4LG8 A;  1TBG A;  3UVK A;  2EIE A;  2H6K A;  2P9U C;  2TRC B;  4GM3 A;  2AGZ A;  3JZH A;  2CE8 A;  4RE6 A;  4A0B B;  4CI8 A;  4L1Q D;  5M61 A;  4ZOV A;  4J82 A;  2O9K A;  4N14 A;  3BG0 A;  5EMM B;  2AH1 A;  1JTD B;  3K6S A;  2HYE A;  5C86 A;  4NSX A;  2EIB A;  2H9L A;  3GD1 I;  3PVW B;  1E5T A;  5M5V A;  2I3S A;  3IJE A;  3UVM A;  3RN1 D;  2VZ3 A;  3I89 A;  3GC3 B;  2HU5 A;  2H9N A;  3A0F A;  4ES0 A;  2VDN A;  3PXS D;  4ZOZ A;  4K3I D;  1C9L A;  2BCJ B;  5HYN B;  4DNW A;  3IUM A;  3SBQ A;  3VGZ A;  3ZDX A;  5C9Z B;  4ZN4 A;  4EWR A;  1E8M A;  3O4J A;  4A0A B;  2IUP A;  2UZY B;  3SN6 B;  2H13 A;  3EQ9 A;  1R5M A;  4WK4 A;  4A11 A;  5IC7 A;  4PC0 A;  2BKL A;  4L1M A;  3EWE A;  2OK4 A;  3FCU A;  4GM9 A;  4O1Q D;  1OLZ A;  3CIK B;  3EG6 A;  5HE3 B;  1H2X A;  1UOP A;  4GQ1 A;  2AQ5 A;  1XHM A;  2H3X A;  4L9O A;  1VE7 A;  4X61 B;  3SWS D;  3OL2 A;  3RMZ D;  4G1M A;  4DNU A;  1O6F A;  2YNO A;  1C9I A;  3ZWL B;  3MKQ A;  3OKY A;  4CZV A;  4DNV A;  5M5U A;  1GOF A;  3V9F A;  4CI1 A;  3JRP A;  3N0D A;  3C5M A;  3NVQ A;  2QC5 A;  4A2L A;  3AFC A;  3AH8 B;  3AL9 A;  2HKM A;  1UOQ A;  4JSN C;  3RN0 D;  2OVR B;  3I7L A;  4X63 B;  3FGB A;  5K1C C;  3KRW B;  2YNN A;  2MTA H;  1PGU A;  5A2Q g;  3UKR C;  5SXM A;  5HE1 B;  3QI0 A;  4J81 A;  5EML B;  2Q7Q A;  5FFO A;  5FXY A;  1QNI A;  4XEI C;  4A09 A;  2IUV A;  5I5M A;  5EAR A;  4E54 B;  4GGC A;  3GFC A;  1H2W A;  3I8C A;  4XYH A;  2PBI B;  5IJ8 E;  4CI2 A;  2B5M A;  4HDJ A;  3N0E A;  5TEE A;  3PXW D;  3JB9 L;  1SQ9 A;  4O3U B;  5EMJ B;  1MDA H;  2XE4 A;  2HU8 A;  3OW8 A;  4PSX B;  3NVX A;  5AJA A;  3ZDZ A;  1SQJ A;  2G9A A;  3PE7 A;  4ERQ A;  2CE9 A;  5CYK B;  2H9M A;  4AMY A;  4BH6 A;  4K3J B;  4CZY A;  4FA9 D;  2CN2 A;  2AGL A;  4A0B A;  3DXM C;  5I5J A;  4A08 A;  3IUJ A;  3IUQ A;  3K72 A;  1VE6 A;  3UKU C;  2G99 A;  2HJ4 A;  4NC4 A;  5K19 A;  2H9P A;  4FAN D;  3VH0 A;  3EU7 A;  3EI2 B;  1BPO A;  2AGY A;  4FA4 D;  5HE0 B;  4CY2 A;  3U4Y A;  2H68 A;  2I3T A;  4J87 A;  3VA6 A;  5B4W A;  2B5N A;  3OTT A;  2Z2N A;  1GOH A;  2VDQ A;  3QHY B;  3E0C A;  4YVD A;  3DXK C;  3MMY A;  4PXW A;  4A0A A;  4WK0 A;  2HES X;  1H2Z A;  3K27 A;  3V4V A;  3EMH A;  2P9K C;  3I2N A;  1B9Y A;  3PXT D;  2YMU A;  5GXH A;  3I7O A;  3O4G A;  2W18 A;  3O4H A;  3SLE D;  5FLX g;  2I0R A;  3ORV D;  4NAA A;  5CXB B;  3C99 A;  3FCS A;  2P9L C;  4I79 A;  2B5L A;  3EQ7 A;  1A0R B;  3AL8 A;  4GGA A;  4RE5 A;  3BG1 A;  2YB8 B;  3IJC A;  3IKO A;  1TYE A;  3EQ8 A;  5E6R A;  3HFQ A;  3J81 g;  2P9N C;  4J78 A;  4Z7Q A;  3EI2 A;  2EID A;  2VDK A;  5EAL A;  4L3H D;  3F3F A;  3RSE C;  5TEF A;  2PM6 B;  4NEN A;  2QXV A;  3V4P A;  3IUR A;  4G55 A;  2P9I C;  1Q47 A;  4JSP C;  1H2Y A;  4D0K A;  4MMZ A;  3IIY A;  2HJB A;  4PBY A;  1S4U X;  2J56 H;  5CXC A;  3V5W B;  3EI4 B;  2GC7 A;  5TF2 A;  3JRO A;  3L4M D;  5C92 A;  4JHN A;  1P22 A;  3MKS B;  5HQG A;  5FKQ A;  1B9X A;  1A12 A;  3MZL A;  3JPX A;  3T3M A;  2CN3 A;  3JZN A;  5AMS A;  5FA5 B;  2OK6 A;  2VC2 A;  2GNQ A;  3MXX A;  2VDM A;  4GGD A;  3SMR A;  4FA1 D;  3RLM D;  4AX4 A;  2OVP B;  4X3E A;  4O9D A;  3NIG A;  2H47 A;  4A7J A;  1OMW B;  4AEZ A;  3I8E A;  4QAM A;  3ZE1 A;  1XKS A;  4OZU A;  3T3P A;  2Z2O A;  3MZK A;  2PM9 A;  3PSC B;  1GP2 B;  2VDP A;  4D6V A;  1MG3 A;  3OKW A;  4IRZ A;  4L3G D;  3MUO A;  4U7A A;  5H1M A;  1JJU B;  3UVL A;  4QT8 A;  2JKX A;  4H5J A;  5HDB A;  2UZX B;  2XL3 A;  1PI6 A;  1E8N A;  2XZG A;  3IVM A;  2OVQ B;  3I7K A;  4JSV C;  5GXI A;  3OKT A;  2AGX A;  2H6Q A;  4J86 A;  5GMK n;  3SFZ A;  4A11 B;  4GMB A;  4AOW A;  2B4E A;  2OIZ A;  1O6G A;  3FRX A;  4BCD A;  3OL2 B;  2WQ8 A;  4ZOX A;  1L5G A;  3IUL A;  4X60 B;  4GZ8 A;  4TZ4 A;  2XDW A;  1MG2 A;  2HKR A;  3SBR A;  4UI9 R;  3SCY A;  4J77 A;  5FQD A;  4ERZ A;  4PNK B;  4O45 A;  1VZ3 A;  3K26 A;  2IAA A;  2AGW A;  4GM8 A;  3IJ0 A;  3P4F A;  4IA9 A;  1VYH C;  3I7H A;  3F3P A;  2VDR A;  4JT6 C;  3BWS A;  1U2V C;  3B7F A;  5M5R A;  2EIC A;  4JSX C;  4ESG A;  2AH0 A;  2HU7 A;  3KCI A;  1K3I A;  4BL0 A;  4Z7O A;  2J57 G;  3DM0 A;  4FWW A;  3JZG A;  2PM7 B;  4FA5 D;  4CI3 A;  1K8K C;  3VI3 A;  4E54 A;  1GXR A;  4ERY A;  3IJ1 A;  2P9S C;  3I7N A;  3CFS B;  4BP9 A;  4AN1 A;  4BUJ C;  4J84 A;  3JAM g;  4CY1 A;  3UR4 A;  2CO0 A;  4A09 B;  4O02 A;  5TDH B;  4KFM B;  3OF7 A;  3DWL C;  2YBA A;  3NIF A;  5HE2 B;  1N6E A;  3OKY B;  4XYI A;  3MUN A;  4WK2 A;  5H14 A;  5EAP A;  5C2W B;  3SJL D;  4A08 B;  3SVW D;  3SBP A;  1PEV A;  3EI4 A;  4JXM A;  5H17 A;  1M1X A;  1N6F A;  4GQB B;  4IMM A;  3SXT D;  4FAV D;  3EI1 B;  4FHL A;  5JWZ A;  2XU7 A;  4GQ2 P;  2OJY A;  3EI3 A;  4CY5 A;  1NR0 A;  3KRX B;  1RI6 A;  3O4I A;  2IWK A;  4J0W A;  2P9P C;  1TYQ C;  3VI4 A;  4D9S A;  5FKR A;  1NEX B;  4LG9 A;  4J79 A;  3DDU A;  3PVU B;  1GOT B;  3PSL A;  1QFS A;  2H6N A;  4U1E I;  2IWF A;  4NBM A;  4Z8L A;  2GC4 A;  4PBZ A;  4BCB A;  2Z2P A;  5M5S A;  3GRE A;  2J55 H;  4JD2 C;  3J80 g;  2CNX A;  2IUR A;  5E6S A;  1I2M B;  2I0T A;  4J0X A;  3RRM C;  4G56 B;  5CXC B;  3NID A;  1K32 A;  1UTC A;  5CXB A;  1JMX B;  5FKS A;  5CYK A;  3EI3 B;  2XL2 A;  4FB1 D;  5AFU 3;  2VDO A;  3ZDY A;  4J73 A;  3DSM A;  4UM8 A;  1JV2 A;  1JMZ B;  1L0Q A;  4MMX A;  1YFQ A;  3EI1 A;  5C2V B;  4QL1 A;  2QR5 A;  3AL8 B;  3L4O D;  4WJK A;  1GG2 B;  5FFG A;  4BP8 A;  4J8G A;  5EM2 A;  4AMZ A;  3FM0 A;  4R7A B;  3I7P A;  4H5I A;  2VDL A;  3ZE0 A;  3ZE2 A;  2QZP A;  5I5I A;  4Z7N A;  3CFV A;  3C9C A;  4UM9 A;  4O3T B;  2HXC A;  4A2M A;  1UOO A;  3IIW A;  4JT5 C;  3UVN A;  4OWR A;  3IUN A;  3RFG A;  4O2W A;  2BBK H;  2VZ1 A;  4CY3 A;  1U4C A;  4JHP C;  5IGQ A;  4QQE A;  4Y7R A;  4E5Z B;  2YNP A;  2EBS A;  5IGO A;  4J8B A;  4CC9 A;  3NVN A;  1YR2 A;  3UVO A;  1GOG A;  5M5T A;  3F3G A;  1JOF A;  3C75 H;  1PBY B;  2CO0 C;  1SHY B;  3RFH A;  1T2X A;  3W15 A;  5THA A;  1FWX A;  2H14 A;  3MVD K;  3ODT A;  5IJ7 E;  1ERJ A;  4QRJ A;  4PSW B;  2XYI A;  1QFM A; 
#chains in the Genus database with same CATH homology
 3ULE C;  5EM2 B;  2PM9 B;  1N6D A;  5IT9 g;  4CZX A;  3SHF A;  5EMK B;  3V7D B;  4LGN A;  2IUQ A;  5FKT A;  4Y5R D;  5EAM A;  4MK0 B;  4E5Z A;  1XIP A;  2I0S A;  5GSA A;  5KDO B;  4ZOY A;  4LG8 A;  1TBG A;  3UVK A;  2TRC B;  2H6K A;  2P9U C;  4GM3 A;  2AGZ A;  3JZH A;  2CE8 A;  4A0B B;  4CI8 A;  4L1Q D;  4ZOV A;  4J82 A;  2O9K A;  4N14 A;  3BG0 A;  5EMM B;  2AH1 A;  2HYE A;  4NSX A;  2H9L A;  3PVW B;  2I3S A;  3UVM A;  3RN1 D;  3I89 A;  2H9N A;  3A0F A;  4ES0 A;  3PXS D;  4ZOZ A;  4K3I D;  2BCJ B;  5HYN B;  3SBQ A;  3VGZ A;  5C9Z B;  4ZN4 A;  4EWR A;  4A0A B;  2IUP A;  2UZY B;  3SN6 B;  2H13 A;  1R5M A;  4A11 A;  5IC7 A;  4PC0 A;  3EWE A;  2OK4 A;  4GM9 A;  4O1Q D;  1OLZ A;  3CIK B;  3EG6 A;  5HE3 B;  4GQ1 A;  2AQ5 A;  1XHM A;  2H3X A;  4L9O A;  3SWS D;  4X61 B;  3OL2 A;  3RMZ D;  2YNO A;  3ZWL B;  3MKQ A;  3OKY A;  4CZV A;  3V9F A;  4CI1 A;  3JRP A;  3N0D A;  3C5M A;  3NVQ A;  2QC5 A;  4A2L A;  3AFC A;  3AH8 B;  3AL9 A;  2HKM A;  4JSN C;  3RN0 D;  2OVR B;  3I7L A;  4X63 B;  3FGB A;  5K1C C;  3KRW B;  2YNN A;  2MTA H;  1PGU A;  5A2Q g;  3UKR C;  5SXM A;  5HE1 B;  4J81 A;  5EML B;  2Q7Q A;  5FXY A;  1QNI A;  4XEI C;  4A09 A;  2IUV A;  5I5M A;  5EAR A;  4E54 B;  4GGC A;  3GFC A;  3I8C A;  4XYH A;  2PBI B;  5IJ8 E;  4CI2 A;  2B5M A;  4HDJ A;  3N0E A;  5TEE A;  3PXW D;  3JB9 L;  1SQ9 A;  4O3U B;  5EMJ B;  1MDA H;  3OW8 A;  5AJA A;  4PSX B;  3NVX A;  1SQJ A;  2G9A A;  3PE7 A;  4ERQ A;  2CE9 A;  5CYK B;  2H9M A;  4BH6 A;  4K3J B;  4CZY A;  4FA9 D;  2CN2 A;  2AGL A;  4A0B A;  3DXM C;  5I5J A;  4A08 A;  3UKU C;  2G99 A;  2HJ4 A;  5K19 A;  2H9P A;  4FAN D;  3VH0 A;  3EU7 A;  3EI2 B;  2AGY A;  4FA4 D;  5HE0 B;  4CY2 A;  3U4Y A;  2H68 A;  2I3T A;  4J87 A;  3VA6 A;  5B4W A;  2B5N A;  3OTT A;  2Z2N A;  3E0C A;  4YVD A;  3DXK C;  3MMY A;  4PXW A;  4A0A A;  2HES X;  3K27 A;  3EMH A;  2P9K C;  3I2N A;  1B9Y A;  3PXT D;  2YMU A;  5GXH A;  3I7O A;  5FLX g;  2W18 A;  3SLE D;  2I0R A;  3ORV D;  5CXB B;  3C99 A;  2P9L C;  4I79 A;  2B5L A;  1A0R B;  3AL8 A;  4GGA A;  3BG1 A;  2YB8 B;  3IJC A;  3IKO A;  3HFQ A;  3J81 g;  2P9N C;  4J78 A;  3EI2 A;  5EAL A;  4L3H D;  3F3F A;  3RSE C;  5TEF A;  2PM6 B;  2QXV A;  2P9I C;  1Q47 A;  4JSP C;  4D0K A;  3IIY A;  2HJB A;  4PBY A;  1S4U X;  2J56 H;  5CXC A;  3V5W B;  3EI4 B;  2GC7 A;  5TF2 A;  3JRO A;  3L4M D;  1P22 A;  3MKS B;  5HQG A;  5FKQ A;  1B9X A;  3MZL A;  3JPX A;  2CN3 A;  3JZN A;  5AMS A;  5FA5 B;  2OK6 A;  2GNQ A;  3MXX A;  4GGD A;  3SMR A;  4FA1 D;  3RLM D;  2OVP B;  4X3E A;  4O9D A;  2H47 A;  4A7J A;  1OMW B;  4AEZ A;  3I8E A;  1XKS A;  4OZU A;  2Z2O A;  3MZK A;  2PM9 A;  3PSC B;  1GP2 B;  4D6V A;  1MG3 A;  3OKW A;  4L3G D;  4U7A A;  5H1M A;  1JJU B;  3UVL A;  4QT8 A;  4H5J A;  2UZX B;  2XL3 A;  1PI6 A;  2OVQ B;  3I7K A;  4JSV C;  5GXI A;  3OKT A;  2AGX A;  2H6Q A;  4J86 A;  5GMK n;  3SFZ A;  4A11 B;  4GMB A;  4AOW A;  2B4E A;  2OIZ A;  3FRX A;  3OL2 B;  4ZOX A;  4X60 B;  4GZ8 A;  4TZ4 A;  3SBR A;  1MG2 A;  2HKR A;  4UI9 R;  3SCY A;  4J77 A;  5FQD A;  4ERZ A;  4PNK B;  4O45 A;  3K26 A;  2IAA A;  2AGW A;  4GM8 A;  3IJ0 A;  4IA9 A;  3P4F A;  1VYH C;  3I7H A;  3F3P A;  4JT6 C;  3BWS A;  1U2V C;  3B7F A;  4JSX C;  4ESG A;  2AH0 A;  4BL0 A;  2J57 G;  3DM0 A;  4FWW A;  3JZG A;  2PM7 B;  4FA5 D;  4CI3 A;  1K8K C;  4E54 A;  1GXR A;  4ERY A;  3IJ1 A;  2P9S C;  3I7N A;  3CFS B;  4BUJ C;  4J84 A;  3JAM g;  4CY1 A;  3UR4 A;  2CO0 A;  4A09 B;  5TDH B;  4KFM B;  3DWL C;  2YBA A;  5HE2 B;  1N6E A;  3OKY B;  4XYI A;  5H14 A;  5EAP A;  5C2W B;  3SJL D;  3SVW D;  3SBP A;  1PEV A;  3EI4 A;  4JXM A;  5H17 A;  4FAV D;  1N6F A;  4GQB B;  4IMM A;  3SXT D;  3EI1 B;  4FHL A;  5JWZ A;  2XU7 A;  4GQ2 P;  2OJY A;  3EI3 A;  4CY5 A;  1NR0 A;  3KRX B;  1RI6 A;  2IWK A;  4J0W A;  2P9P C;  1TYQ C;  5FKR A;  1NEX B;  4LG9 A;  4J79 A;  3PVU B;  1GOT B;  3PSL A;  2H6N A;  4U1E I;  2IWF A;  4Z8L A;  2GC4 A;  4PBZ A;  2Z2P A;  3GRE A;  2J55 H;  4JD2 C;  3J80 g;  2CNX A;  2IUR A;  2I0T A;  4J0X A;  3RRM C;  4G56 B;  5CXC B;  1K32 A;  5CXB A;  5FKS A;  4A08 B;  1JMX B;  5CYK A;  3EI3 B;  2XL2 A;  4FB1 D;  5AFU 3;  4J73 A;  3DSM A;  1JMZ B;  1L0Q A;  1YFQ A;  3EI1 A;  5C2V B;  4QL1 A;  3AL8 B;  3L4O D;  1GG2 B;  4J8G A;  5EM2 A;  3FM0 A;  4R7A B;  3I7P A;  4H5I A;  5I5I A;  3CFV A;  3C9C A;  4A2M A;  4O3T B;  2HXC A;  3IIW A;  4JT5 C;  3UVN A;  4OWR A;  3RFG A;  2BBK H;  4CY3 A;  1U4C A;  5IGQ A;  4QQE A;  4Y7R A;  4E5Z B;  2YNP A;  2EBS A;  5IGO A;  4J8B A;  4CC9 A;  3NVN A;  3UVO A;  3F3G A;  1JOF A;  3C75 H;  1PBY B;  2CO0 C;  1SHY B;  3RFH A;  3W15 A;  5THA A;  1FWX A;  2H14 A;  3ODT A;  5IJ7 E;  1ERJ A;  4QRJ A;  4PSW B;  2XYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...