2HJBA

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
358
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 92
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hjbA01
2HYEA 4EWRA 4K3JB 4E5ZB 3I7KA 1PEVA 2I3SA 5CYKA 5H1MA 1FWXA 4CY2A 4FHLA 2HJBA 3RRMC 3I7OA 2YNPA 4A08A 2OK6A 4IMMA 4MK0B 2P9UC 2H6QA 2AGLA 2H9LA 3OKWA 1GP2B 3OL2A 4JT6C 1JMZB 5IGOA 5HE1B 3DSMA 3EI2A 4O3TB 3ZWLB 2PBIB 4XEIC 5I5MA 3I2NA 5AFU3 2H6NA 2IUPA 4PBZA 4D6VA 3RFGA 3OKYA 2CE8A 1B9YA 2G99A 4ZOZA 3ULEC 5CXCB 3JAMg 2H9NA 3C99A 4A0AA 2GNQA 3JB9L 3PXSD 5H17A 4QL1A 4Y5RD 5IGQA 2CO0C 5KDOB 1SQJA 5HE0B 1XHMA 4H5JA 5HE2B 3I7NA 3SCYA 2UZXB 3EI4B 3VA6A 5THAA 4A0AB 2H68A 3RN1D 2HJ4A 3SMRA 3JZNA 3VH0A 4N14A 2Q7QA 3AL8B 1VYHC 4CY5A 4BH6A 4JSVC 3DXMC 3GFCA 3SWSD 2P9KC 4J73A 4L3GD 4ZOVA 2O9KA 1U4CA 5B4WA 1PI6A 3UVMA 1Q47A 5EM2A 4J8GA 4FAND 3UVKA 3PSLA 4JXMA 5EMMB 1MG3A 3CFVA 3OW8A 5I5JA 2HKMA 3I7HA 3HFQA 3GREA 4ERZA 2TRCB 2CN2A 4J8BA 2IURA 1R5MA 3AH8B 3L4OD 1U2VC 4FA1D 2YB8B 3OTTA 1P22A 4FAVD 1A0RB 2CNXA 2IUVA 3I89A 4A2MA 2GC7A 5IT9g 1S4UX 4JSNC 4CY1A 5EMLB 4GQ2P 3MMYA 4JD2C 4R7AB 3K27A 3MXXA 4GM9A 4PXWA 3I7LA 5TEEA 3I7PA 4A7JA 5C9ZB 4H5IA 4CI8A 4J86A 3UVOA 2GC4A 3EI3B 4O1QD 2HKRA 4CZYA 1K8KC 4YVDA 3BWSA 4BUJC 2OVPB 1N6FA 2YNNA 5HQGA 4ZOYA 2J55H 1GG2B 5SXMA 2XYIA 3FRXA 5EMJB 2AGYA 4E54A 1TBGA 2Z2NA 2CO0A 2MTAH 3SBQA 4GQBB 4X61B 2H6KA 4KFMB 3B7FA 2P9SC 3SLED 2PM9A 5JWZA 4ERQA 3OKTA 3SFZA 5EAPA 4ESGA 2H3XA 2XU7A 3BG1A 2IWKA 5FKQA 4K3ID 2AQ5A 1SQ9A 4GZ8A 3PE7A 4CY3A 3N0DA 3BG0A 3EWEA 5FQDA 5K19A 3PVWB 2BBKH 3C9CA 3PSCB 3F3GA 4BL0A 4PBYA 5FXYA 4QT8A 2H9MA 4J0WA 5AMSA 4HDJA 1NR0A 5GXIA 2I3TA 5FKRA 3UVLA 1MG2A 3DXKC 3AL9A 1OLZA 5EAMA 2UZYB 3MZKA 3NVXA 3EU7A 2IAAA 4CZVA 5HYNB 2J56H 4AEZA 4GGDA 3V7DB 1N6EA 4U1EI 3DWLC 3SBPA 4CC9A 2EBSA 3P4FA 4E5ZA 4L9OA 4UI9R 4L1QD 2PM7B 3SXTD 3UR4A 5GSAA 2W18A 4E54B 2XL3A 3OKYB 4A2LA 3MKQA 4ZN4A 3SN6B 1K32A 3SJLD 2AGZA 4PSWB 3RN0D 3EI2B 1NEXB 2I0RA 3C75H 4PSXB 3DM0A 2PM6B 3RSEC 4ES0A 5GMKn 5A2Qg 2H47A 4JSXC 3EI3A 2AH1A 3EMHA 2B4EA 4QRJA 1YFQA 4GMBA 4GQ1A 3IJCA 4GGCA 2OVQB 4O9DA 4CI1A 4J0XA 3CIKB 4J79A 1MDAH 3NVQA 3V5WB 3I8CA 4LG9A 3UVNA 4FA9D 4XYHA 3AFCA 5IC7A 4A09B 4CZXA 4L3HD 5TF2A 4OWRA 5TEFA 2IUQA 4FWWA 3IJ1A 3EI4A 2OJYA 3KRXB 2Z2OA 4IA9A 2CN3A 2XL2A 2IWFA 3V9FA 1SHYB 5IJ7E 3C5MA 3MKSB 2H9PA 2YNOA 3U4YA 4FA4D 4Y7RA 2B5LA 5EMKB 5CXBB 3MZLA 4ERYA 4FB1D 4ZOXA 1JMXB 3OL2B 2AH0A 3VGZA 1N6DA 3FGBA 4QQEA 3J81g 1PGUA 3KRWB 4J82A 1JJUB 4TZ4A 3W15A 2P9IC 3SHFA 2P9NC 5EALA 5GXHA 3PXTD 3I8EA 2B5NA 3N0EA 3PVUB 4JSPC 5CYKB 2HESX 4PC0A 3UKUC 4OZUA 1PBYB 2J57G 3NVNA 3ORVD 2B5MA 3IJ0A 1GOTB 1ERJA 2BCJB 4A09A 5IJ8E 3E0CA 5HE3B 4J87A 3IIWA 5FLXg 3A0FA 5AJAA 5FA5B 4A11A 3PXWD 2AGXA 3EG6A 5C2WB 3L4MD 5EARA 2YBAA 3SBRA 4I79A 4CI2A 4A11B 2OIZA 1JOFA 3UKRC 3FM0A 4PNKB 3RMZD 4A08B 4J84A 2AGWA 3EI1B 2CE9A 3IIYA 5EM2B 4GGAA 1TYQC 2P9LC 2YMUA 4U7AA 1RI6A 3F3FA 5TDHB 5FKTA 4X60B 1XIPA 2QXVA 4LG8A 2PM9B 2Z2PA 4J78A 4LGNA 3AL8A 3JRPA 4O45A 2H13A 4X63B 4JT5C 2OVRB 3JROA 3ODTA 4D0KA 2I0SA 3RLMD 1L0QA 4J81A 4FA5D 1XKSA 2QC5A 4Z8LA 4GM3A 3JZGA 2G9AA 4A0BA 4O3UB 4CI3A 2HXCA 3CFSB 5CXCA 5C2VB 1OMWB 2H14A 3RFHA 1GXRA 3SVWD 2P9PC 3JZHA 4XYIA 3K26A 3EI1A 2I0TA 3F3PA 4GM8A 1B9XA 5CXBA 4G56B 3IKOA 5H14A 5FKSA 5K1CC 2OK4A 4X3EA 4AOWA 3JPXA 1QNIA 5I5IA 3J80g 4A0BB 4J77A 4NSXA
chains in the Genus database with same CATH superfamily
2HYEA 4EWRA 3NIFA 4K3JB 4E5ZB 1UOQA 1C9IA 3NIDA 3I7KA 4WK0A 4RE6A 1PEVA 4NBMA 2I3SA 5CYKA 5H1MA 3O4IA 1FWXA 4CY2A 4FHLA 1I2MB 3O4HA 2HJBA 3RRMC 3I7OA 2YNPA 4A08A 4MMXA 5M5UA 2OK6A 4IMMA 4MK0B 2P9UC 2H6QA 2AGLA 2H9LA 5C92A 3OKWA 1GP2B 3OL2A 4JT6C 4G1MA 1JMZB 5IGOA 1O6GA 4MMZA 5HE1B 3DSMA 3EI2A 4O3TB 3ZWLB 2PBIB 4XEIC 5I5MA 3I2NA 5AFU3 2H6NA 2IUPA 4PBZA 4D6VA 1E5TA 3RFGA 3OKYA 4AN1A 2CE8A 1B9YA 2G99A 4ZOZA 3ULEC 5CXCB 3JAMg 2H9NA 3C99A 4A0AA 2GNQA 3IURA 3QHYB 3PXSD 4DNWA 5H17A 3JB9L 4QL1A 4Y5RD 5IGQA 2CO0C 5KDOB 1SQJA 5HE0B 1XHMA 4H5JA 5HE2B 3I7NA 4JHPC 3SCYA 4Z7QA 2UZXB 3EI4B 3VA6A 5THAA 4QAMA 1E8MA 4BCCA 4A0AB 5HDBA 2H68A 3FCSA 2HJ4A 3RN1D 3SMRA 3JZNA 3VH0A 4NC4A 1UOOA 4N14A 2Q7QA 3AL8B 2VDRA 1VYHC 4CY5A 4BH6A 4JSVC 4WJKA 3DXMC 3GFCA 3SWSD 5M5RA 2P9KC 4J73A 4L3GD 4ZOVA 2O9KA 1U4CA 4MMYA 5B4WA 1PI6A 3UVMA 1Q47A 5EM2A 4J8GA 4FAND 3UVKA 3PSLA 1GOGA 4JXMA 5EMMB 4JHNA 1MG3A 3CFVA 3KCIA 3OW8A 5I5JA 2HKMA 2VDNA 3HFQA 3I7HA 4WK4A 1C9LA 3GREA 4ERZA 2TRCB 2CN2A 3VI3A 4J8BA 2IURA 1R5MA 3AH8B 3L4OD 3O4GA 1U2VC 4NENA 4FA1D 2YB8B 3OTTA 1P22A 4FAVD 1A0RB 2CNXA 2IUVA 3I89A 1VZ3A 4A2MA 2GC7A 5IT9g 1S4UX 4JSNC 4CY1A 5EMLB 4GQ2P 3MMYA 4JD2C 4R7AB 3K27A 3MXXA 4GM9A 4PXWA 3VI4A 2EIDA 3I7LA 5TEEA 3I7PA 4DNVA 4A7JA 5C9ZB 4H5IA 4CI8A 4J86A 3UVOA 4O2WA 2VDPA 2GC4A 3ZDXA 3EI3B 4O1QD 2HKRA 4CZYA 1K8KC 5M5SA 2XE4A 4O02A 4YVDA 3BWSA 4BUJC 2OVPB 3T3MA 1N6FA 2YNNA 5HQGA 4ZOYA 2J55H 1GG2B 5E6UA 5SXMA 2XYIA 3FRXA 5EMJB 2AGYA 4E54A 1M1XA 1TBGA 2Z2NA 1H2WA 2CO0A 3IVMA 2MTAH 3SBQA 4GQBB 4X61B 2H6KA 4KFMB 3B7FA 2P9SC 3IUNA 3SLED 3V4PA 1GOHA 2PM9A 1UTCA 5JWZA 4ERQA 3OKTA 3SFZA 5EAPA 4ESGA 2H3XA 2XU7A 3BG1A 2IWKA 5FKQA 4K3ID 2AQ5A 2JKXA 1SQ9A 3K72A 4GZ8A 3PE7A 4CY3A 3N0DA 3BG0A 3EWEA 5FQDA 5K19A 3PVWB 2BBKH 3C9CA 4AMYA 3PSCB 3F3GA 4BL0A 1BPOA 4BP8A 4PBYA 5FXYA 4QT8A 2H9MA 4J0WA 5AMSA 4HDJA 1NR0A 5GXIA 2I3TA 5FKRA 3UVLA 1MG2A 3DXKC 1A12A 3AL9A 1OLZA 5EAMA 2UZYB 3QI0A 3MZKA 2VC2A 3NVXA 3EU7A 2IAAA 4CZVA 4UM8A 5HYNB 2J56H 4AEZA 4GGDA 3V7DB 1N6EA 4U1EI 1JV2A 1E8NA 3DWLC 2HU8A 3IUMA 3MUOA 1VE6A 3SBPA 4CC9A 3MVDK 2VDOA 2EBSA 3P4FA 4E5ZA 4L9OA 4UI9R 4L1QD 2PM7B 3SXTD 3UR4A 5GSAA 2W18A 4E54B 3EQ8A 2XL3A 3OKYB 4A2LA 5FFOA 3MKQA 4ZN4A 3SN6B 1K32A 5M5VA 3SJLD 2AGZA 4PSWB 3RN0D 3EI2B 1NEXB 2HU5A 4G1EA 3O4JA 2I0RA 5C86A 3C75H 1VZ2A 4PSXB 3DM0A 2PM6B 3RSEC 4ES0A 5GMKn 1YR2A 5A2Qg 2H47A 4JSXC 3EI3A 2AH1A 3EMHA 2B4EA 4QRJA 4Z7OA 1YFQA 2BKLA 4Z7NA 4GMBA 4GQ1A 3IJCA 4GGCA 2OVQB 3T3PA 4O9DA 4AN0A 4CI1A 4J0XA 3CIKB 1MDAH 4J79A 3ZE2A 3NVQA 4BP9A 3V5WB 3IUQA 3I8CA 4UM9A 4LG9A 3UVNA 4FA9D 4XYHA 3AFCA 5IC7A 4A09B 4CZXA 2HU7A 4L3HD 5TF2A 4OWRA 3NIGA 5TEFA 2IUQA 4FWWA 1H2ZA 3IJ1A 3EI4A 2OJYA 1GOFA 2QZPA 3KRXB 2Z2OA 4IA9A 4D9SA 2CN3A 2XL2A 2IWFA 3V9FA 1SHYB 5IJ7E 3C5MA 3MKSB 2H9PA 2YNOA 3U4YA 2QR5A 3K71A 4FA4D 4Y7RA 5M61A 2B5LA 2VZ1A 5EMKB 3IUJA 5CXBB 3MZLA 3EQ7A 4ERYA 4FB1D 4ZOXA 1JMXB 3OL2B 1TYEA 2AH0A 4NAAA 3VGZA 1N6DA 3FGBA 3OF7A 3IJEA 4IRZA 4QQEA 3EQ9A 3J81g 1PGUA 2VZ3A 3KRWB 4J82A 5FFGA 5E6RA 1JJUB 4TZ4A 4G55A 3DDUA 3W15A 2P9IC 3SHFA 2P9NC 5EALA 5GXHA 3PXTD 1T2XA 3I8EA 2B5NA 1VE7A 3N0EA 3PVUB 4JSPC 5CYKB 2HESX 4PC0A 3UKUC 4OZUA 4WK2A 5E6SA 1PBYB 1H2XA 2J57G 3NVNA 3GC3B 3ORVD 2VDLA 2B5MA 3IJ0A 1GOTB 1ERJA 2BCJB 3FCUA 4A09A 5IJ8E 4L1MA 3E0CA 5HE3B 3V4VA 4J87A 3IIWA 5FLXg 3IULA 3A0FA 3MUNA 5AJAA 5FA5B 4A11A 3PXWD 2AGXA 3EG6A 5C2WB 5M5TA 2WQ8A 1QFMA 3L4MD 5EARA 2YBAA 3SBRA 4I79A 4AMZA 4CI2A 4A11B 2OIZA 1JOFA 3UKRC 3FM0A 4PNKB 3RMZD 4A08B 1H2YA 4J84A 2AGWA 4AX4A 3EI1B 3ZDZA 2CE9A 3IIYA 5EM2B 2EICA 4GGAA 1TYQC 2P9LC 2YMUA 4U7AA 1RI6A 3F3FA 1QFSA 1U8CA 5TDHB 2XZGA 5FKTA 4X60B 1XIPA 2QXVA 1O6FA 4LG8A 2PM9B 2Z2PA 4J78A 4JT5C 3AL8A 3JRPA 4LGNA 2H13A 4O45A 4X63B 2OVRB 3JROA 3ODTA 2EIEA 2XDWA 4D0KA 2I0SA 3RLMD 1L0QA 4J81A 4RE5A 4BCBA 4FA5D 1XKSA 2QC5A 4Z8LA 3JZGA 2EIBA 4GM3A 2G9AA 4A0BA 4O3UB 3GD1I 1K3IA 4CI3A 2HXCA 3ZDYA 2VDKA 3CFSB 5CXCA 5C2VB 1OMWB 2H14A 3RFHA 3ZE1A 1GXRA 3ZE0A 3SVWD 2P9PC 3JZHA 4XYIA 3K26A 3EI1A 2I0TA 3F3PA 4GM8A 1B9XA 4DNUA 5CXBA 4G56B 1L5GA 4BCDA 3IKOA 5H14A 5FKSA 5K1CC 1UOPA 2VDMA 2OK4A 4X3EA 4AOWA 3K6SA 1JTDB 3JPXA 1QNIA 5I5IA 2VDQA 3J80g 4A0BB 4J77A 4NSXA
chains in the Genus database with same CATH topology
2HYEA 4EWRA 4K3JB 4E5ZB 3I7KA 1PEVA 2I3SA 5CYKA 5H1MA 1FWXA 4CY2A 4FHLA 2HJBA 3RRMC 3I7OA 2YNPA 4A08A 2OK6A 4IMMA 4MK0B 2P9UC 2H6QA 2AGLA 2H9LA 3OKWA 1GP2B 3OL2A 4JT6C 1JMZB 5IGOA 5HE1B 3DSMA 3EI2A 4O3TB 3ZWLB 2PBIB 4XEIC 5I5MA 3I2NA 5AFU3 2H6NA 2IUPA 4PBZA 4D6VA 3RFGA 3OKYA 2CE8A 1B9YA 2G99A 4ZOZA 3ULEC 5CXCB 3JAMg 2H9NA 3C99A 4A0AA 2GNQA 3JB9L 3PXSD 5H17A 4QL1A 4Y5RD 5IGQA 2CO0C 5KDOB 1SQJA 5HE0B 1XHMA 4H5JA 5HE2B 3I7NA 3SCYA 2UZXB 3EI4B 3VA6A 5THAA 4A0AB 2H68A 3RN1D 2HJ4A 3SMRA 3JZNA 3VH0A 4N14A 2Q7QA 3AL8B 1VYHC 4CY5A 4BH6A 4JSVC 3DXMC 3GFCA 3SWSD 2P9KC 4J73A 4L3GD 4ZOVA 2O9KA 1U4CA 5B4WA 1PI6A 3UVMA 1Q47A 5EM2A 4J8GA 4FAND 3UVKA 3PSLA 4JXMA 5EMMB 1MG3A 3CFVA 3OW8A 5I5JA 2HKMA 3I7HA 3HFQA 3GREA 4ERZA 2TRCB 2CN2A 4J8BA 2IURA 1R5MA 3AH8B 3L4OD 1U2VC 4FA1D 2YB8B 3OTTA 1P22A 4FAVD 1A0RB 2CNXA 2IUVA 3I89A 4A2MA 2GC7A 5IT9g 1S4UX 4JSNC 4CY1A 5EMLB 4GQ2P 3MMYA 4JD2C 4R7AB 3K27A 3MXXA 4GM9A 4PXWA 3I7LA 5TEEA 3I7PA 4A7JA 5C9ZB 4H5IA 4CI8A 4J86A 3UVOA 2GC4A 3EI3B 4O1QD 2HKRA 4CZYA 1K8KC 4YVDA 3BWSA 4BUJC 2OVPB 1N6FA 2YNNA 5HQGA 4ZOYA 2J55H 1GG2B 5SXMA 2XYIA 3FRXA 5EMJB 2AGYA 4E54A 1TBGA 2Z2NA 2CO0A 2MTAH 3SBQA 4GQBB 4X61B 2H6KA 4KFMB 3B7FA 2P9SC 3SLED 2PM9A 5JWZA 4ERQA 3OKTA 3SFZA 5EAPA 4ESGA 2H3XA 2XU7A 3BG1A 2IWKA 5FKQA 4K3ID 2AQ5A 1SQ9A 4GZ8A 3PE7A 4CY3A 3N0DA 3BG0A 3EWEA 5FQDA 5K19A 3PVWB 2BBKH 3C9CA 3PSCB 3F3GA 4BL0A 4PBYA 5FXYA 4QT8A 2H9MA 4J0WA 5AMSA 4HDJA 1NR0A 5GXIA 2I3TA 5FKRA 3UVLA 1MG2A 3DXKC 3AL9A 1OLZA 5EAMA 2UZYB 3MZKA 3NVXA 3EU7A 2IAAA 4CZVA 5HYNB 2J56H 4AEZA 4GGDA 3V7DB 1N6EA 4U1EI 3DWLC 3SBPA 4CC9A 2EBSA 3P4FA 4E5ZA 4L9OA 4UI9R 4L1QD 2PM7B 3SXTD 3UR4A 5GSAA 2W18A 4E54B 2XL3A 3OKYB 4A2LA 3MKQA 4ZN4A 3SN6B 1K32A 3SJLD 2AGZA 4PSWB 3RN0D 3EI2B 1NEXB 2I0RA 3C75H 4PSXB 3DM0A 2PM6B 3RSEC 4ES0A 5GMKn 5A2Qg 2H47A 4JSXC 3EI3A 2AH1A 3EMHA 2B4EA 4QRJA 1YFQA 4GMBA 4GQ1A 3IJCA 4GGCA 2OVQB 4O9DA 4CI1A 4J0XA 3CIKB 4J79A 1MDAH 3NVQA 3V5WB 3I8CA 4LG9A 3UVNA 4FA9D 4XYHA 3AFCA 5IC7A 4A09B 4CZXA 4L3HD 5TF2A 4OWRA 5TEFA 2IUQA 4FWWA 3IJ1A 3EI4A 2OJYA 3KRXB 2Z2OA 4IA9A 2CN3A 2XL2A 2IWFA 3V9FA 1SHYB 5IJ7E 3C5MA 3MKSB 2H9PA 2YNOA 3U4YA 4FA4D 4Y7RA 2B5LA 5EMKB 5CXBB 3MZLA 4ERYA 4FB1D 4ZOXA 1JMXB 3OL2B 2AH0A 3VGZA 1N6DA 3FGBA 4QQEA 3J81g 1PGUA 3KRWB 4J82A 1JJUB 4TZ4A 3W15A 2P9IC 3SHFA 2P9NC 5EALA 5GXHA 3PXTD 3I8EA 2B5NA 3N0EA 3PVUB 4JSPC 5CYKB 2HESX 4PC0A 3UKUC 4OZUA 1PBYB 2J57G 3NVNA 3ORVD 2B5MA 3IJ0A 1GOTB 1ERJA 2BCJB 4A09A 5IJ8E 3E0CA 5HE3B 4J87A 3IIWA 5FLXg 3A0FA 5AJAA 5FA5B 4A11A 3PXWD 2AGXA 3EG6A 5C2WB 3L4MD 5EARA 2YBAA 3SBRA 4I79A 4CI2A 4A11B 2OIZA 1JOFA 3UKRC 3FM0A 4PNKB 3RMZD 4A08B 4J84A 2AGWA 3EI1B 2CE9A 3IIYA 5EM2B 4GGAA 1TYQC 2P9LC 2YMUA 4U7AA 1RI6A 3F3FA 5TDHB 5FKTA 4X60B 1XIPA 2QXVA 4LG8A 2PM9B 2Z2PA 4J78A 4LGNA 3AL8A 3JRPA 4O45A 2H13A 4X63B 4JT5C 2OVRB 3JROA 3ODTA 4D0KA 2I0SA 3RLMD 1L0QA 4J81A 4FA5D 1XKSA 2QC5A 4Z8LA 4GM3A 3JZGA 2G9AA 4A0BA 4O3UB 4CI3A 2HXCA 3CFSB 5CXCA 5C2VB 1OMWB 2H14A 3RFHA 1GXRA 3SVWD 2P9PC 3JZHA 4XYIA 3K26A 3EI1A 2I0TA 3F3PA 4GM8A 1B9XA 5CXBA 4G56B 3IKOA 5H14A 5FKSA 5K1CC 2OK4A 4X3EA 4AOWA 3JPXA 1QNIA 5I5IA 3J80g 4A0BB 4J77A 4NSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYE A;  4EWR A;  4K3J B;  4E5Z B;  3I7K A;  1PEV A;  2I3S A;  5CYK A;  5H1M A;  1FWX A;  4CY2 A;  4FHL A;  2HJB A;  3RRM C;  3I7O A;  2YNP A;  4A08 A;  2OK6 A;  4IMM A;  4MK0 B;  2P9U C;  2H6Q A;  2AGL A;  2H9L A;  3OKW A;  1GP2 B;  3OL2 A;  4JT6 C;  1JMZ B;  5IGO A;  5HE1 B;  3DSM A;  3EI2 A;  4O3T B;  3ZWL B;  2PBI B;  4XEI C;  5I5M A;  3I2N A;  5AFU 3;  2H6N A;  2IUP A;  4PBZ A;  4D6V A;  3RFG A;  3OKY A;  2CE8 A;  1B9Y A;  2G99 A;  4ZOZ A;  3ULE C;  5CXC B;  3JAM g;  2H9N A;  3C99 A;  4A0A A;  2GNQ A;  3JB9 L;  3PXS D;  5H17 A;  4QL1 A;  4Y5R D;  5IGQ A;  2CO0 C;  5KDO B;  1SQJ A;  5HE0 B;  1XHM A;  4H5J A;  5HE2 B;  3I7N A;  3SCY A;  2UZX B;  3EI4 B;  3VA6 A;  5THA A;  4A0A B;  2H68 A;  3RN1 D;  2HJ4 A;  3SMR A;  3JZN A;  3VH0 A;  4N14 A;  2Q7Q A;  3AL8 B;  1VYH C;  4CY5 A;  4BH6 A;  4JSV C;  3DXM C;  3GFC A;  3SWS D;  2P9K C;  4J73 A;  4L3G D;  4ZOV A;  2O9K A;  1U4C A;  5B4W A;  1PI6 A;  3UVM A;  1Q47 A;  5EM2 A;  4J8G A;  4FAN D;  3UVK A;  3PSL A;  4JXM A;  5EMM B;  1MG3 A;  3CFV A;  3OW8 A;  5I5J A;  2HKM A;  3I7H A;  3HFQ A;  3GRE A;  4ERZ A;  2TRC B;  2CN2 A;  4J8B A;  2IUR A;  1R5M A;  3AH8 B;  3L4O D;  1U2V C;  4FA1 D;  2YB8 B;  3OTT A;  1P22 A;  4FAV D;  1A0R B;  2CNX A;  2IUV A;  3I89 A;  4A2M A;  2GC7 A;  5IT9 g;  1S4U X;  4JSN C;  4CY1 A;  5EML B;  4GQ2 P;  3MMY A;  4JD2 C;  4R7A B;  3K27 A;  3MXX A;  4GM9 A;  4PXW A;  3I7L A;  5TEE A;  3I7P A;  4A7J A;  5C9Z B;  4H5I A;  4CI8 A;  4J86 A;  3UVO A;  2GC4 A;  3EI3 B;  4O1Q D;  2HKR A;  4CZY A;  1K8K C;  4YVD A;  3BWS A;  4BUJ C;  2OVP B;  1N6F A;  2YNN A;  5HQG A;  4ZOY A;  2J55 H;  1GG2 B;  5SXM A;  2XYI A;  3FRX A;  5EMJ B;  2AGY A;  4E54 A;  1TBG A;  2Z2N A;  2CO0 A;  2MTA H;  3SBQ A;  4GQB B;  4X61 B;  2H6K A;  4KFM B;  3B7F A;  2P9S C;  3SLE D;  2PM9 A;  5JWZ A;  4ERQ A;  3OKT A;  3SFZ A;  5EAP A;  4ESG A;  2H3X A;  2XU7 A;  3BG1 A;  2IWK A;  5FKQ A;  4K3I D;  2AQ5 A;  1SQ9 A;  4GZ8 A;  3PE7 A;  4CY3 A;  3N0D A;  3BG0 A;  3EWE A;  5FQD A;  5K19 A;  3PVW B;  2BBK H;  3C9C A;  3PSC B;  3F3G A;  4BL0 A;  4PBY A;  5FXY A;  4QT8 A;  2H9M A;  4J0W A;  5AMS A;  4HDJ A;  1NR0 A;  5GXI A;  2I3T A;  5FKR A;  3UVL A;  1MG2 A;  3DXK C;  3AL9 A;  1OLZ A;  5EAM A;  2UZY B;  3MZK A;  3NVX A;  3EU7 A;  2IAA A;  4CZV A;  5HYN B;  2J56 H;  4AEZ A;  4GGD A;  3V7D B;  1N6E A;  4U1E I;  3DWL C;  3SBP A;  4CC9 A;  2EBS A;  3P4F A;  4E5Z A;  4L9O A;  4UI9 R;  4L1Q D;  2PM7 B;  3SXT D;  3UR4 A;  5GSA A;  2W18 A;  4E54 B;  2XL3 A;  3OKY B;  4A2L A;  3MKQ A;  4ZN4 A;  3SN6 B;  1K32 A;  3SJL D;  2AGZ A;  4PSW B;  3RN0 D;  3EI2 B;  1NEX B;  2I0R A;  3C75 H;  4PSX B;  3DM0 A;  2PM6 B;  3RSE C;  4ES0 A;  5GMK n;  5A2Q g;  2H47 A;  4JSX C;  3EI3 A;  2AH1 A;  3EMH A;  2B4E A;  4QRJ A;  1YFQ A;  4GMB A;  4GQ1 A;  3IJC A;  4GGC A;  2OVQ B;  4O9D A;  4CI1 A;  4J0X A;  3CIK B;  4J79 A;  1MDA H;  3NVQ A;  3V5W B;  3I8C A;  4LG9 A;  3UVN A;  4FA9 D;  4XYH A;  3AFC A;  5IC7 A;  4A09 B;  4CZX A;  4L3H D;  5TF2 A;  4OWR A;  5TEF A;  2IUQ A;  4FWW A;  3IJ1 A;  3EI4 A;  2OJY A;  3KRX B;  2Z2O A;  4IA9 A;  2CN3 A;  2XL2 A;  2IWF A;  3V9F A;  1SHY B;  5IJ7 E;  3C5M A;  3MKS B;  2H9P A;  2YNO A;  3U4Y A;  4FA4 D;  4Y7R A;  2B5L A;  5EMK B;  5CXB B;  3MZL A;  4ERY A;  4FB1 D;  4ZOX A;  1JMX B;  3OL2 B;  2AH0 A;  3VGZ A;  1N6D A;  3FGB A;  4QQE A;  3J81 g;  1PGU A;  3KRW B;  4J82 A;  1JJU B;  4TZ4 A;  3W15 A;  2P9I C;  3SHF A;  2P9N C;  5EAL A;  5GXH A;  3PXT D;  3I8E A;  2B5N A;  3N0E A;  3PVU B;  4JSP C;  5CYK B;  2HES X;  4PC0 A;  3UKU C;  4OZU A;  1PBY B;  2J57 G;  3NVN A;  3ORV D;  2B5M A;  3IJ0 A;  1GOT B;  1ERJ A;  2BCJ B;  4A09 A;  5IJ8 E;  3E0C A;  5HE3 B;  4J87 A;  3IIW A;  5FLX g;  3A0F A;  5AJA A;  5FA5 B;  4A11 A;  3PXW D;  2AGX A;  3EG6 A;  5C2W B;  3L4M D;  5EAR A;  2YBA A;  3SBR A;  4I79 A;  4CI2 A;  4A11 B;  2OIZ A;  1JOF A;  3UKR C;  3FM0 A;  4PNK B;  3RMZ D;  4A08 B;  4J84 A;  2AGW A;  3EI1 B;  2CE9 A;  3IIY A;  5EM2 B;  4GGA A;  1TYQ C;  2P9L C;  2YMU A;  4U7A A;  1RI6 A;  3F3F A;  5TDH B;  5FKT A;  4X60 B;  1XIP A;  2QXV A;  4LG8 A;  2PM9 B;  2Z2P A;  4J78 A;  4LGN A;  3AL8 A;  3JRP A;  4O45 A;  2H13 A;  4X63 B;  4JT5 C;  2OVR B;  3JRO A;  3ODT A;  4D0K A;  2I0S A;  3RLM D;  1L0Q A;  4J81 A;  4FA5 D;  1XKS A;  2QC5 A;  4Z8L A;  4GM3 A;  3JZG A;  2G9A A;  4A0B A;  4O3U B;  4CI3 A;  2HXC A;  3CFS B;  5CXC A;  5C2V B;  1OMW B;  2H14 A;  3RFH A;  1GXR A;  3SVW D;  2P9P C;  3JZH A;  4XYI A;  3K26 A;  3EI1 A;  2I0T A;  3F3P A;  4GM8 A;  1B9X A;  5CXB A;  4G56 B;  3IKO A;  5H14 A;  5FKS A;  5K1C C;  2OK4 A;  4X3E A;  4AOW A;  3JPX A;  1QNI A;  5I5I A;  3J80 g;  4A0B B;  4J77 A;  4NSX A; 
#chains in the Genus database with same CATH topology
 2HYE A;  4EWR A;  3NIF A;  4K3J B;  4E5Z B;  1UOQ A;  1C9I A;  3NID A;  3I7K A;  4WK0 A;  4RE6 A;  1PEV A;  4NBM A;  2I3S A;  5CYK A;  5H1M A;  3O4I A;  1FWX A;  4CY2 A;  4FHL A;  1I2M B;  3O4H A;  2HJB A;  3RRM C;  3I7O A;  2YNP A;  4A08 A;  4MMX A;  5M5U A;  2OK6 A;  4IMM A;  4MK0 B;  2P9U C;  2H6Q A;  2AGL A;  2H9L A;  5C92 A;  3OKW A;  1GP2 B;  3OL2 A;  4JT6 C;  4G1M A;  1JMZ B;  5IGO A;  1O6G A;  4MMZ A;  5HE1 B;  3DSM A;  3EI2 A;  4O3T B;  3ZWL B;  2PBI B;  4XEI C;  5I5M A;  3I2N A;  5AFU 3;  2H6N A;  2IUP A;  4PBZ A;  4D6V A;  1E5T A;  3RFG A;  3OKY A;  4AN1 A;  2CE8 A;  1B9Y A;  2G99 A;  4ZOZ A;  3ULE C;  5CXC B;  3JAM g;  2H9N A;  3C99 A;  4A0A A;  2GNQ A;  3IUR A;  3QHY B;  3PXS D;  4DNW A;  5H17 A;  3JB9 L;  4QL1 A;  4Y5R D;  5IGQ A;  2CO0 C;  5KDO B;  1SQJ A;  5HE0 B;  1XHM A;  4H5J A;  5HE2 B;  3I7N A;  4JHP C;  3SCY A;  4Z7Q A;  2UZX B;  3EI4 B;  3VA6 A;  5THA A;  4QAM A;  1E8M A;  4BCC A;  4A0A B;  5HDB A;  2H68 A;  3FCS A;  2HJ4 A;  3RN1 D;  3SMR A;  3JZN A;  3VH0 A;  4NC4 A;  1UOO A;  4N14 A;  2Q7Q A;  3AL8 B;  2VDR A;  1VYH C;  4CY5 A;  4BH6 A;  4JSV C;  4WJK A;  3DXM C;  3GFC A;  3SWS D;  5M5R A;  2P9K C;  4J73 A;  4L3G D;  4ZOV A;  2O9K A;  1U4C A;  4MMY A;  5B4W A;  1PI6 A;  3UVM A;  1Q47 A;  5EM2 A;  4J8G A;  4FAN D;  3UVK A;  3PSL A;  1GOG A;  4JXM A;  5EMM B;  4JHN A;  1MG3 A;  3CFV A;  3KCI A;  3OW8 A;  5I5J A;  2HKM A;  2VDN A;  3HFQ A;  3I7H A;  4WK4 A;  1C9L A;  3GRE A;  4ERZ A;  2TRC B;  2CN2 A;  3VI3 A;  4J8B A;  2IUR A;  1R5M A;  3AH8 B;  3L4O D;  3O4G A;  1U2V C;  4NEN A;  4FA1 D;  2YB8 B;  3OTT A;  1P22 A;  4FAV D;  1A0R B;  2CNX A;  2IUV A;  3I89 A;  1VZ3 A;  4A2M A;  2GC7 A;  5IT9 g;  1S4U X;  4JSN C;  4CY1 A;  5EML B;  4GQ2 P;  3MMY A;  4JD2 C;  4R7A B;  3K27 A;  3MXX A;  4GM9 A;  4PXW A;  3VI4 A;  2EID A;  3I7L A;  5TEE A;  3I7P A;  4DNV A;  4A7J A;  5C9Z B;  4H5I A;  4CI8 A;  4J86 A;  3UVO A;  4O2W A;  2VDP A;  2GC4 A;  3ZDX A;  3EI3 B;  4O1Q D;  2HKR A;  4CZY A;  1K8K C;  5M5S A;  2XE4 A;  4O02 A;  4YVD A;  3BWS A;  4BUJ C;  2OVP B;  3T3M A;  1N6F A;  2YNN A;  5HQG A;  4ZOY A;  2J55 H;  1GG2 B;  5E6U A;  5SXM A;  2XYI A;  3FRX A;  5EMJ B;  2AGY A;  4E54 A;  1M1X A;  1TBG A;  2Z2N A;  1H2W A;  2CO0 A;  3IVM A;  2MTA H;  3SBQ A;  4GQB B;  4X61 B;  2H6K A;  4KFM B;  3B7F A;  2P9S C;  3IUN A;  3SLE D;  3V4P A;  1GOH A;  2PM9 A;  1UTC A;  5JWZ A;  4ERQ A;  3OKT A;  3SFZ A;  5EAP A;  4ESG A;  2H3X A;  2XU7 A;  3BG1 A;  2IWK A;  5FKQ A;  4K3I D;  2AQ5 A;  2JKX A;  1SQ9 A;  3K72 A;  4GZ8 A;  3PE7 A;  4CY3 A;  3N0D A;  3BG0 A;  3EWE A;  5FQD A;  5K19 A;  3PVW B;  2BBK H;  3C9C A;  4AMY A;  3PSC B;  3F3G A;  4BL0 A;  1BPO A;  4BP8 A;  4PBY A;  5FXY A;  4QT8 A;  2H9M A;  4J0W A;  5AMS A;  4HDJ A;  1NR0 A;  5GXI A;  2I3T A;  5FKR A;  3UVL A;  1MG2 A;  3DXK C;  1A12 A;  3AL9 A;  1OLZ A;  5EAM A;  2UZY B;  3QI0 A;  3MZK A;  2VC2 A;  3NVX A;  3EU7 A;  2IAA A;  4CZV A;  4UM8 A;  5HYN B;  2J56 H;  4AEZ A;  4GGD A;  3V7D B;  1N6E A;  4U1E I;  1JV2 A;  1E8N A;  3DWL C;  2HU8 A;  3IUM A;  3MUO A;  1VE6 A;  3SBP A;  4CC9 A;  3MVD K;  2VDO A;  2EBS A;  3P4F A;  4E5Z A;  4L9O A;  4UI9 R;  4L1Q D;  2PM7 B;  3SXT D;  3UR4 A;  5GSA A;  2W18 A;  4E54 B;  3EQ8 A;  2XL3 A;  3OKY B;  4A2L A;  5FFO A;  3MKQ A;  4ZN4 A;  3SN6 B;  1K32 A;  5M5V A;  3SJL D;  2AGZ A;  4PSW B;  3RN0 D;  3EI2 B;  1NEX B;  2HU5 A;  4G1E A;  3O4J A;  2I0R A;  5C86 A;  3C75 H;  1VZ2 A;  4PSX B;  3DM0 A;  2PM6 B;  3RSE C;  4ES0 A;  5GMK n;  1YR2 A;  5A2Q g;  2H47 A;  4JSX C;  3EI3 A;  2AH1 A;  3EMH A;  2B4E A;  4QRJ A;  4Z7O A;  1YFQ A;  2BKL A;  4Z7N A;  4GMB A;  4GQ1 A;  3IJC A;  4GGC A;  2OVQ B;  3T3P A;  4O9D A;  4AN0 A;  4CI1 A;  4J0X A;  3CIK B;  1MDA H;  4J79 A;  3ZE2 A;  3NVQ A;  4BP9 A;  3V5W B;  3IUQ A;  3I8C A;  4UM9 A;  4LG9 A;  3UVN A;  4FA9 D;  4XYH A;  3AFC A;  5IC7 A;  4A09 B;  4CZX A;  2HU7 A;  4L3H D;  5TF2 A;  4OWR A;  3NIG A;  5TEF A;  2IUQ A;  4FWW A;  1H2Z A;  3IJ1 A;  3EI4 A;  2OJY A;  1GOF A;  2QZP A;  3KRX B;  2Z2O A;  4IA9 A;  4D9S A;  2CN3 A;  2XL2 A;  2IWF A;  3V9F A;  1SHY B;  5IJ7 E;  3C5M A;  3MKS B;  2H9P A;  2YNO A;  3U4Y A;  2QR5 A;  3K71 A;  4FA4 D;  4Y7R A;  5M61 A;  2B5L A;  2VZ1 A;  5EMK B;  3IUJ A;  5CXB B;  3MZL A;  3EQ7 A;  4ERY A;  4FB1 D;  4ZOX A;  1JMX B;  3OL2 B;  1TYE A;  2AH0 A;  4NAA A;  3VGZ A;  1N6D A;  3FGB A;  3OF7 A;  3IJE A;  4IRZ A;  4QQE A;  3EQ9 A;  3J81 g;  1PGU A;  2VZ3 A;  3KRW B;  4J82 A;  5FFG A;  5E6R A;  1JJU B;  4TZ4 A;  4G55 A;  3DDU A;  3W15 A;  2P9I C;  3SHF A;  2P9N C;  5EAL A;  5GXH A;  3PXT D;  1T2X A;  3I8E A;  2B5N A;  1VE7 A;  3N0E A;  3PVU B;  4JSP C;  5CYK B;  2HES X;  4PC0 A;  3UKU C;  4OZU A;  4WK2 A;  5E6S A;  1PBY B;  1H2X A;  2J57 G;  3NVN A;  3GC3 B;  3ORV D;  2VDL A;  2B5M A;  3IJ0 A;  1GOT B;  1ERJ A;  2BCJ B;  3FCU A;  4A09 A;  5IJ8 E;  4L1M A;  3E0C A;  5HE3 B;  3V4V A;  4J87 A;  3IIW A;  5FLX g;  3IUL A;  3A0F A;  3MUN A;  5AJA A;  5FA5 B;  4A11 A;  3PXW D;  2AGX A;  3EG6 A;  5C2W B;  5M5T A;  2WQ8 A;  1QFM A;  3L4M D;  5EAR A;  2YBA A;  3SBR A;  4I79 A;  4AMZ A;  4CI2 A;  4A11 B;  2OIZ A;  1JOF A;  3UKR C;  3FM0 A;  4PNK B;  3RMZ D;  4A08 B;  1H2Y A;  4J84 A;  2AGW A;  4AX4 A;  3EI1 B;  3ZDZ A;  2CE9 A;  3IIY A;  5EM2 B;  2EIC A;  4GGA A;  1TYQ C;  2P9L C;  2YMU A;  4U7A A;  1RI6 A;  3F3F A;  1QFS A;  1U8C A;  5TDH B;  2XZG A;  5FKT A;  4X60 B;  1XIP A;  2QXV A;  1O6F A;  4LG8 A;  2PM9 B;  2Z2P A;  4J78 A;  4JT5 C;  3AL8 A;  3JRP A;  4LGN A;  2H13 A;  4O45 A;  4X63 B;  2OVR B;  3JRO A;  3ODT A;  2EIE A;  2XDW A;  4D0K A;  2I0S A;  3RLM D;  1L0Q A;  4J81 A;  4RE5 A;  4BCB A;  4FA5 D;  1XKS A;  2QC5 A;  4Z8L A;  3JZG A;  2EIB A;  4GM3 A;  2G9A A;  4A0B A;  4O3U B;  3GD1 I;  1K3I A;  4CI3 A;  2HXC A;  3ZDY A;  2VDK A;  3CFS B;  5CXC A;  5C2V B;  1OMW B;  2H14 A;  3RFH A;  3ZE1 A;  1GXR A;  3ZE0 A;  3SVW D;  2P9P C;  3JZH A;  4XYI A;  3K26 A;  3EI1 A;  2I0T A;  3F3P A;  4GM8 A;  1B9X A;  4DNU A;  5CXB A;  4G56 B;  1L5G A;  4BCD A;  3IKO A;  5H14 A;  5FKS A;  5K1C C;  1UOP A;  2VDM A;  2OK4 A;  4X3E A;  4AOW A;  3K6S A;  1JTD B;  3JPX A;  1QNI A;  5I5I A;  2VDQ A;  3J80 g;  4A0B B;  4J77 A;  4NSX A; 
#chains in the Genus database with same CATH homology
 2HYE A;  4EWR A;  4K3J B;  4E5Z B;  3I7K A;  1PEV A;  2I3S A;  5CYK A;  5H1M A;  1FWX A;  4CY2 A;  4FHL A;  2HJB A;  3RRM C;  3I7O A;  2YNP A;  4A08 A;  2OK6 A;  4IMM A;  4MK0 B;  2P9U C;  2H6Q A;  2AGL A;  2H9L A;  3OKW A;  1GP2 B;  3OL2 A;  4JT6 C;  1JMZ B;  5IGO A;  5HE1 B;  3DSM A;  3EI2 A;  4O3T B;  3ZWL B;  2PBI B;  4XEI C;  5I5M A;  3I2N A;  5AFU 3;  2H6N A;  2IUP A;  4PBZ A;  4D6V A;  3RFG A;  3OKY A;  2CE8 A;  1B9Y A;  2G99 A;  4ZOZ A;  3ULE C;  5CXC B;  3JAM g;  2H9N A;  3C99 A;  4A0A A;  2GNQ A;  3JB9 L;  3PXS D;  5H17 A;  4QL1 A;  4Y5R D;  5IGQ A;  2CO0 C;  5KDO B;  1SQJ A;  5HE0 B;  1XHM A;  4H5J A;  5HE2 B;  3I7N A;  3SCY A;  2UZX B;  3EI4 B;  3VA6 A;  5THA A;  4A0A B;  2H68 A;  3RN1 D;  2HJ4 A;  3SMR A;  3JZN A;  3VH0 A;  4N14 A;  2Q7Q A;  3AL8 B;  1VYH C;  4CY5 A;  4BH6 A;  4JSV C;  3DXM C;  3GFC A;  3SWS D;  2P9K C;  4J73 A;  4L3G D;  4ZOV A;  2O9K A;  1U4C A;  5B4W A;  1PI6 A;  3UVM A;  1Q47 A;  5EM2 A;  4J8G A;  4FAN D;  3UVK A;  3PSL A;  4JXM A;  5EMM B;  1MG3 A;  3CFV A;  3OW8 A;  5I5J A;  2HKM A;  3I7H A;  3HFQ A;  3GRE A;  4ERZ A;  2TRC B;  2CN2 A;  4J8B A;  2IUR A;  1R5M A;  3AH8 B;  3L4O D;  1U2V C;  4FA1 D;  2YB8 B;  3OTT A;  1P22 A;  4FAV D;  1A0R B;  2CNX A;  2IUV A;  3I89 A;  4A2M A;  2GC7 A;  5IT9 g;  1S4U X;  4JSN C;  4CY1 A;  5EML B;  4GQ2 P;  3MMY A;  4JD2 C;  4R7A B;  3K27 A;  3MXX A;  4GM9 A;  4PXW A;  3I7L A;  5TEE A;  3I7P A;  4A7J A;  5C9Z B;  4H5I A;  4CI8 A;  4J86 A;  3UVO A;  2GC4 A;  3EI3 B;  4O1Q D;  2HKR A;  4CZY A;  1K8K C;  4YVD A;  3BWS A;  4BUJ C;  2OVP B;  1N6F A;  2YNN A;  5HQG A;  4ZOY A;  2J55 H;  1GG2 B;  5SXM A;  2XYI A;  3FRX A;  5EMJ B;  2AGY A;  4E54 A;  1TBG A;  2Z2N A;  2CO0 A;  2MTA H;  3SBQ A;  4GQB B;  4X61 B;  2H6K A;  4KFM B;  3B7F A;  2P9S C;  3SLE D;  2PM9 A;  5JWZ A;  4ERQ A;  3OKT A;  3SFZ A;  5EAP A;  4ESG A;  2H3X A;  2XU7 A;  3BG1 A;  2IWK A;  5FKQ A;  4K3I D;  2AQ5 A;  1SQ9 A;  4GZ8 A;  3PE7 A;  4CY3 A;  3N0D A;  3BG0 A;  3EWE A;  5FQD A;  5K19 A;  3PVW B;  2BBK H;  3C9C A;  3PSC B;  3F3G A;  4BL0 A;  4PBY A;  5FXY A;  4QT8 A;  2H9M A;  4J0W A;  5AMS A;  4HDJ A;  1NR0 A;  5GXI A;  2I3T A;  5FKR A;  3UVL A;  1MG2 A;  3DXK C;  3AL9 A;  1OLZ A;  5EAM A;  2UZY B;  3MZK A;  3NVX A;  3EU7 A;  2IAA A;  4CZV A;  5HYN B;  2J56 H;  4AEZ A;  4GGD A;  3V7D B;  1N6E A;  4U1E I;  3DWL C;  3SBP A;  4CC9 A;  2EBS A;  3P4F A;  4E5Z A;  4L9O A;  4UI9 R;  4L1Q D;  2PM7 B;  3SXT D;  3UR4 A;  5GSA A;  2W18 A;  4E54 B;  2XL3 A;  3OKY B;  4A2L A;  3MKQ A;  4ZN4 A;  3SN6 B;  1K32 A;  3SJL D;  2AGZ A;  4PSW B;  3RN0 D;  3EI2 B;  1NEX B;  2I0R A;  3C75 H;  4PSX B;  3DM0 A;  2PM6 B;  3RSE C;  4ES0 A;  5GMK n;  5A2Q g;  2H47 A;  4JSX C;  3EI3 A;  2AH1 A;  3EMH A;  2B4E A;  4QRJ A;  1YFQ A;  4GMB A;  4GQ1 A;  3IJC A;  4GGC A;  2OVQ B;  4O9D A;  4CI1 A;  4J0X A;  3CIK B;  4J79 A;  1MDA H;  3NVQ A;  3V5W B;  3I8C A;  4LG9 A;  3UVN A;  4FA9 D;  4XYH A;  3AFC A;  5IC7 A;  4A09 B;  4CZX A;  4L3H D;  5TF2 A;  4OWR A;  5TEF A;  2IUQ A;  4FWW A;  3IJ1 A;  3EI4 A;  2OJY A;  3KRX B;  2Z2O A;  4IA9 A;  2CN3 A;  2XL2 A;  2IWF A;  3V9F A;  1SHY B;  5IJ7 E;  3C5M A;  3MKS B;  2H9P A;  2YNO A;  3U4Y A;  4FA4 D;  4Y7R A;  2B5L A;  5EMK B;  5CXB B;  3MZL A;  4ERY A;  4FB1 D;  4ZOX A;  1JMX B;  3OL2 B;  2AH0 A;  3VGZ A;  1N6D A;  3FGB A;  4QQE A;  3J81 g;  1PGU A;  3KRW B;  4J82 A;  1JJU B;  4TZ4 A;  3W15 A;  2P9I C;  3SHF A;  2P9N C;  5EAL A;  5GXH A;  3PXT D;  3I8E A;  2B5N A;  3N0E A;  3PVU B;  4JSP C;  5CYK B;  2HES X;  4PC0 A;  3UKU C;  4OZU A;  1PBY B;  2J57 G;  3NVN A;  3ORV D;  2B5M A;  3IJ0 A;  1GOT B;  1ERJ A;  2BCJ B;  4A09 A;  5IJ8 E;  3E0C A;  5HE3 B;  4J87 A;  3IIW A;  5FLX g;  3A0F A;  5AJA A;  5FA5 B;  4A11 A;  3PXW D;  2AGX A;  3EG6 A;  5C2W B;  3L4M D;  5EAR A;  2YBA A;  3SBR A;  4I79 A;  4CI2 A;  4A11 B;  2OIZ A;  1JOF A;  3UKR C;  3FM0 A;  4PNK B;  3RMZ D;  4A08 B;  4J84 A;  2AGW A;  3EI1 B;  2CE9 A;  3IIY A;  5EM2 B;  4GGA A;  1TYQ C;  2P9L C;  2YMU A;  4U7A A;  1RI6 A;  3F3F A;  5TDH B;  5FKT A;  4X60 B;  1XIP A;  2QXV A;  4LG8 A;  2PM9 B;  2Z2P A;  4J78 A;  4LGN A;  3AL8 A;  3JRP A;  4O45 A;  2H13 A;  4X63 B;  4JT5 C;  2OVR B;  3JRO A;  3ODT A;  4D0K A;  2I0S A;  3RLM D;  1L0Q A;  4J81 A;  4FA5 D;  1XKS A;  2QC5 A;  4Z8L A;  4GM3 A;  3JZG A;  2G9A A;  4A0B A;  4O3U B;  4CI3 A;  2HXC A;  3CFS B;  5CXC A;  5C2V B;  1OMW B;  2H14 A;  3RFH A;  1GXR A;  3SVW D;  2P9P C;  3JZH A;  4XYI A;  3K26 A;  3EI1 A;  2I0T A;  3F3P A;  4GM8 A;  1B9X A;  5CXB A;  4G56 B;  3IKO A;  5H14 A;  5FKS A;  5K1C C;  2OK4 A;  4X3E A;  4AOW A;  3JPX A;  1QNI A;  5I5I A;  3J80 g;  4A0B B;  4J77 A;  4NSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...