2HJBA

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
358
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 92
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hjbA01
3BWSA 1A0RB 2OJYA 3PE7A 3PSLA 4FA5D 5GMKn 4R7AB 4J87A 2P9SC 5HYNB 3OTTA 5HE0B 2HYEA 1TYQC 2H14A 2YB8B 2OVQB 1L0QA 3EI3A 3IKOA 3I7KA 2H9NA 4A0AB 2HJ4A 2AH1A 3JB9L 4ZOYA 3L4OD 4CI3A 5FKSA 5THAA 4O9DA 2AGXA 5B4WA 3P4FA 4GQ1A 4PC0A 3RSEC 4ZOVA 2IAAA 4GGDA 3DWLC 5CYKB 4J77A 2H6QA 3C75H 4O3TB 4A0BA 3ORVD 4GZ8A 3PVWB 4JSPC 5EM2A 2I0SA 5HQGA 1Q47A 3NVXA 1PGUA 3IJ1A 4JSNC 4PXWA 2P9LC 1N6DA 2IWKA 3F3GA 5H17A 5HE1B 2GC4A 3E0CA 2OVPB 3AFCA 3PVUB 3KRWB 2OK4A 1GOTB 1XHMA 4J73A 3AH8B 3UKRC 4E54A 4H5JA 1OLZA 2H6KA 2PM9B 3MXXA 2CO0A 1R5MA 2GNQA 4GMBA 4L9OA 3GREA 3DXMC 1GXRA 4O3UB 2XL2A 2YNOA 2H3XA 3ZWLB 1JJUB 2BCJB 2B5MA 4K3ID 2P9UC 4FAVD 4QT8A 3UVOA 3HFQA 3EI1A 3I2NA 4XEIC 3AL8A 3BG1A 1N6EA 2J55H 3NVNA 2J57G 4CZYA 2HKRA 2TRCB 4JT6C 1P22A 3W15A 4JT5C 1JMZB 3F3FA 4Z8LA 3SMRA 5HE3B 5IGQA 3UKUC 4K3JB 3DXKC 4PBZA 3EWEA 3I7HA 3DM0A 4FA9D 2HESX 3CFSB 3OKYB 4GM8A 3B7FA 5K1CC 4E5ZB 2B4EA 3V7DB 4X3EA 2I0TA 4LG8A 2IUPA 4G56B 4X61B 5EMKB 2XU7A 2H9PA 3OKTA 4A08B 2H68A 4XYHA 3UR4A 2HJBA 4FA4D 5CXBA 5SXMA 4NSXA 3C99A 4GQ2P 3UVLA 4FA1D 3J81g 5AMSA 5C2WB 3V9FA 4J78A 4ZN4A 4CZVA 3EI2A 2H47A 3FRXA 3RMZD 3RN0D 3OL2B 4J82A 3I8CA 4D0KA 1PI6A 3IJ0A 3I89A 5IGOA 3IIWA 1FWXA 4CZXA 5FKQA 2BBKH 2O9KA 2Q7QA 2AGZA 3JRPA 5FLXg 2B5NA 4QQEA 3SWSD 2GC7A 4AEZA 2P9PC 2AGYA 5FKRA 2OIZA 4U1EI 3CFVA 3EI4A 5EAPA 2PBIB 4A7JA 4D6VA 2UZXB 4BL0A 4Y7RA 3I7LA 4OWRA 3SHFA 5AFU3 5H14A 4FAND 2Z2NA 4A11A 2H9MA 4MK0B 4OZUA 3OKYA 5IC7A 4FB1D 5JWZA 1SHYB 4IMMA 2IUQA 3PXWD 4ERZA 3DSMA 4J8BA 4AOWA 3EU7A 3RRMC 4CC9A 3FM0A 4X60B 4A2LA 4PSWB 4A08A 5IJ8E 3MKSB 4X63B 4LG9A 3UVMA 4QRJA 4A09B 5TF2A 4A0AA 1MDAH 4L1QD 3EMHA 5FA5B 3AL9A 4CI8A 3NVQA 3OL2A 5A2Qg 3FGBA 2AGLA 2CNXA 3JPXA 4EWRA 3SBRA 3I8EA 2HXCA 3JZGA 3RN1D 3EI3B 2P9IC 2AH0A 2QXVA 5CYKA 2H6NA 2YNNA 3SCYA 4CY2A 4KFMB 2IURA 3JZNA 2XL3A 1K8KC 1XIPA 1MG2A 2YNPA 5CXCB 3MKQA 1NEXB 3C5MA 3MMYA 2CN3A 4IA9A 3VGZA 4CI2A 3SBPA 4H5IA 4L3HD 4TZ4A 4LGNA 2MTAH 2OK6A 3ODTA 3RFHA 2I0RA 3I7PA 5FXYA 3I7OA 5EMMB 4ESGA 5EM2B 1RI6A 4CI1A 3RFGA 1K32A 1B9YA 2IUVA 2P9KC 2Z2PA 4UI9R 3SN6B 4N14A 3K27A 3SJLD 2H13A 2PM9A 4U7AA 3U4YA 2CE9A 2UZYB 5I5IA 4ES0A 2CN2A 4ZOXA 1XKSA 3L4MD 3F3PA 4A09A 1JMXB 1MG3A 1GG2B 1U4CA 1OMWB 3V5WB 1QNIA 4GQBB 4E54B 4L3GD 5K19A 5HE2B 1B9XA 3A0FA 4QL1A 3JAMg 4ZOZA 1ERJA 5TEFA 2I3SA 4GM3A 4GM9A 4J84A 3UVNA 3PXSD 2P9NC 1S4UX 4JD2C 3PXTD 3SFZA 4FWWA 1JOFA 4BH6A 4PNKB 1YFQA 2J56H 4BUJC 3GFCA 4Y5RD 5I5JA 5GXIA 3JZHA 4JSVC 5C2VB 3SXTD 4GGAA 2W18A 5CXCA 1SQJA 2PM7B 5TEEA 4I79A 5KDOB 3I7NA 3EI1B 3AL8B 4ERYA 4E5ZA 5GSAA 2CO0C 3CIKB 4J0WA 3BG0A 3N0EA 4J79A 4O1QD 3SBQA 2G9AA 4A2MA 3UVKA 3VA6A 5IJ7E 2YBAA 5I5MA 4ERQA 4J0XA 3K26A 3SLED 1GP2B 2AGWA 1TBGA 3IIYA 3N0DA 3J80g 4J8GA 5GXHA 1PBYB 2YMUA 1PEVA 1U2VC 1SQ9A 2XYIA 4FHLA 5IT9g 1VYHC 5CXBB 4PSXB 3JROA 2I3TA 1N6FA 1NR0A 5EALA 4J86A 2PM6B 2HKMA 4J81A 5FQDA 3EI2B 5EAMA 2AQ5A 4JXMA 2CE8A 5FKTA 4GGCA 4PBYA 3ULEC 5EMJB 2QC5A 2G99A 5TDHB 2B5LA 3IJCA 2H9LA 3RLMD 5EMLB 3PSCB 4XYIA 2IWFA 5EARA 5H1MA 4A0BB 2Z2OA 3VH0A 3EI4B 4JSXC 3SVWD 4CY1A 3MZLA 3OKWA 5C9ZB 4YVDA 2EBSA 2OVRB 4CY3A 4A11B 4HDJA 3EG6A 3C9CA 5AJAA 4O45A 4CY5A 3MZKA 3KRXB 3OW8A
chains in the Genus database with same CATH superfamily
3BWSA 1A0RB 2OJYA 3PE7A 3PSLA 4FA5D 5GMKn 4R7AB 3VI4A 3ZDXA 4J87A 3V4PA 2P9SC 5HYNB 3OTTA 5HE0B 2HYEA 1TYQC 2H14A 2YB8B 2OVQB 1L0QA 3EI3A 3IKOA 3I7KA 2H9NA 4A0AB 2HJ4A 4G1MA 2AH1A 3JB9L 4MMYA 4ZOYA 3L4OD 4CI3A 5FKSA 3ZDZA 5THAA 3O4IA 3IUQA 5M5TA 4O9DA 2AGXA 5B4WA 3P4FA 3VI3A 3IULA 4GQ1A 4PC0A 3RSEC 4ZOVA 2IAAA 4GGDA 3DWLC 5CYKB 4J77A 2H6QA 3C75H 4O3TB 1M1XA 4A0BA 3ORVD 1GOHA 4GZ8A 3PVWB 4JSPC 5EM2A 2I0SA 5HQGA 1Q47A 3NVXA 1PGUA 3IJ1A 4JSNC 4Z7OA 2XE4A 4PXWA 2P9LC 5M5UA 1N6DA 1H2ZA 2IWKA 3F3GA 4O2WA 5H17A 5HE1B 2GC4A 2VDRA 3E0CA 2OVPB 3AFCA 3PVUB 4RE6A 1GOFA 3KRWB 2OK4A 1GOTB 1XHMA 4J73A 3AH8B 3UKRC 4E54A 4H5JA 1OLZA 2H6KA 4O02A 2PM9B 1K3IA 4WK4A 3MXXA 3NIDA 3EQ7A 2CO0A 1R5MA 2GNQA 4GMBA 4L9OA 1VE7A 3GREA 2VC2A 3DXMC 1GXRA 4O3UB 1VZ2A 2XL2A 2YNOA 2H3XA 3K71A 4MMXA 3ZWLB 1JJUB 3EQ9A 3K72A 3T3MA 2BCJB 2B5MA 4K3ID 2VDNA 2P9UC 3NIFA 4FAVD 4QT8A 3UVOA 3HFQA 5C86A 3EI1A 3I2NA 4XEIC 3AL8A 3BG1A 1N6EA 2J55H 3NVNA 2J57G 1H2WA 2HKRA 4CZYA 2TRCB 4JT6C 1P22A 3W15A 4JT5C 1JMZB 3F3FA 4Z8LA 3SMRA 5HE3B 5IGQA 3UKUC 4K3JB 3DXKC 3QHYB 4PBZA 3EWEA 3I7HA 3DM0A 3V4VA 2VZ1A 4FA9D 2HESX 3CFSB 3OKYB 3IUNA 3B7FA 4GM8A 5K1CC 1TYEA 2B4EA 4E5ZB 4NENA 3V7DB 4X3EA 3ZE0A 2I0TA 3QI0A 4LG8A 1YR2A 1VE6A 2IUPA 2HU8A 1C9LA 2XZGA 4G56B 4X61B 5EMKB 4DNWA 2VDPA 2XU7A 2H9PA 3OKTA 4A08B 2H68A 4XYHA 3UR4A 2HJBA 1A12A 4FA4D 5M5SA 5CXBA 5SXMA 4QAMA 4NSXA 1I2MB 3C99A 4GQ2P 3FCUA 3UVLA 4FA1D 3J81g 5AMSA 5C2WB 3V9FA 4J78A 3ZDYA 4CZVA 4ZN4A 2H47A 3FRXA 3RMZD 3EI2A 3KCIA 3RN0D 3OL2B 4J82A 3I8CA 4D0KA 1PI6A 3IJ0A 3I89A 5IGOA 3K6SA 3IIWA 1FWXA 4CZXA 5E6RA 4NAAA 1L5GA 5FKQA 4DNUA 2BBKH 2O9KA 2Q7QA 3O4HA 1C9IA 2AGZA 3JRPA 5FLXg 2B5NA 3IURA 4QQEA 4L1MA 2GC7A 3SWSD 4AEZA 2XDWA 2P9PC 2AGYA 5FKRA 3DDUA 2OIZA 4U1EI 3CFVA 4JHNA 3EI4A 5EAPA 2PBIB 4A7JA 4RE5A 4D6VA 2UZXB 4BL0A 4Y7RA 3I7LA 4OWRA 3SHFA 5AFU3 2VDOA 5H14A 4FAND 2Z2NA 4G1EA 2H9MA 4MK0B 4A11A 4OZUA 3OKYA 5IC7A 4FB1D 5JWZA 1SHYB 3IUMA 2IUQA 4IMMA 3PXWD 4ERZA 3DSMA 1E8NA 3O4JA 4J8BA 4AOWA 3EU7A 3RRMC 4CC9A 3FM0A 4X60B 4A2LA 1UTCA 1UOOA 4PSWB 4A08A 5IJ8E 3MKSB 4X63B 2VDKA 4LG9A 3UVMA 4QRJA 4D9SA 4A09B 2EIBA 5TF2A 3IUJA 4MMZA 4A0AA 1MDAH 4L1QD 2VDMA 3EMHA 5FA5B 3AL9A 4CI8A 3NVQA 3OL2A 5A2Qg 3FGBA 4JHPC 4UM8A 5E6SA 2AGLA 2CNXA 3JPXA 4EWRA 3SBRA 3I8EA 2HXCA 1GOGA 3JZGA 3RN1D 2WQ8A 3IVMA 2QZPA 4AX4A 3EI3B 1E5TA 3GD1I 2P9IC 5M5RA 2AH0A 2QXVA 5CYKA 2EICA 2H6NA 2YNNA 3SCYA 5M61A 4CY2A 4KFMB 2IURA 3JZNA 2JKXA 2XL3A 1K8KC 1XIPA 1MG2A 2YNPA 2EIEA 3NIGA 5CXCB 3MKQA 5FFGA 3MMYA 1NEXB 3C5MA 2CN3A 3OF7A 4IA9A 3VGZA 4CI2A 3SBPA 4H5IA 4L3HD 1O6FA 4TZ4A 4LGNA 2MTAH 2OK6A 3ODTA 3RFHA 2I0RA 3I7PA 5FXYA 4BP9A 3I7OA 5EMMB 4ESGA 5EM2B 4BCCA 1RI6A 4CI1A 3RFGA 1K32A 1B9YA 2EIDA 3EQ8A 2IUVA 2P9KC 2Z2PA 4UI9R 3SN6B 4N14A 3K27A 1JTDB 3SJLD 2H13A 2PM9A 4U7AA 3U4YA 2CE9A 2UZYB 2VZ3A 5I5IA 3MVDK 4ES0A 2CN2A 4ZOXA 1XKSA 3L4MD 3F3PA 4A09A 1MG3A 1JMXB 1GG2B 1U4CA 1OMWB 1O6GA 3V5WB 2VDQA 1QNIA 4GQBB 4BCDA 4E54B 4L3GD 5K19A 5FFOA 1B9XA 5HE2B 4AMZA 3A0FA 1UOQA 1T2XA 4QL1A 4WK0A 3MUOA 4Z7QA 4ZOZA 1ERJA 3JAMg 5TEFA 4DNVA 2I3SA 4GM3A 4GM9A 4J84A 3ZE2A 3UVNA 3PXSD 2P9NC 1S4UX 4JD2C 4WJKA 3PXTD 3SFZA 4FWWA 2BKLA 1JOFA 4BH6A 4PNKB 1YFQA 2J56H 4BUJC 3GFCA 4Y5RD 5I5JA 5GXIA 3JZHA 4JSVC 5C2VB 2QR5A 3SXTD 4GGAA 2W18A 4AN1A 5CXCA 1SQJA 2PM7B 5TEEA 4I79A 5KDOB 3I7NA 3EI1B 3AL8B 4ERYA 4E5ZA 5GSAA 2CO0C 3CIKB 4J0WA 3BG0A 1U8CA 3N0EA 4J79A 4O1QD 3SBQA 1JV2A 2G9AA 4A2MA 3UVKA 3VA6A 5IJ7E 2YBAA 1BPOA 5I5MA 1VZ3A 4ERQA 4J0XA 3K26A 3SLED 1GP2B 2AGWA 1TBGA 3IIYA 3N0DA 3J80g 5HDBA 4J8GA 3O4GA 5GXHA 1H2XA 1PBYB 3ZE1A 4BCBA 2YMUA 1PEVA 1U2VC 1SQ9A 2XYIA 4FHLA 4BP8A 5IT9g 1VYHC 5CXBB 4UM9A 4PSXB 3JROA 2I3TA 4G55A 1N6FA 1NR0A 5EALA 4J86A 2PM6B 2HKMA 4J81A 5FQDA 2HU5A 3EI2B 5EAMA 4Z7NA 2AQ5A 3FCSA 4JXMA 4IRZA 2HU7A 1UOPA 2CE8A 5FKTA 4GGCA 5C92A 4PBYA 3MUNA 4NBMA 3ULEC 5EMJB 2QC5A 2G99A 5TDHB 5M5VA 1QFMA 2B5LA 4WK2A 3IJCA 2VDLA 2H9LA 3RLMD 5EMLB 3PSCB 4XYIA 3IJEA 5E6UA 2IWFA 5EARA 5H1MA 4A0BB 1E8MA 3T3PA 2Z2OA 3VH0A 1H2YA 3EI4B 4JSXC 3SVWD 4CY1A 3MZLA 3OKWA 3GC3B 5C9ZB 4YVDA 2EBSA 4AN0A 2OVRB 4CY3A 4A11B 4HDJA 4NC4A 3EG6A 3C9CA 5AJAA 4O45A 4CY5A 3MZKA 4AMYA 1QFSA 3KRXB 3OW8A
chains in the Genus database with same CATH topology
3BWSA 1A0RB 2OJYA 3PE7A 3PSLA 4FA5D 5GMKn 4R7AB 4J87A 2P9SC 5HYNB 3OTTA 5HE0B 2HYEA 1TYQC 2H14A 2YB8B 2OVQB 1L0QA 3EI3A 3IKOA 3I7KA 2H9NA 4A0AB 2HJ4A 2AH1A 3JB9L 4ZOYA 3L4OD 4CI3A 5FKSA 5THAA 4O9DA 2AGXA 5B4WA 3P4FA 4GQ1A 4PC0A 3RSEC 4ZOVA 2IAAA 4GGDA 3DWLC 5CYKB 4J77A 2H6QA 3C75H 4O3TB 4A0BA 3ORVD 4GZ8A 3PVWB 4JSPC 5EM2A 2I0SA 5HQGA 1Q47A 3NVXA 1PGUA 3IJ1A 4JSNC 4PXWA 2P9LC 1N6DA 2IWKA 3F3GA 5H17A 5HE1B 2GC4A 3E0CA 2OVPB 3AFCA 3PVUB 3KRWB 2OK4A 1GOTB 1XHMA 4J73A 3AH8B 3UKRC 4E54A 4H5JA 1OLZA 2H6KA 2PM9B 3MXXA 2CO0A 1R5MA 2GNQA 4GMBA 4L9OA 3GREA 3DXMC 1GXRA 4O3UB 2XL2A 2YNOA 2H3XA 3ZWLB 1JJUB 2BCJB 2B5MA 4K3ID 2P9UC 4FAVD 4QT8A 3UVOA 3HFQA 3EI1A 3I2NA 4XEIC 3AL8A 3BG1A 1N6EA 2J55H 3NVNA 2J57G 4CZYA 2HKRA 2TRCB 4JT6C 1P22A 3W15A 4JT5C 1JMZB 3F3FA 4Z8LA 3SMRA 5HE3B 5IGQA 3UKUC 4K3JB 3DXKC 4PBZA 3EWEA 3I7HA 3DM0A 4FA9D 2HESX 3CFSB 3OKYB 4GM8A 3B7FA 5K1CC 4E5ZB 2B4EA 3V7DB 4X3EA 2I0TA 4LG8A 2IUPA 4G56B 4X61B 5EMKB 2XU7A 2H9PA 3OKTA 4A08B 2H68A 4XYHA 3UR4A 2HJBA 4FA4D 5CXBA 5SXMA 4NSXA 3C99A 4GQ2P 3UVLA 4FA1D 3J81g 5AMSA 5C2WB 3V9FA 4J78A 4ZN4A 4CZVA 3EI2A 2H47A 3FRXA 3RMZD 3RN0D 3OL2B 4J82A 3I8CA 4D0KA 1PI6A 3IJ0A 3I89A 5IGOA 3IIWA 1FWXA 4CZXA 5FKQA 2BBKH 2O9KA 2Q7QA 2AGZA 3JRPA 5FLXg 2B5NA 4QQEA 3SWSD 2GC7A 4AEZA 2P9PC 2AGYA 5FKRA 2OIZA 4U1EI 3CFVA 3EI4A 5EAPA 2PBIB 4A7JA 4D6VA 2UZXB 4BL0A 4Y7RA 3I7LA 4OWRA 3SHFA 5AFU3 5H14A 4FAND 2Z2NA 4A11A 2H9MA 4MK0B 4OZUA 3OKYA 5IC7A 4FB1D 5JWZA 1SHYB 4IMMA 2IUQA 3PXWD 4ERZA 3DSMA 4J8BA 4AOWA 3EU7A 3RRMC 4CC9A 3FM0A 4X60B 4A2LA 4PSWB 4A08A 5IJ8E 3MKSB 4X63B 4LG9A 3UVMA 4QRJA 4A09B 5TF2A 4A0AA 1MDAH 4L1QD 3EMHA 5FA5B 3AL9A 4CI8A 3NVQA 3OL2A 5A2Qg 3FGBA 2AGLA 2CNXA 3JPXA 4EWRA 3SBRA 3I8EA 2HXCA 3JZGA 3RN1D 3EI3B 2P9IC 2AH0A 2QXVA 5CYKA 2H6NA 2YNNA 3SCYA 4CY2A 4KFMB 2IURA 3JZNA 2XL3A 1K8KC 1XIPA 1MG2A 2YNPA 5CXCB 3MKQA 1NEXB 3C5MA 3MMYA 2CN3A 4IA9A 3VGZA 4CI2A 3SBPA 4H5IA 4L3HD 4TZ4A 4LGNA 2MTAH 2OK6A 3ODTA 3RFHA 2I0RA 3I7PA 5FXYA 3I7OA 5EMMB 4ESGA 5EM2B 1RI6A 4CI1A 3RFGA 1K32A 1B9YA 2IUVA 2P9KC 2Z2PA 4UI9R 3SN6B 4N14A 3K27A 3SJLD 2H13A 2PM9A 4U7AA 3U4YA 2CE9A 2UZYB 5I5IA 4ES0A 2CN2A 4ZOXA 1XKSA 3L4MD 3F3PA 4A09A 1JMXB 1MG3A 1GG2B 1U4CA 1OMWB 3V5WB 1QNIA 4GQBB 4E54B 4L3GD 5K19A 5HE2B 1B9XA 3A0FA 4QL1A 3JAMg 4ZOZA 1ERJA 5TEFA 2I3SA 4GM3A 4GM9A 4J84A 3UVNA 3PXSD 2P9NC 1S4UX 4JD2C 3PXTD 3SFZA 4FWWA 1JOFA 4BH6A 4PNKB 1YFQA 2J56H 4BUJC 3GFCA 4Y5RD 5I5JA 5GXIA 3JZHA 4JSVC 5C2VB 3SXTD 4GGAA 2W18A 5CXCA 1SQJA 2PM7B 5TEEA 4I79A 5KDOB 3I7NA 3EI1B 3AL8B 4ERYA 4E5ZA 5GSAA 2CO0C 3CIKB 4J0WA 3BG0A 3N0EA 4J79A 4O1QD 3SBQA 2G9AA 4A2MA 3UVKA 3VA6A 5IJ7E 2YBAA 5I5MA 4ERQA 4J0XA 3K26A 3SLED 1GP2B 2AGWA 1TBGA 3IIYA 3N0DA 3J80g 4J8GA 5GXHA 1PBYB 2YMUA 1PEVA 1U2VC 1SQ9A 2XYIA 4FHLA 5IT9g 1VYHC 5CXBB 4PSXB 3JROA 2I3TA 1N6FA 1NR0A 5EALA 4J86A 2PM6B 2HKMA 4J81A 5FQDA 3EI2B 5EAMA 2AQ5A 4JXMA 2CE8A 5FKTA 4GGCA 4PBYA 3ULEC 5EMJB 2QC5A 2G99A 5TDHB 2B5LA 3IJCA 2H9LA 3RLMD 5EMLB 3PSCB 4XYIA 2IWFA 5EARA 5H1MA 4A0BB 2Z2OA 3VH0A 3EI4B 4JSXC 3SVWD 4CY1A 3MZLA 3OKWA 5C9ZB 4YVDA 2EBSA 2OVRB 4CY3A 4A11B 4HDJA 3EG6A 3C9CA 5AJAA 4O45A 4CY5A 3MZKA 3KRXB 3OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BWS A;  1A0R B;  2OJY A;  3PE7 A;  3PSL A;  4FA5 D;  5GMK n;  4R7A B;  4J87 A;  2P9S C;  5HYN B;  3OTT A;  5HE0 B;  2HYE A;  1TYQ C;  2H14 A;  2YB8 B;  2OVQ B;  1L0Q A;  3EI3 A;  3IKO A;  3I7K A;  2H9N A;  4A0A B;  2HJ4 A;  2AH1 A;  3JB9 L;  4ZOY A;  3L4O D;  4CI3 A;  5FKS A;  5THA A;  4O9D A;  2AGX A;  5B4W A;  3P4F A;  4GQ1 A;  4PC0 A;  3RSE C;  4ZOV A;  2IAA A;  4GGD A;  3DWL C;  5CYK B;  4J77 A;  2H6Q A;  3C75 H;  4O3T B;  4A0B A;  3ORV D;  4GZ8 A;  3PVW B;  4JSP C;  5EM2 A;  2I0S A;  5HQG A;  1Q47 A;  3NVX A;  1PGU A;  3IJ1 A;  4JSN C;  4PXW A;  2P9L C;  1N6D A;  2IWK A;  3F3G A;  5H17 A;  5HE1 B;  2GC4 A;  3E0C A;  2OVP B;  3AFC A;  3PVU B;  3KRW B;  2OK4 A;  1GOT B;  1XHM A;  4J73 A;  3AH8 B;  3UKR C;  4E54 A;  4H5J A;  1OLZ A;  2H6K A;  2PM9 B;  3MXX A;  2CO0 A;  1R5M A;  2GNQ A;  4GMB A;  4L9O A;  3GRE A;  3DXM C;  1GXR A;  4O3U B;  2XL2 A;  2YNO A;  2H3X A;  3ZWL B;  1JJU B;  2BCJ B;  2B5M A;  4K3I D;  2P9U C;  4FAV D;  4QT8 A;  3UVO A;  3HFQ A;  3EI1 A;  3I2N A;  4XEI C;  3AL8 A;  3BG1 A;  1N6E A;  2J55 H;  3NVN A;  2J57 G;  4CZY A;  2HKR A;  2TRC B;  4JT6 C;  1P22 A;  3W15 A;  4JT5 C;  1JMZ B;  3F3F A;  4Z8L A;  3SMR A;  5HE3 B;  5IGQ A;  3UKU C;  4K3J B;  3DXK C;  4PBZ A;  3EWE A;  3I7H A;  3DM0 A;  4FA9 D;  2HES X;  3CFS B;  3OKY B;  4GM8 A;  3B7F A;  5K1C C;  4E5Z B;  2B4E A;  3V7D B;  4X3E A;  2I0T A;  4LG8 A;  2IUP A;  4G56 B;  4X61 B;  5EMK B;  2XU7 A;  2H9P A;  3OKT A;  4A08 B;  2H68 A;  4XYH A;  3UR4 A;  2HJB A;  4FA4 D;  5CXB A;  5SXM A;  4NSX A;  3C99 A;  4GQ2 P;  3UVL A;  4FA1 D;  3J81 g;  5AMS A;  5C2W B;  3V9F A;  4J78 A;  4ZN4 A;  4CZV A;  3EI2 A;  2H47 A;  3FRX A;  3RMZ D;  3RN0 D;  3OL2 B;  4J82 A;  3I8C A;  4D0K A;  1PI6 A;  3IJ0 A;  3I89 A;  5IGO A;  3IIW A;  1FWX A;  4CZX A;  5FKQ A;  2BBK H;  2O9K A;  2Q7Q A;  2AGZ A;  3JRP A;  5FLX g;  2B5N A;  4QQE A;  3SWS D;  2GC7 A;  4AEZ A;  2P9P C;  2AGY A;  5FKR A;  2OIZ A;  4U1E I;  3CFV A;  3EI4 A;  5EAP A;  2PBI B;  4A7J A;  4D6V A;  2UZX B;  4BL0 A;  4Y7R A;  3I7L A;  4OWR A;  3SHF A;  5AFU 3;  5H14 A;  4FAN D;  2Z2N A;  4A11 A;  2H9M A;  4MK0 B;  4OZU A;  3OKY A;  5IC7 A;  4FB1 D;  5JWZ A;  1SHY B;  4IMM A;  2IUQ A;  3PXW D;  4ERZ A;  3DSM A;  4J8B A;  4AOW A;  3EU7 A;  3RRM C;  4CC9 A;  3FM0 A;  4X60 B;  4A2L A;  4PSW B;  4A08 A;  5IJ8 E;  3MKS B;  4X63 B;  4LG9 A;  3UVM A;  4QRJ A;  4A09 B;  5TF2 A;  4A0A A;  1MDA H;  4L1Q D;  3EMH A;  5FA5 B;  3AL9 A;  4CI8 A;  3NVQ A;  3OL2 A;  5A2Q g;  3FGB A;  2AGL A;  2CNX A;  3JPX A;  4EWR A;  3SBR A;  3I8E A;  2HXC A;  3JZG A;  3RN1 D;  3EI3 B;  2P9I C;  2AH0 A;  2QXV A;  5CYK A;  2H6N A;  2YNN A;  3SCY A;  4CY2 A;  4KFM B;  2IUR A;  3JZN A;  2XL3 A;  1K8K C;  1XIP A;  1MG2 A;  2YNP A;  5CXC B;  3MKQ A;  1NEX B;  3C5M A;  3MMY A;  2CN3 A;  4IA9 A;  3VGZ A;  4CI2 A;  3SBP A;  4H5I A;  4L3H D;  4TZ4 A;  4LGN A;  2MTA H;  2OK6 A;  3ODT A;  3RFH A;  2I0R A;  3I7P A;  5FXY A;  3I7O A;  5EMM B;  4ESG A;  5EM2 B;  1RI6 A;  4CI1 A;  3RFG A;  1K32 A;  1B9Y A;  2IUV A;  2P9K C;  2Z2P A;  4UI9 R;  3SN6 B;  4N14 A;  3K27 A;  3SJL D;  2H13 A;  2PM9 A;  4U7A A;  3U4Y A;  2CE9 A;  2UZY B;  5I5I A;  4ES0 A;  2CN2 A;  4ZOX A;  1XKS A;  3L4M D;  3F3P A;  4A09 A;  1JMX B;  1MG3 A;  1GG2 B;  1U4C A;  1OMW B;  3V5W B;  1QNI A;  4GQB B;  4E54 B;  4L3G D;  5K19 A;  5HE2 B;  1B9X A;  3A0F A;  4QL1 A;  3JAM g;  4ZOZ A;  1ERJ A;  5TEF A;  2I3S A;  4GM3 A;  4GM9 A;  4J84 A;  3UVN A;  3PXS D;  2P9N C;  1S4U X;  4JD2 C;  3PXT D;  3SFZ A;  4FWW A;  1JOF A;  4BH6 A;  4PNK B;  1YFQ A;  2J56 H;  4BUJ C;  3GFC A;  4Y5R D;  5I5J A;  5GXI A;  3JZH A;  4JSV C;  5C2V B;  3SXT D;  4GGA A;  2W18 A;  5CXC A;  1SQJ A;  2PM7 B;  5TEE A;  4I79 A;  5KDO B;  3I7N A;  3EI1 B;  3AL8 B;  4ERY A;  4E5Z A;  5GSA A;  2CO0 C;  3CIK B;  4J0W A;  3BG0 A;  3N0E A;  4J79 A;  4O1Q D;  3SBQ A;  2G9A A;  4A2M A;  3UVK A;  3VA6 A;  5IJ7 E;  2YBA A;  5I5M A;  4ERQ A;  4J0X A;  3K26 A;  3SLE D;  1GP2 B;  2AGW A;  1TBG A;  3IIY A;  3N0D A;  3J80 g;  4J8G A;  5GXH A;  1PBY B;  2YMU A;  1PEV A;  1U2V C;  1SQ9 A;  2XYI A;  4FHL A;  5IT9 g;  1VYH C;  5CXB B;  4PSX B;  3JRO A;  2I3T A;  1N6F A;  1NR0 A;  5EAL A;  4J86 A;  2PM6 B;  2HKM A;  4J81 A;  5FQD A;  3EI2 B;  5EAM A;  2AQ5 A;  4JXM A;  2CE8 A;  5FKT A;  4GGC A;  4PBY A;  3ULE C;  5EMJ B;  2QC5 A;  2G99 A;  5TDH B;  2B5L A;  3IJC A;  2H9L A;  3RLM D;  5EML B;  3PSC B;  4XYI A;  2IWF A;  5EAR A;  5H1M A;  4A0B B;  2Z2O A;  3VH0 A;  3EI4 B;  4JSX C;  3SVW D;  4CY1 A;  3MZL A;  3OKW A;  5C9Z B;  4YVD A;  2EBS A;  2OVR B;  4CY3 A;  4A11 B;  4HDJ A;  3EG6 A;  3C9C A;  5AJA A;  4O45 A;  4CY5 A;  3MZK A;  3KRX B;  3OW8 A; 
#chains in the Genus database with same CATH topology
 3BWS A;  1A0R B;  2OJY A;  3PE7 A;  3PSL A;  4FA5 D;  5GMK n;  4R7A B;  3VI4 A;  3ZDX A;  4J87 A;  3V4P A;  2P9S C;  5HYN B;  3OTT A;  5HE0 B;  2HYE A;  1TYQ C;  2H14 A;  2YB8 B;  2OVQ B;  1L0Q A;  3EI3 A;  3IKO A;  3I7K A;  2H9N A;  4A0A B;  2HJ4 A;  4G1M A;  2AH1 A;  3JB9 L;  4MMY A;  4ZOY A;  3L4O D;  4CI3 A;  5FKS A;  3ZDZ A;  5THA A;  3O4I A;  3IUQ A;  5M5T A;  4O9D A;  2AGX A;  5B4W A;  3P4F A;  3VI3 A;  3IUL A;  4GQ1 A;  4PC0 A;  3RSE C;  4ZOV A;  2IAA A;  4GGD A;  3DWL C;  5CYK B;  4J77 A;  2H6Q A;  3C75 H;  4O3T B;  1M1X A;  4A0B A;  3ORV D;  1GOH A;  4GZ8 A;  3PVW B;  4JSP C;  5EM2 A;  2I0S A;  5HQG A;  1Q47 A;  3NVX A;  1PGU A;  3IJ1 A;  4JSN C;  4Z7O A;  2XE4 A;  4PXW A;  2P9L C;  5M5U A;  1N6D A;  1H2Z A;  2IWK A;  3F3G A;  4O2W A;  5H17 A;  5HE1 B;  2GC4 A;  2VDR A;  3E0C A;  2OVP B;  3AFC A;  3PVU B;  4RE6 A;  1GOF A;  3KRW B;  2OK4 A;  1GOT B;  1XHM A;  4J73 A;  3AH8 B;  3UKR C;  4E54 A;  4H5J A;  1OLZ A;  2H6K A;  4O02 A;  2PM9 B;  1K3I A;  4WK4 A;  3MXX A;  3NID A;  3EQ7 A;  2CO0 A;  1R5M A;  2GNQ A;  4GMB A;  4L9O A;  1VE7 A;  3GRE A;  2VC2 A;  3DXM C;  1GXR A;  4O3U B;  1VZ2 A;  2XL2 A;  2YNO A;  2H3X A;  3K71 A;  4MMX A;  3ZWL B;  1JJU B;  3EQ9 A;  3K72 A;  3T3M A;  2BCJ B;  2B5M A;  4K3I D;  2VDN A;  2P9U C;  3NIF A;  4FAV D;  4QT8 A;  3UVO A;  3HFQ A;  5C86 A;  3EI1 A;  3I2N A;  4XEI C;  3AL8 A;  3BG1 A;  1N6E A;  2J55 H;  3NVN A;  2J57 G;  1H2W A;  2HKR A;  4CZY A;  2TRC B;  4JT6 C;  1P22 A;  3W15 A;  4JT5 C;  1JMZ B;  3F3F A;  4Z8L A;  3SMR A;  5HE3 B;  5IGQ A;  3UKU C;  4K3J B;  3DXK C;  3QHY B;  4PBZ A;  3EWE A;  3I7H A;  3DM0 A;  3V4V A;  2VZ1 A;  4FA9 D;  2HES X;  3CFS B;  3OKY B;  3IUN A;  3B7F A;  4GM8 A;  5K1C C;  1TYE A;  2B4E A;  4E5Z B;  4NEN A;  3V7D B;  4X3E A;  3ZE0 A;  2I0T A;  3QI0 A;  4LG8 A;  1YR2 A;  1VE6 A;  2IUP A;  2HU8 A;  1C9L A;  2XZG A;  4G56 B;  4X61 B;  5EMK B;  4DNW A;  2VDP A;  2XU7 A;  2H9P A;  3OKT A;  4A08 B;  2H68 A;  4XYH A;  3UR4 A;  2HJB A;  1A12 A;  4FA4 D;  5M5S A;  5CXB A;  5SXM A;  4QAM A;  4NSX A;  1I2M B;  3C99 A;  4GQ2 P;  3FCU A;  3UVL A;  4FA1 D;  3J81 g;  5AMS A;  5C2W B;  3V9F A;  4J78 A;  3ZDY A;  4CZV A;  4ZN4 A;  2H47 A;  3FRX A;  3RMZ D;  3EI2 A;  3KCI A;  3RN0 D;  3OL2 B;  4J82 A;  3I8C A;  4D0K A;  1PI6 A;  3IJ0 A;  3I89 A;  5IGO A;  3K6S A;  3IIW A;  1FWX A;  4CZX A;  5E6R A;  4NAA A;  1L5G A;  5FKQ A;  4DNU A;  2BBK H;  2O9K A;  2Q7Q A;  3O4H A;  1C9I A;  2AGZ A;  3JRP A;  5FLX g;  2B5N A;  3IUR A;  4QQE A;  4L1M A;  2GC7 A;  3SWS D;  4AEZ A;  2XDW A;  2P9P C;  2AGY A;  5FKR A;  3DDU A;  2OIZ A;  4U1E I;  3CFV A;  4JHN A;  3EI4 A;  5EAP A;  2PBI B;  4A7J A;  4RE5 A;  4D6V A;  2UZX B;  4BL0 A;  4Y7R A;  3I7L A;  4OWR A;  3SHF A;  5AFU 3;  2VDO A;  5H14 A;  4FAN D;  2Z2N A;  4G1E A;  2H9M A;  4MK0 B;  4A11 A;  4OZU A;  3OKY A;  5IC7 A;  4FB1 D;  5JWZ A;  1SHY B;  3IUM A;  2IUQ A;  4IMM A;  3PXW D;  4ERZ A;  3DSM A;  1E8N A;  3O4J A;  4J8B A;  4AOW A;  3EU7 A;  3RRM C;  4CC9 A;  3FM0 A;  4X60 B;  4A2L A;  1UTC A;  1UOO A;  4PSW B;  4A08 A;  5IJ8 E;  3MKS B;  4X63 B;  2VDK A;  4LG9 A;  3UVM A;  4QRJ A;  4D9S A;  4A09 B;  2EIB A;  5TF2 A;  3IUJ A;  4MMZ A;  4A0A A;  1MDA H;  4L1Q D;  2VDM A;  3EMH A;  5FA5 B;  3AL9 A;  4CI8 A;  3NVQ A;  3OL2 A;  5A2Q g;  3FGB A;  4JHP C;  4UM8 A;  5E6S A;  2AGL A;  2CNX A;  3JPX A;  4EWR A;  3SBR A;  3I8E A;  2HXC A;  1GOG A;  3JZG A;  3RN1 D;  2WQ8 A;  3IVM A;  2QZP A;  4AX4 A;  3EI3 B;  1E5T A;  3GD1 I;  2P9I C;  5M5R A;  2AH0 A;  2QXV A;  5CYK A;  2EIC A;  2H6N A;  2YNN A;  3SCY A;  5M61 A;  4CY2 A;  4KFM B;  2IUR A;  3JZN A;  2JKX A;  2XL3 A;  1K8K C;  1XIP A;  1MG2 A;  2YNP A;  2EIE A;  3NIG A;  5CXC B;  3MKQ A;  5FFG A;  3MMY A;  1NEX B;  3C5M A;  2CN3 A;  3OF7 A;  4IA9 A;  3VGZ A;  4CI2 A;  3SBP A;  4H5I A;  4L3H D;  1O6F A;  4TZ4 A;  4LGN A;  2MTA H;  2OK6 A;  3ODT A;  3RFH A;  2I0R A;  3I7P A;  5FXY A;  4BP9 A;  3I7O A;  5EMM B;  4ESG A;  5EM2 B;  4BCC A;  1RI6 A;  4CI1 A;  3RFG A;  1K32 A;  1B9Y A;  2EID A;  3EQ8 A;  2IUV A;  2P9K C;  2Z2P A;  4UI9 R;  3SN6 B;  4N14 A;  3K27 A;  1JTD B;  3SJL D;  2H13 A;  2PM9 A;  4U7A A;  3U4Y A;  2CE9 A;  2UZY B;  2VZ3 A;  5I5I A;  3MVD K;  4ES0 A;  2CN2 A;  4ZOX A;  1XKS A;  3L4M D;  3F3P A;  4A09 A;  1MG3 A;  1JMX B;  1GG2 B;  1U4C A;  1OMW B;  1O6G A;  3V5W B;  2VDQ A;  1QNI A;  4GQB B;  4BCD A;  4E54 B;  4L3G D;  5K19 A;  5FFO A;  1B9X A;  5HE2 B;  4AMZ A;  3A0F A;  1UOQ A;  1T2X A;  4QL1 A;  4WK0 A;  3MUO A;  4Z7Q A;  4ZOZ A;  1ERJ A;  3JAM g;  5TEF A;  4DNV A;  2I3S A;  4GM3 A;  4GM9 A;  4J84 A;  3ZE2 A;  3UVN A;  3PXS D;  2P9N C;  1S4U X;  4JD2 C;  4WJK A;  3PXT D;  3SFZ A;  4FWW A;  2BKL A;  1JOF A;  4BH6 A;  4PNK B;  1YFQ A;  2J56 H;  4BUJ C;  3GFC A;  4Y5R D;  5I5J A;  5GXI A;  3JZH A;  4JSV C;  5C2V B;  2QR5 A;  3SXT D;  4GGA A;  2W18 A;  4AN1 A;  5CXC A;  1SQJ A;  2PM7 B;  5TEE A;  4I79 A;  5KDO B;  3I7N A;  3EI1 B;  3AL8 B;  4ERY A;  4E5Z A;  5GSA A;  2CO0 C;  3CIK B;  4J0W A;  3BG0 A;  1U8C A;  3N0E A;  4J79 A;  4O1Q D;  3SBQ A;  1JV2 A;  2G9A A;  4A2M A;  3UVK A;  3VA6 A;  5IJ7 E;  2YBA A;  1BPO A;  5I5M A;  1VZ3 A;  4ERQ A;  4J0X A;  3K26 A;  3SLE D;  1GP2 B;  2AGW A;  1TBG A;  3IIY A;  3N0D A;  3J80 g;  5HDB A;  4J8G A;  3O4G A;  5GXH A;  1H2X A;  1PBY B;  3ZE1 A;  4BCB A;  2YMU A;  1PEV A;  1U2V C;  1SQ9 A;  2XYI A;  4FHL A;  4BP8 A;  5IT9 g;  1VYH C;  5CXB B;  4UM9 A;  4PSX B;  3JRO A;  2I3T A;  4G55 A;  1N6F A;  1NR0 A;  5EAL A;  4J86 A;  2PM6 B;  2HKM A;  4J81 A;  5FQD A;  2HU5 A;  3EI2 B;  5EAM A;  4Z7N A;  2AQ5 A;  3FCS A;  4JXM A;  4IRZ A;  2HU7 A;  1UOP A;  2CE8 A;  5FKT A;  4GGC A;  5C92 A;  4PBY A;  3MUN A;  4NBM A;  3ULE C;  5EMJ B;  2QC5 A;  2G99 A;  5TDH B;  5M5V A;  1QFM A;  2B5L A;  4WK2 A;  3IJC A;  2VDL A;  2H9L A;  3RLM D;  5EML B;  3PSC B;  4XYI A;  3IJE A;  5E6U A;  2IWF A;  5EAR A;  5H1M A;  4A0B B;  1E8M A;  3T3P A;  2Z2O A;  3VH0 A;  1H2Y A;  3EI4 B;  4JSX C;  3SVW D;  4CY1 A;  3MZL A;  3OKW A;  3GC3 B;  5C9Z B;  4YVD A;  2EBS A;  4AN0 A;  2OVR B;  4CY3 A;  4A11 B;  4HDJ A;  4NC4 A;  3EG6 A;  3C9C A;  5AJA A;  4O45 A;  4CY5 A;  3MZK A;  4AMY A;  1QFS A;  3KRX B;  3OW8 A; 
#chains in the Genus database with same CATH homology
 3BWS A;  1A0R B;  2OJY A;  3PE7 A;  3PSL A;  4FA5 D;  5GMK n;  4R7A B;  4J87 A;  2P9S C;  5HYN B;  3OTT A;  5HE0 B;  2HYE A;  1TYQ C;  2H14 A;  2YB8 B;  2OVQ B;  1L0Q A;  3EI3 A;  3IKO A;  3I7K A;  2H9N A;  4A0A B;  2HJ4 A;  2AH1 A;  3JB9 L;  4ZOY A;  3L4O D;  4CI3 A;  5FKS A;  5THA A;  4O9D A;  2AGX A;  5B4W A;  3P4F A;  4GQ1 A;  4PC0 A;  3RSE C;  4ZOV A;  2IAA A;  4GGD A;  3DWL C;  5CYK B;  4J77 A;  2H6Q A;  3C75 H;  4O3T B;  4A0B A;  3ORV D;  4GZ8 A;  3PVW B;  4JSP C;  5EM2 A;  2I0S A;  5HQG A;  1Q47 A;  3NVX A;  1PGU A;  3IJ1 A;  4JSN C;  4PXW A;  2P9L C;  1N6D A;  2IWK A;  3F3G A;  5H17 A;  5HE1 B;  2GC4 A;  3E0C A;  2OVP B;  3AFC A;  3PVU B;  3KRW B;  2OK4 A;  1GOT B;  1XHM A;  4J73 A;  3AH8 B;  3UKR C;  4E54 A;  4H5J A;  1OLZ A;  2H6K A;  2PM9 B;  3MXX A;  2CO0 A;  1R5M A;  2GNQ A;  4GMB A;  4L9O A;  3GRE A;  3DXM C;  1GXR A;  4O3U B;  2XL2 A;  2YNO A;  2H3X A;  3ZWL B;  1JJU B;  2BCJ B;  2B5M A;  4K3I D;  2P9U C;  4FAV D;  4QT8 A;  3UVO A;  3HFQ A;  3EI1 A;  3I2N A;  4XEI C;  3AL8 A;  3BG1 A;  1N6E A;  2J55 H;  3NVN A;  2J57 G;  4CZY A;  2HKR A;  2TRC B;  4JT6 C;  1P22 A;  3W15 A;  4JT5 C;  1JMZ B;  3F3F A;  4Z8L A;  3SMR A;  5HE3 B;  5IGQ A;  3UKU C;  4K3J B;  3DXK C;  4PBZ A;  3EWE A;  3I7H A;  3DM0 A;  4FA9 D;  2HES X;  3CFS B;  3OKY B;  4GM8 A;  3B7F A;  5K1C C;  4E5Z B;  2B4E A;  3V7D B;  4X3E A;  2I0T A;  4LG8 A;  2IUP A;  4G56 B;  4X61 B;  5EMK B;  2XU7 A;  2H9P A;  3OKT A;  4A08 B;  2H68 A;  4XYH A;  3UR4 A;  2HJB A;  4FA4 D;  5CXB A;  5SXM A;  4NSX A;  3C99 A;  4GQ2 P;  3UVL A;  4FA1 D;  3J81 g;  5AMS A;  5C2W B;  3V9F A;  4J78 A;  4ZN4 A;  4CZV A;  3EI2 A;  2H47 A;  3FRX A;  3RMZ D;  3RN0 D;  3OL2 B;  4J82 A;  3I8C A;  4D0K A;  1PI6 A;  3IJ0 A;  3I89 A;  5IGO A;  3IIW A;  1FWX A;  4CZX A;  5FKQ A;  2BBK H;  2O9K A;  2Q7Q A;  2AGZ A;  3JRP A;  5FLX g;  2B5N A;  4QQE A;  3SWS D;  2GC7 A;  4AEZ A;  2P9P C;  2AGY A;  5FKR A;  2OIZ A;  4U1E I;  3CFV A;  3EI4 A;  5EAP A;  2PBI B;  4A7J A;  4D6V A;  2UZX B;  4BL0 A;  4Y7R A;  3I7L A;  4OWR A;  3SHF A;  5AFU 3;  5H14 A;  4FAN D;  2Z2N A;  4A11 A;  2H9M A;  4MK0 B;  4OZU A;  3OKY A;  5IC7 A;  4FB1 D;  5JWZ A;  1SHY B;  4IMM A;  2IUQ A;  3PXW D;  4ERZ A;  3DSM A;  4J8B A;  4AOW A;  3EU7 A;  3RRM C;  4CC9 A;  3FM0 A;  4X60 B;  4A2L A;  4PSW B;  4A08 A;  5IJ8 E;  3MKS B;  4X63 B;  4LG9 A;  3UVM A;  4QRJ A;  4A09 B;  5TF2 A;  4A0A A;  1MDA H;  4L1Q D;  3EMH A;  5FA5 B;  3AL9 A;  4CI8 A;  3NVQ A;  3OL2 A;  5A2Q g;  3FGB A;  2AGL A;  2CNX A;  3JPX A;  4EWR A;  3SBR A;  3I8E A;  2HXC A;  3JZG A;  3RN1 D;  3EI3 B;  2P9I C;  2AH0 A;  2QXV A;  5CYK A;  2H6N A;  2YNN A;  3SCY A;  4CY2 A;  4KFM B;  2IUR A;  3JZN A;  2XL3 A;  1K8K C;  1XIP A;  1MG2 A;  2YNP A;  5CXC B;  3MKQ A;  1NEX B;  3C5M A;  3MMY A;  2CN3 A;  4IA9 A;  3VGZ A;  4CI2 A;  3SBP A;  4H5I A;  4L3H D;  4TZ4 A;  4LGN A;  2MTA H;  2OK6 A;  3ODT A;  3RFH A;  2I0R A;  3I7P A;  5FXY A;  3I7O A;  5EMM B;  4ESG A;  5EM2 B;  1RI6 A;  4CI1 A;  3RFG A;  1K32 A;  1B9Y A;  2IUV A;  2P9K C;  2Z2P A;  4UI9 R;  3SN6 B;  4N14 A;  3K27 A;  3SJL D;  2H13 A;  2PM9 A;  4U7A A;  3U4Y A;  2CE9 A;  2UZY B;  5I5I A;  4ES0 A;  2CN2 A;  4ZOX A;  1XKS A;  3L4M D;  3F3P A;  4A09 A;  1JMX B;  1MG3 A;  1GG2 B;  1U4C A;  1OMW B;  3V5W B;  1QNI A;  4GQB B;  4E54 B;  4L3G D;  5K19 A;  5HE2 B;  1B9X A;  3A0F A;  4QL1 A;  3JAM g;  4ZOZ A;  1ERJ A;  5TEF A;  2I3S A;  4GM3 A;  4GM9 A;  4J84 A;  3UVN A;  3PXS D;  2P9N C;  1S4U X;  4JD2 C;  3PXT D;  3SFZ A;  4FWW A;  1JOF A;  4BH6 A;  4PNK B;  1YFQ A;  2J56 H;  4BUJ C;  3GFC A;  4Y5R D;  5I5J A;  5GXI A;  3JZH A;  4JSV C;  5C2V B;  3SXT D;  4GGA A;  2W18 A;  5CXC A;  1SQJ A;  2PM7 B;  5TEE A;  4I79 A;  5KDO B;  3I7N A;  3EI1 B;  3AL8 B;  4ERY A;  4E5Z A;  5GSA A;  2CO0 C;  3CIK B;  4J0W A;  3BG0 A;  3N0E A;  4J79 A;  4O1Q D;  3SBQ A;  2G9A A;  4A2M A;  3UVK A;  3VA6 A;  5IJ7 E;  2YBA A;  5I5M A;  4ERQ A;  4J0X A;  3K26 A;  3SLE D;  1GP2 B;  2AGW A;  1TBG A;  3IIY A;  3N0D A;  3J80 g;  4J8G A;  5GXH A;  1PBY B;  2YMU A;  1PEV A;  1U2V C;  1SQ9 A;  2XYI A;  4FHL A;  5IT9 g;  1VYH C;  5CXB B;  4PSX B;  3JRO A;  2I3T A;  1N6F A;  1NR0 A;  5EAL A;  4J86 A;  2PM6 B;  2HKM A;  4J81 A;  5FQD A;  3EI2 B;  5EAM A;  2AQ5 A;  4JXM A;  2CE8 A;  5FKT A;  4GGC A;  4PBY A;  3ULE C;  5EMJ B;  2QC5 A;  2G99 A;  5TDH B;  2B5L A;  3IJC A;  2H9L A;  3RLM D;  5EML B;  3PSC B;  4XYI A;  2IWF A;  5EAR A;  5H1M A;  4A0B B;  2Z2O A;  3VH0 A;  3EI4 B;  4JSX C;  3SVW D;  4CY1 A;  3MZL A;  3OKW A;  5C9Z B;  4YVD A;  2EBS A;  2OVR B;  4CY3 A;  4A11 B;  4HDJ A;  3EG6 A;  3C9C A;  5AJA A;  4O45 A;  4CY5 A;  3MZK A;  3KRX B;  3OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...