2HJBA

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
358
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 92
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hjbA01
5HQGA 3UVKA 5GSAA 3PVWB 5HYNB 2GC7A 5GXHA 2HXCA 2IWKA 3NVNA 5GXIA 5C2WB 4BH6A 5B4WA 4E54B 3B7FA 4PC0A 5AJAA 4X63B 3MXXA 1PEVA 5THAA 4J77A 1JMXB 5GMKn 3EMHA 3BWSA 3W15A 5TDHB 1VYHC 4ERYA 5CYKA 2EBSA 4E5ZA 3CFSB 2Z2OA 3VGZA 3I7LA 1GG2B 2I0TA 1YFQA 5C9ZB 1OLZA 2H6NA 3OKWA 2XL3A 4GGDA 4GQ2P 2I0RA 5HE3B 4J8BA 4JSNC 3F3PA 1MDAH 4JSVC 4QL1A 3BG0A 3I2NA 4L3HD 2CE8A 2PM9A 4CY3A 4MK0B 4FWWA 4LGNA 4CZVA 5CXBA 4A08A 4UI9R 3OW8A 5EAPA 3N0DA 1TBGA 3AL8A 5CXCA 4AEZA 3E0CA 2H9PA 3IKOA 3F3FA 2OJYA 3L4MD 2CNXA 3CFVA 2XYIA 3I7PA 4FHLA 1R5MA 4A0BA 4N14A 3FM0A 2H47A 4CC9A 4TZ4A 2I3TA 4QT8A 5EMMB 4GQBB 4A7JA 4BUJC 4E5ZB 3RFHA 3AFCA 4GM9A 5EAMA 2Z2NA 4J82A 3RLMD 2IAAA 5TEEA 4G56B 1GP2B 1U4CA 2H6QA 4A11A 2Q7QA 2W18A 2PM9B 3PXWD 2I3SA 4OWRA 2P9UC 2P9PC 3FGBA 3I7NA 4PSXB 2P9IC 2XL2A 5CXBB 3V5WB 4X60B 1A0RB 1XKSA 3SBPA 3AL8B 4ZOYA 5CXCB 3EI1A 5EARA 3OKYA 3GREA 4A0BB 5SXMA 5IGOA 4GGCA 4J73A 3BG1A 4CY2A 4QQEA 2UZYB 2P9LC 4HDJA 1B9XA 5AMSA 2G99A 3I89A 3KRXB 4JT5C 4H5IA 3RMZD 2AGYA 3UVNA 4J78A 5EMLB 3RRMC 4CY1A 4ZOZA 5IC7A 3AL9A 3J81g 4X3EA 3JZNA 2HKMA 2OIZA 5K19A 2IUPA 4A11B 4CI1A 2HJBA 3C75H 2Z2PA 1MG3A 2P9NC 3IIWA 2YNNA 4L9OA 4GGAA 3C9CA 3DWLC 1JOFA 2YBAA 2MTAH 4R7AB 5H14A 4GZ8A 3MMYA 3EI1B 4JSXC 2PBIB 2AH1A 1JJUB 2J57G 4BL0A 1JMZB 3OKYB 4Y7RA 3SLED 2B4EA 3PSLA 5K1CC 4ES0A 3EU7A 2H13A 5FQDA 4CZYA 5FLXg 3UR4A 3I7KA 5AFU3 2IUQA 3JROA 3RFGA 3C99A 4FA4D 2H14A 4Z8LA 2H9NA 3SBRA 5EALA 4FAVD 4IA9A 5JWZA 4FB1D 4A0AB 3GFCA 5C2VB 4ZOVA 3UKUC 2HESX 4JSPC 5FKRA 2GNQA 3SCYA 4FA1D 3PXTD 4A2LA 1XIPA 2GC4A 5I5MA 4CI3A 2AH0A 1P22A 2BBKH 3KRWB 4D0KA 5FKSA 2P9KC 3DSMA 3IJ0A 3ODTA 2AGZA 5FKQA 3EI4B 5IGQA 2UZXB 4J86A 4U1EI 4GQ1A 2CE9A 3SN6B 1ERJA 4J84A 4A2MA 2B5NA 4O45A 4D6VA 2IWFA 3JRPA 2QC5A 1SQJA 4J0WA 4JXMA 5EM2A 3K27A 5I5IA 1N6EA 3V7DB 4PXWA 3SWSD 2YNPA 2AQ5A 3I7HA 3PE7A 4PBYA 3EI3A 4J0XA 2AGLA 5IJ7E 1OMWB 3RN1D 2G9AA 5EMKB 1N6DA 2BCJB 3L4OD 2CN3A 4XEIC 3U4YA 3J80g 3JB9L 3CIKB 3C5MA 3ZWLB 1Q47A 3SJLD 1MG2A 4XYIA 2OVPB 4LG9A 1PI6A 4J79A 2B5MA 2AGWA 1PBYB 4ERZA 4OZUA 3AH8B 5TEFA 4QRJA 3SVWD 1RI6A 4A0AA 4K3JB 3JZHA 4XYHA 2H9LA 5FKTA 4PNKB 4A09B 2HKRA 3PXSD 5EM2B 4GMBA 3RSEC 5H1MA 3EWEA 4FAND 4YVDA 1L0QA 1K32A 3NVQA 3MZLA 3P4FA 2J56H 3EI3B 2IURA 2I0SA 4O3UB 3MKSB 4LG8A 2J55H 3SBQA 3EI4A 2YNOA 4KFMB 3IJCA 4PSWB 3FRXA 4GM3A 4JT6C 3PVUB 4JD2C 4J87A 1GOTB 5HE1B 4H5JA 3N0EA 2H6KA 3K26A 3RN0D 4ESGA 1TYQC 4K3ID 3OTTA 3IJ1A 4EWRA 1B9YA 4CI8A 2PM7B 3PSCB 4ERQA 2PM6B 1NR0A 5HE0B 2HJ4A 3SMRA 2YB8B 3UVOA 1FWXA 5TF2A 3SXTD 5KDOB 4FA5D 2H68A 5FA5B 5I5JA 3EI2A 4GM8A 4U7AA 3NVXA 3ULEC 3OL2A 5HE2B 2TRCB 2YMUA 2OK6A 3SFZA 2B5LA 5A2Qg 3OKTA 3ORVD 3HFQA 4A09A 2H9MA 5H17A 3V9FA 2IUVA 4IMMA 1SQ9A 3DXMC 4CZXA 4J81A 5CYKB 1SHYB 1XHMA 3DM0A 2CO0A 3JZGA 1N6FA 3SHFA 5EMJB 3UVMA 4PBZA 4L1QD 4Y5RD 2CO0C 4I79A 2OK4A 3VH0A 4E54A 5IJ8E 3EG6A 2HYEA 4ZN4A 2QXVA 3F3GA 1K8KC 3DXKC 3UVLA 2XU7A 4ZOXA 4L3GD 5FXYA 3I8CA 4AOWA 3I7OA 2H3XA 3JPXA 3MZKA 3EI2B 4X61B 2OVRB 2P9SC 3A0FA 1PGUA 1QNIA 4A08B 4J8GA 1NEXB 4CI2A 1S4UX 4NSXA 3IIYA 3OL2B 4O1QD 3VA6A 3I8EA 2AGXA 4CY5A 3UKRC 2O9KA 4O3TB 3JAMg 3MKQA 2CN2A 4O9DA 1U2VC 2OVQB 1GXRA 4FA9D 5IT9g
chains in the Genus database with same CATH superfamily
5HQGA 3UVKA 5GSAA 3PVWB 1BPOA 5M5VA 5HYNB 2GC7A 5GXHA 2HXCA 2IWKA 3NVNA 3K72A 5GXIA 1UOQA 5C2WB 4BH6A 5B4WA 4E54B 3GD1I 3B7FA 4PC0A 5AJAA 4X63B 3MXXA 1PEVA 5THAA 4J77A 4G55A 1JMXB 5GMKn 3EMHA 4D9SA 3VI3A 4BCCA 3BWSA 3W15A 5TDHB 1VYHC 4ERYA 5CYKA 2EBSA 4E5ZA 3CFSB 2Z2OA 3VGZA 3I7LA 4WK0A 1GG2B 2I0TA 1YFQA 3IURA 5C9ZB 1OLZA 1UTCA 2H6NA 3OKWA 1U8CA 3OF7A 4BP9A 1E8MA 5M61A 4G1EA 2XL3A 4MMYA 4GGDA 4GQ2P 4JHNA 5C92A 1GOFA 2I0RA 5HE3B 4J8BA 4JSNC 3F3PA 1MDAH 4JSVC 3IUJA 4QL1A 3BG0A 3I2NA 4L3HD 2CE8A 2PM9A 4CY3A 4MK0B 4FWWA 4LGNA 4CZVA 5C86A 5CXBA 4A08A 4UI9R 3OW8A 5EAPA 3N0DA 3ZDYA 1TBGA 3AL8A 5CXCA 4AEZA 3E0CA 5M5UA 2H9PA 3K6SA 3IKOA 1JV2A 3IJEA 3F3FA 2OJYA 3L4MD 2CNXA 3CFVA 2XYIA 3I7PA 4FHLA 3V4PA 1R5MA 4A0BA 4N14A 4G1MA 1UOPA 3FM0A 2H47A 2VDLA 4CC9A 3ZDXA 4TZ4A 2I3TA 3EQ7A 1JTDB 4QT8A 1T2XA 5EMMB 4GQBB 4A7JA 1GOHA 4BUJC 4E5ZB 3RFHA 4MMZA 3AFCA 4GM9A 5EAMA 4UM8A 2Z2NA 4J82A 1UOOA 3RLMD 2IAAA 4RE5A 5TEEA 4G56B 4QAMA 1GP2B 1U4CA 2H6QA 4A11A 2Q7QA 2W18A 2PM9B 3PXWD 2I3SA 4OWRA 2P9UC 2P9PC 4BP8A 3FGBA 3I7NA 4PSXB 2P9IC 2XL2A 3DDUA 5CXBB 3V5WB 4X60B 1A0RB 1XKSA 3SBPA 3AL8B 2BKLA 4ZOYA 5CXCB 3EI1A 4JHPC 5EARA 3OKYA 3GREA 4A0BB 5SXMA 5IGOA 4GGCA 4AMYA 4J73A 3BG1A 3EQ8A 3T3PA 4CY2A 4QQEA 2UZYB 2P9LC 4HDJA 1H2XA 2EIEA 1B9XA 5AMSA 2G99A 3I89A 3KRXB 5M5TA 4JT5C 4H5IA 3RMZD 2JKXA 2AGYA 3QI0A 3VI4A 3UVNA 4J78A 2VDMA 5EMLB 3RRMC 4CY1A 4ZOZA 2QR5A 5IC7A 3AL9A 5E6RA 3J81g 4X3EA 4DNVA 3JZNA 2HKMA 2OIZA 5K19A 2IUPA 4A11B 4CI1A 1K3IA 2HJBA 3C75H 2Z2PA 1MG3A 2P9NC 3IIWA 2YNNA 1M1XA 2HU5A 4L9OA 4GGAA 3C9CA 3DWLC 1JOFA 2XZGA 2YBAA 1H2YA 2VDRA 2MTAH 2VDPA 4R7AB 2HU7A 5H14A 4GZ8A 3MMYA 3EI1B 4JSXC 2PBIB 2AH1A 1JJUB 2J57G 4BL0A 1JMZB 3OKYB 4Y7RA 3SLED 4Z7QA 2B4EA 3PSLA 5K1CC 4ES0A 3EU7A 2H13A 3V4VA 5FQDA 2WQ8A 4CZYA 1VE6A 5FLXg 3UR4A 5E6SA 3I7KA 1VZ3A 5AFU3 3JROA 2IUQA 3RFGA 3C99A 4FA4D 1QFMA 2H14A 4Z8LA 2H9NA 3SBRA 5EALA 4FAVD 4IA9A 5JWZA 4FB1D 2VDQA 4A0AB 4Z7OA 3GFCA 1GOGA 4ZOVA 3UKUC 5C2VB 4WK4A 2HESX 4JSPC 5FKRA 2GNQA 3SCYA 4FA1D 3PXTD 4A2LA 1H2ZA 1XIPA 2GC4A 4UM9A 3ZDZA 5I5MA 4CI3A 2AH0A 1P22A 2BBKH 3KRWB 4D0KA 5FKSA 2P9KC 3DSMA 3IJ0A 3ODTA 2AGZA 4MMXA 5FKQA 3EI4B 5IGQA 2UZXB 3EQ9A 4J86A 4U1EI 4GQ1A 2CE9A 3SN6B 3K71A 1ERJA 3GC3B 4J84A 4A2MA 2QZPA 2B5NA 4O45A 1O6GA 3QHYB 4D6VA 2IWFA 3JRPA 2QC5A 1SQJA 4J0WA 4JXMA 5EM2A 3K27A 5I5IA 3NIFA 1N6EA 2VDNA 3V7DB 4PXWA 3SWSD 1QFSA 2YNPA 2AQ5A 3I7HA 3PE7A 2VZ3A 4PBYA 3EI3A 4J0XA 2AGLA 4NENA 4WJKA 5IJ7E 1OMWB 3RN1D 3FCSA 2G9AA 5EMKB 1N6DA 2BCJB 3L4OD 1C9IA 2CN3A 4XEIC 3U4YA 3IUQA 3J80g 3JB9L 3CIKB 3C5MA 3ZWLB 2HU8A 1VE7A 1Q47A 3SJLD 1MG2A 2VDKA 4XYIA 2OVPB 4LG9A 1PI6A 3O4HA 4J79A 4O02A 2B5MA 2AGWA 4DNWA 1PBYB 3IVMA 4OZUA 4ERZA 3AH8B 5FFOA 5TEFA 4QRJA 3SVWD 4AX4A 4NBMA 4BCBA 1I2MB 1RI6A 4A0AA 4K3JB 3JZHA 4XYHA 1O6FA 2H9LA 5FKTA 2EICA 4PNKB 4A09B 2HKRA 3PXSD 1L5GA 5EM2B 4GMBA 3RSEC 5H1MA 3EWEA 4FAND 4YVDA 3ZE2A 1L0QA 2VZ1A 1K32A 4WK2A 4DNUA 3NVQA 3MZLA 3P4FA 2J56H 3EI3B 3NIGA 2IURA 1E8NA 2I0SA 4O3UB 3MKSB 4LG8A 2J55H 3SBQA 2XDWA 3EI4A 2YNOA 4KFMB 3IJCA 4PSWB 1YR2A 3FRXA 4GM3A 4JT6C 2VC2A 3PVUB 4JD2C 1E5TA 4J87A 4L1MA 1GOTB 5HE1B 4H5JA 3N0EA 2H6KA 5HDBA 3K26A 3RN0D 3ZE1A 4ESGA 1VZ2A 1TYQC 4K3ID 3OTTA 3IJ1A 4EWRA 1B9YA 4CI8A 2PM7B 3PSCB 4ERQA 2PM6B 1NR0A 2EIBA 5HE0B 2HJ4A 3MUOA 3IULA 3SMRA 2YB8B 5M5RA 3UVOA 3IUMA 1H2WA 1FWXA 5TF2A 3SXTD 5KDOB 4FA5D 2H68A 5FA5B 5I5JA 3EI2A 4GM8A 4RE6A 4U7AA 2VDOA 3NVXA 3FCUA 3ULEC 3OL2A 3O4JA 4NC4A 3T3MA 5HE2B 2TRCB 2YMUA 2OK6A 3SFZA 3KCIA 2B5LA 5A2Qg 3OKTA 3ORVD 3HFQA 4A09A 2H9MA 5H17A 3V9FA 2IUVA 4Z7NA 3MVDK 4IMMA 1SQ9A 1C9LA 3DXMC 4NAAA 4CZXA 4J81A 5CYKB 1SHYB 1XHMA 3DM0A 2CO0A 4AMZA 3JZGA 1N6FA 2EIDA 3SHFA 5EMJB 3UVMA 4AN0A 4PBZA 3MUNA 4L1QD 4Y5RD 2CO0C 4I79A 2OK4A 3VH0A 4E54A 2XE4A 3EG6A 5IJ8E 2HYEA 4ZN4A 2QXVA 3F3GA 1K8KC 3DXKC 3UVLA 2XU7A 4ZOXA 4L3GD 5FXYA 3I8CA 5E6UA 3ZE0A 4AOWA 3I7OA 3O4GA 2H3XA 3JPXA 3MZKA 3O4IA 4O2WA 3EI2B 4X61B 2OVRB 2P9SC 3A0FA 1QNIA 1A12A 1PGUA 4A08B 4J8GA 1NEXB 5M5SA 4CI2A 1S4UX 4NSXA 4AN1A 3IIYA 3NIDA 3OL2B 4O1QD 3VA6A 3I8EA 1TYEA 2AGXA 4CY5A 3UKRC 2O9KA 5FFGA 4O3TB 4IRZA 3JAMg 4BCDA 3MKQA 2CN2A 4O9DA 1U2VC 2OVQB 3IUNA 1GXRA 4FA9D 5IT9g
chains in the Genus database with same CATH topology
5HQGA 3UVKA 5GSAA 3PVWB 5HYNB 2GC7A 5GXHA 2HXCA 2IWKA 3NVNA 5GXIA 5C2WB 4BH6A 5B4WA 4E54B 3B7FA 4PC0A 5AJAA 4X63B 3MXXA 1PEVA 5THAA 4J77A 1JMXB 5GMKn 3EMHA 3BWSA 3W15A 5TDHB 1VYHC 4ERYA 5CYKA 2EBSA 4E5ZA 3CFSB 2Z2OA 3VGZA 3I7LA 1GG2B 2I0TA 1YFQA 5C9ZB 1OLZA 2H6NA 3OKWA 2XL3A 4GGDA 4GQ2P 2I0RA 5HE3B 4J8BA 4JSNC 3F3PA 1MDAH 4JSVC 4QL1A 3BG0A 3I2NA 4L3HD 2CE8A 2PM9A 4CY3A 4MK0B 4FWWA 4LGNA 4CZVA 5CXBA 4A08A 4UI9R 3OW8A 5EAPA 3N0DA 1TBGA 3AL8A 5CXCA 4AEZA 3E0CA 2H9PA 3IKOA 3F3FA 2OJYA 3L4MD 2CNXA 3CFVA 2XYIA 3I7PA 4FHLA 1R5MA 4A0BA 4N14A 3FM0A 2H47A 4CC9A 4TZ4A 2I3TA 4QT8A 5EMMB 4GQBB 4A7JA 4BUJC 4E5ZB 3RFHA 3AFCA 4GM9A 5EAMA 2Z2NA 4J82A 3RLMD 2IAAA 5TEEA 4G56B 1GP2B 1U4CA 2H6QA 4A11A 2Q7QA 2W18A 2PM9B 3PXWD 2I3SA 4OWRA 2P9UC 2P9PC 3FGBA 3I7NA 4PSXB 2P9IC 2XL2A 5CXBB 3V5WB 4X60B 1A0RB 1XKSA 3SBPA 3AL8B 4ZOYA 5CXCB 3EI1A 5EARA 3OKYA 3GREA 4A0BB 5SXMA 5IGOA 4GGCA 4J73A 3BG1A 4CY2A 4QQEA 2UZYB 2P9LC 4HDJA 1B9XA 5AMSA 2G99A 3I89A 3KRXB 4JT5C 4H5IA 3RMZD 2AGYA 3UVNA 4J78A 5EMLB 3RRMC 4CY1A 4ZOZA 5IC7A 3AL9A 3J81g 4X3EA 3JZNA 2HKMA 2OIZA 5K19A 2IUPA 4A11B 4CI1A 2HJBA 3C75H 2Z2PA 1MG3A 2P9NC 3IIWA 2YNNA 4L9OA 4GGAA 3C9CA 3DWLC 1JOFA 2YBAA 2MTAH 4R7AB 5H14A 4GZ8A 3MMYA 3EI1B 4JSXC 2PBIB 2AH1A 1JJUB 2J57G 4BL0A 1JMZB 3OKYB 4Y7RA 3SLED 2B4EA 3PSLA 5K1CC 4ES0A 3EU7A 2H13A 5FQDA 4CZYA 5FLXg 3UR4A 3I7KA 5AFU3 2IUQA 3JROA 3RFGA 3C99A 4FA4D 2H14A 4Z8LA 2H9NA 3SBRA 5EALA 4FAVD 4IA9A 5JWZA 4FB1D 4A0AB 3GFCA 5C2VB 4ZOVA 3UKUC 2HESX 4JSPC 5FKRA 2GNQA 3SCYA 4FA1D 3PXTD 4A2LA 1XIPA 2GC4A 5I5MA 4CI3A 2AH0A 1P22A 2BBKH 3KRWB 4D0KA 5FKSA 2P9KC 3DSMA 3IJ0A 3ODTA 2AGZA 5FKQA 3EI4B 5IGQA 2UZXB 4J86A 4U1EI 4GQ1A 2CE9A 3SN6B 1ERJA 4J84A 4A2MA 2B5NA 4O45A 4D6VA 2IWFA 3JRPA 2QC5A 1SQJA 4J0WA 4JXMA 5EM2A 3K27A 5I5IA 1N6EA 3V7DB 4PXWA 3SWSD 2YNPA 2AQ5A 3I7HA 3PE7A 4PBYA 3EI3A 4J0XA 2AGLA 5IJ7E 1OMWB 3RN1D 2G9AA 5EMKB 1N6DA 2BCJB 3L4OD 2CN3A 4XEIC 3U4YA 3J80g 3JB9L 3CIKB 3C5MA 3ZWLB 1Q47A 3SJLD 1MG2A 4XYIA 2OVPB 4LG9A 1PI6A 4J79A 2B5MA 2AGWA 1PBYB 4ERZA 4OZUA 3AH8B 5TEFA 4QRJA 3SVWD 1RI6A 4A0AA 4K3JB 3JZHA 4XYHA 2H9LA 5FKTA 4PNKB 4A09B 2HKRA 3PXSD 5EM2B 4GMBA 3RSEC 5H1MA 3EWEA 4FAND 4YVDA 1L0QA 1K32A 3NVQA 3MZLA 3P4FA 2J56H 3EI3B 2IURA 2I0SA 4O3UB 3MKSB 4LG8A 2J55H 3SBQA 3EI4A 2YNOA 4KFMB 3IJCA 4PSWB 3FRXA 4GM3A 4JT6C 3PVUB 4JD2C 4J87A 1GOTB 5HE1B 4H5JA 3N0EA 2H6KA 3K26A 3RN0D 4ESGA 1TYQC 4K3ID 3OTTA 3IJ1A 4EWRA 1B9YA 4CI8A 2PM7B 3PSCB 4ERQA 2PM6B 1NR0A 5HE0B 2HJ4A 3SMRA 2YB8B 3UVOA 1FWXA 5TF2A 3SXTD 5KDOB 4FA5D 2H68A 5FA5B 5I5JA 3EI2A 4GM8A 4U7AA 3NVXA 3ULEC 3OL2A 5HE2B 2TRCB 2YMUA 2OK6A 3SFZA 2B5LA 5A2Qg 3OKTA 3ORVD 3HFQA 4A09A 2H9MA 5H17A 3V9FA 2IUVA 4IMMA 1SQ9A 3DXMC 4CZXA 4J81A 5CYKB 1SHYB 1XHMA 3DM0A 2CO0A 3JZGA 1N6FA 3SHFA 5EMJB 3UVMA 4PBZA 4L1QD 4Y5RD 2CO0C 4I79A 2OK4A 3VH0A 4E54A 5IJ8E 3EG6A 2HYEA 4ZN4A 2QXVA 3F3GA 1K8KC 3DXKC 3UVLA 2XU7A 4ZOXA 4L3GD 5FXYA 3I8CA 4AOWA 3I7OA 2H3XA 3JPXA 3MZKA 3EI2B 4X61B 2OVRB 2P9SC 3A0FA 1PGUA 1QNIA 4A08B 4J8GA 1NEXB 4CI2A 1S4UX 4NSXA 3IIYA 3OL2B 4O1QD 3VA6A 3I8EA 2AGXA 4CY5A 3UKRC 2O9KA 4O3TB 3JAMg 3MKQA 2CN2A 4O9DA 1U2VC 2OVQB 1GXRA 4FA9D 5IT9g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQG A;  3UVK A;  5GSA A;  3PVW B;  5HYN B;  2GC7 A;  5GXH A;  2HXC A;  2IWK A;  3NVN A;  5GXI A;  5C2W B;  4BH6 A;  5B4W A;  4E54 B;  3B7F A;  4PC0 A;  5AJA A;  4X63 B;  3MXX A;  1PEV A;  5THA A;  4J77 A;  1JMX B;  5GMK n;  3EMH A;  3BWS A;  3W15 A;  5TDH B;  1VYH C;  4ERY A;  5CYK A;  2EBS A;  4E5Z A;  3CFS B;  2Z2O A;  3VGZ A;  3I7L A;  1GG2 B;  2I0T A;  1YFQ A;  5C9Z B;  1OLZ A;  2H6N A;  3OKW A;  2XL3 A;  4GGD A;  4GQ2 P;  2I0R A;  5HE3 B;  4J8B A;  4JSN C;  3F3P A;  1MDA H;  4JSV C;  4QL1 A;  3BG0 A;  3I2N A;  4L3H D;  2CE8 A;  2PM9 A;  4CY3 A;  4MK0 B;  4FWW A;  4LGN A;  4CZV A;  5CXB A;  4A08 A;  4UI9 R;  3OW8 A;  5EAP A;  3N0D A;  1TBG A;  3AL8 A;  5CXC A;  4AEZ A;  3E0C A;  2H9P A;  3IKO A;  3F3F A;  2OJY A;  3L4M D;  2CNX A;  3CFV A;  2XYI A;  3I7P A;  4FHL A;  1R5M A;  4A0B A;  4N14 A;  3FM0 A;  2H47 A;  4CC9 A;  4TZ4 A;  2I3T A;  4QT8 A;  5EMM B;  4GQB B;  4A7J A;  4BUJ C;  4E5Z B;  3RFH A;  3AFC A;  4GM9 A;  5EAM A;  2Z2N A;  4J82 A;  3RLM D;  2IAA A;  5TEE A;  4G56 B;  1GP2 B;  1U4C A;  2H6Q A;  4A11 A;  2Q7Q A;  2W18 A;  2PM9 B;  3PXW D;  2I3S A;  4OWR A;  2P9U C;  2P9P C;  3FGB A;  3I7N A;  4PSX B;  2P9I C;  2XL2 A;  5CXB B;  3V5W B;  4X60 B;  1A0R B;  1XKS A;  3SBP A;  3AL8 B;  4ZOY A;  5CXC B;  3EI1 A;  5EAR A;  3OKY A;  3GRE A;  4A0B B;  5SXM A;  5IGO A;  4GGC A;  4J73 A;  3BG1 A;  4CY2 A;  4QQE A;  2UZY B;  2P9L C;  4HDJ A;  1B9X A;  5AMS A;  2G99 A;  3I89 A;  3KRX B;  4JT5 C;  4H5I A;  3RMZ D;  2AGY A;  3UVN A;  4J78 A;  5EML B;  3RRM C;  4CY1 A;  4ZOZ A;  5IC7 A;  3AL9 A;  3J81 g;  4X3E A;  3JZN A;  2HKM A;  2OIZ A;  5K19 A;  2IUP A;  4A11 B;  4CI1 A;  2HJB A;  3C75 H;  2Z2P A;  1MG3 A;  2P9N C;  3IIW A;  2YNN A;  4L9O A;  4GGA A;  3C9C A;  3DWL C;  1JOF A;  2YBA A;  2MTA H;  4R7A B;  5H14 A;  4GZ8 A;  3MMY A;  3EI1 B;  4JSX C;  2PBI B;  2AH1 A;  1JJU B;  2J57 G;  4BL0 A;  1JMZ B;  3OKY B;  4Y7R A;  3SLE D;  2B4E A;  3PSL A;  5K1C C;  4ES0 A;  3EU7 A;  2H13 A;  5FQD A;  4CZY A;  5FLX g;  3UR4 A;  3I7K A;  5AFU 3;  2IUQ A;  3JRO A;  3RFG A;  3C99 A;  4FA4 D;  2H14 A;  4Z8L A;  2H9N A;  3SBR A;  5EAL A;  4FAV D;  4IA9 A;  5JWZ A;  4FB1 D;  4A0A B;  3GFC A;  5C2V B;  4ZOV A;  3UKU C;  2HES X;  4JSP C;  5FKR A;  2GNQ A;  3SCY A;  4FA1 D;  3PXT D;  4A2L A;  1XIP A;  2GC4 A;  5I5M A;  4CI3 A;  2AH0 A;  1P22 A;  2BBK H;  3KRW B;  4D0K A;  5FKS A;  2P9K C;  3DSM A;  3IJ0 A;  3ODT A;  2AGZ A;  5FKQ A;  3EI4 B;  5IGQ A;  2UZX B;  4J86 A;  4U1E I;  4GQ1 A;  2CE9 A;  3SN6 B;  1ERJ A;  4J84 A;  4A2M A;  2B5N A;  4O45 A;  4D6V A;  2IWF A;  3JRP A;  2QC5 A;  1SQJ A;  4J0W A;  4JXM A;  5EM2 A;  3K27 A;  5I5I A;  1N6E A;  3V7D B;  4PXW A;  3SWS D;  2YNP A;  2AQ5 A;  3I7H A;  3PE7 A;  4PBY A;  3EI3 A;  4J0X A;  2AGL A;  5IJ7 E;  1OMW B;  3RN1 D;  2G9A A;  5EMK B;  1N6D A;  2BCJ B;  3L4O D;  2CN3 A;  4XEI C;  3U4Y A;  3J80 g;  3JB9 L;  3CIK B;  3C5M A;  3ZWL B;  1Q47 A;  3SJL D;  1MG2 A;  4XYI A;  2OVP B;  4LG9 A;  1PI6 A;  4J79 A;  2B5M A;  2AGW A;  1PBY B;  4ERZ A;  4OZU A;  3AH8 B;  5TEF A;  4QRJ A;  3SVW D;  1RI6 A;  4A0A A;  4K3J B;  3JZH A;  4XYH A;  2H9L A;  5FKT A;  4PNK B;  4A09 B;  2HKR A;  3PXS D;  5EM2 B;  4GMB A;  3RSE C;  5H1M A;  3EWE A;  4FAN D;  4YVD A;  1L0Q A;  1K32 A;  3NVQ A;  3MZL A;  3P4F A;  2J56 H;  3EI3 B;  2IUR A;  2I0S A;  4O3U B;  3MKS B;  4LG8 A;  2J55 H;  3SBQ A;  3EI4 A;  2YNO A;  4KFM B;  3IJC A;  4PSW B;  3FRX A;  4GM3 A;  4JT6 C;  3PVU B;  4JD2 C;  4J87 A;  1GOT B;  5HE1 B;  4H5J A;  3N0E A;  2H6K A;  3K26 A;  3RN0 D;  4ESG A;  1TYQ C;  4K3I D;  3OTT A;  3IJ1 A;  4EWR A;  1B9Y A;  4CI8 A;  2PM7 B;  3PSC B;  4ERQ A;  2PM6 B;  1NR0 A;  5HE0 B;  2HJ4 A;  3SMR A;  2YB8 B;  3UVO A;  1FWX A;  5TF2 A;  3SXT D;  5KDO B;  4FA5 D;  2H68 A;  5FA5 B;  5I5J A;  3EI2 A;  4GM8 A;  4U7A A;  3NVX A;  3ULE C;  3OL2 A;  5HE2 B;  2TRC B;  2YMU A;  2OK6 A;  3SFZ A;  2B5L A;  5A2Q g;  3OKT A;  3ORV D;  3HFQ A;  4A09 A;  2H9M A;  5H17 A;  3V9F A;  2IUV A;  4IMM A;  1SQ9 A;  3DXM C;  4CZX A;  4J81 A;  5CYK B;  1SHY B;  1XHM A;  3DM0 A;  2CO0 A;  3JZG A;  1N6F A;  3SHF A;  5EMJ B;  3UVM A;  4PBZ A;  4L1Q D;  4Y5R D;  2CO0 C;  4I79 A;  2OK4 A;  3VH0 A;  4E54 A;  5IJ8 E;  3EG6 A;  2HYE A;  4ZN4 A;  2QXV A;  3F3G A;  1K8K C;  3DXK C;  3UVL A;  2XU7 A;  4ZOX A;  4L3G D;  5FXY A;  3I8C A;  4AOW A;  3I7O A;  2H3X A;  3JPX A;  3MZK A;  3EI2 B;  4X61 B;  2OVR B;  2P9S C;  3A0F A;  1PGU A;  1QNI A;  4A08 B;  4J8G A;  1NEX B;  4CI2 A;  1S4U X;  4NSX A;  3IIY A;  3OL2 B;  4O1Q D;  3VA6 A;  3I8E A;  2AGX A;  4CY5 A;  3UKR C;  2O9K A;  4O3T B;  3JAM g;  3MKQ A;  2CN2 A;  4O9D A;  1U2V C;  2OVQ B;  1GXR A;  4FA9 D;  5IT9 g; 
#chains in the Genus database with same CATH topology
 5HQG A;  3UVK A;  5GSA A;  3PVW B;  1BPO A;  5M5V A;  5HYN B;  2GC7 A;  5GXH A;  2HXC A;  2IWK A;  3NVN A;  3K72 A;  5GXI A;  1UOQ A;  5C2W B;  4BH6 A;  5B4W A;  4E54 B;  3GD1 I;  3B7F A;  4PC0 A;  5AJA A;  4X63 B;  3MXX A;  1PEV A;  5THA A;  4J77 A;  4G55 A;  1JMX B;  5GMK n;  3EMH A;  4D9S A;  3VI3 A;  4BCC A;  3BWS A;  3W15 A;  5TDH B;  1VYH C;  4ERY A;  5CYK A;  2EBS A;  4E5Z A;  3CFS B;  2Z2O A;  3VGZ A;  3I7L A;  4WK0 A;  1GG2 B;  2I0T A;  1YFQ A;  3IUR A;  5C9Z B;  1OLZ A;  1UTC A;  2H6N A;  3OKW A;  1U8C A;  3OF7 A;  4BP9 A;  1E8M A;  5M61 A;  4G1E A;  2XL3 A;  4MMY A;  4GGD A;  4GQ2 P;  4JHN A;  5C92 A;  1GOF A;  2I0R A;  5HE3 B;  4J8B A;  4JSN C;  3F3P A;  1MDA H;  4JSV C;  3IUJ A;  4QL1 A;  3BG0 A;  3I2N A;  4L3H D;  2CE8 A;  2PM9 A;  4CY3 A;  4MK0 B;  4FWW A;  4LGN A;  4CZV A;  5C86 A;  5CXB A;  4A08 A;  4UI9 R;  3OW8 A;  5EAP A;  3N0D A;  3ZDY A;  1TBG A;  3AL8 A;  5CXC A;  4AEZ A;  3E0C A;  5M5U A;  2H9P A;  3K6S A;  3IKO A;  1JV2 A;  3IJE A;  3F3F A;  2OJY A;  3L4M D;  2CNX A;  3CFV A;  2XYI A;  3I7P A;  4FHL A;  3V4P A;  1R5M A;  4A0B A;  4N14 A;  4G1M A;  1UOP A;  3FM0 A;  2H47 A;  2VDL A;  4CC9 A;  3ZDX A;  4TZ4 A;  2I3T A;  3EQ7 A;  1JTD B;  4QT8 A;  1T2X A;  5EMM B;  4GQB B;  4A7J A;  1GOH A;  4BUJ C;  4E5Z B;  3RFH A;  4MMZ A;  3AFC A;  4GM9 A;  5EAM A;  4UM8 A;  2Z2N A;  4J82 A;  1UOO A;  3RLM D;  2IAA A;  4RE5 A;  5TEE A;  4G56 B;  4QAM A;  1GP2 B;  1U4C A;  2H6Q A;  4A11 A;  2Q7Q A;  2W18 A;  2PM9 B;  3PXW D;  2I3S A;  4OWR A;  2P9U C;  2P9P C;  4BP8 A;  3FGB A;  3I7N A;  4PSX B;  2P9I C;  2XL2 A;  3DDU A;  5CXB B;  3V5W B;  4X60 B;  1A0R B;  1XKS A;  3SBP A;  3AL8 B;  2BKL A;  4ZOY A;  5CXC B;  3EI1 A;  4JHP C;  5EAR A;  3OKY A;  3GRE A;  4A0B B;  5SXM A;  5IGO A;  4GGC A;  4AMY A;  4J73 A;  3BG1 A;  3EQ8 A;  3T3P A;  4CY2 A;  4QQE A;  2UZY B;  2P9L C;  4HDJ A;  1H2X A;  2EIE A;  1B9X A;  5AMS A;  2G99 A;  3I89 A;  3KRX B;  5M5T A;  4JT5 C;  4H5I A;  3RMZ D;  2JKX A;  2AGY A;  3QI0 A;  3VI4 A;  3UVN A;  4J78 A;  2VDM A;  5EML B;  3RRM C;  4CY1 A;  4ZOZ A;  2QR5 A;  5IC7 A;  3AL9 A;  5E6R A;  3J81 g;  4X3E A;  4DNV A;  3JZN A;  2HKM A;  2OIZ A;  5K19 A;  2IUP A;  4A11 B;  4CI1 A;  1K3I A;  2HJB A;  3C75 H;  2Z2P A;  1MG3 A;  2P9N C;  3IIW A;  2YNN A;  1M1X A;  2HU5 A;  4L9O A;  4GGA A;  3C9C A;  3DWL C;  1JOF A;  2XZG A;  2YBA A;  1H2Y A;  2VDR A;  2MTA H;  2VDP A;  4R7A B;  2HU7 A;  5H14 A;  4GZ8 A;  3MMY A;  3EI1 B;  4JSX C;  2PBI B;  2AH1 A;  1JJU B;  2J57 G;  4BL0 A;  1JMZ B;  3OKY B;  4Y7R A;  3SLE D;  4Z7Q A;  2B4E A;  3PSL A;  5K1C C;  4ES0 A;  3EU7 A;  2H13 A;  3V4V A;  5FQD A;  2WQ8 A;  4CZY A;  1VE6 A;  5FLX g;  3UR4 A;  5E6S A;  3I7K A;  1VZ3 A;  5AFU 3;  3JRO A;  2IUQ A;  3RFG A;  3C99 A;  4FA4 D;  1QFM A;  2H14 A;  4Z8L A;  2H9N A;  3SBR A;  5EAL A;  4FAV D;  4IA9 A;  5JWZ A;  4FB1 D;  2VDQ A;  4A0A B;  4Z7O A;  3GFC A;  1GOG A;  4ZOV A;  3UKU C;  5C2V B;  4WK4 A;  2HES X;  4JSP C;  5FKR A;  2GNQ A;  3SCY A;  4FA1 D;  3PXT D;  4A2L A;  1H2Z A;  1XIP A;  2GC4 A;  4UM9 A;  3ZDZ A;  5I5M A;  4CI3 A;  2AH0 A;  1P22 A;  2BBK H;  3KRW B;  4D0K A;  5FKS A;  2P9K C;  3DSM A;  3IJ0 A;  3ODT A;  2AGZ A;  4MMX A;  5FKQ A;  3EI4 B;  5IGQ A;  2UZX B;  3EQ9 A;  4J86 A;  4U1E I;  4GQ1 A;  2CE9 A;  3SN6 B;  3K71 A;  1ERJ A;  3GC3 B;  4J84 A;  4A2M A;  2QZP A;  2B5N A;  4O45 A;  1O6G A;  3QHY B;  4D6V A;  2IWF A;  3JRP A;  2QC5 A;  1SQJ A;  4J0W A;  4JXM A;  5EM2 A;  3K27 A;  5I5I A;  3NIF A;  1N6E A;  2VDN A;  3V7D B;  4PXW A;  3SWS D;  1QFS A;  2YNP A;  2AQ5 A;  3I7H A;  3PE7 A;  2VZ3 A;  4PBY A;  3EI3 A;  4J0X A;  2AGL A;  4NEN A;  4WJK A;  5IJ7 E;  1OMW B;  3RN1 D;  3FCS A;  2G9A A;  5EMK B;  1N6D A;  2BCJ B;  3L4O D;  1C9I A;  2CN3 A;  4XEI C;  3U4Y A;  3IUQ A;  3J80 g;  3JB9 L;  3CIK B;  3C5M A;  3ZWL B;  2HU8 A;  1VE7 A;  1Q47 A;  3SJL D;  1MG2 A;  2VDK A;  4XYI A;  2OVP B;  4LG9 A;  1PI6 A;  3O4H A;  4J79 A;  4O02 A;  2B5M A;  2AGW A;  4DNW A;  1PBY B;  3IVM A;  4OZU A;  4ERZ A;  3AH8 B;  5FFO A;  5TEF A;  4QRJ A;  3SVW D;  4AX4 A;  4NBM A;  4BCB A;  1I2M B;  1RI6 A;  4A0A A;  4K3J B;  3JZH A;  4XYH A;  1O6F A;  2H9L A;  5FKT A;  2EIC A;  4PNK B;  4A09 B;  2HKR A;  3PXS D;  1L5G A;  5EM2 B;  4GMB A;  3RSE C;  5H1M A;  3EWE A;  4FAN D;  4YVD A;  3ZE2 A;  1L0Q A;  2VZ1 A;  1K32 A;  4WK2 A;  4DNU A;  3NVQ A;  3MZL A;  3P4F A;  2J56 H;  3EI3 B;  3NIG A;  2IUR A;  1E8N A;  2I0S A;  4O3U B;  3MKS B;  4LG8 A;  2J55 H;  3SBQ A;  2XDW A;  3EI4 A;  2YNO A;  4KFM B;  3IJC A;  4PSW B;  1YR2 A;  3FRX A;  4GM3 A;  4JT6 C;  2VC2 A;  3PVU B;  4JD2 C;  1E5T A;  4J87 A;  4L1M A;  1GOT B;  5HE1 B;  4H5J A;  3N0E A;  2H6K A;  5HDB A;  3K26 A;  3RN0 D;  3ZE1 A;  4ESG A;  1VZ2 A;  1TYQ C;  4K3I D;  3OTT A;  3IJ1 A;  4EWR A;  1B9Y A;  4CI8 A;  2PM7 B;  3PSC B;  4ERQ A;  2PM6 B;  1NR0 A;  2EIB A;  5HE0 B;  2HJ4 A;  3MUO A;  3IUL A;  3SMR A;  2YB8 B;  5M5R A;  3UVO A;  3IUM A;  1H2W A;  1FWX A;  5TF2 A;  3SXT D;  5KDO B;  4FA5 D;  2H68 A;  5FA5 B;  5I5J A;  3EI2 A;  4GM8 A;  4RE6 A;  4U7A A;  2VDO A;  3NVX A;  3FCU A;  3ULE C;  3OL2 A;  3O4J A;  4NC4 A;  3T3M A;  5HE2 B;  2TRC B;  2YMU A;  2OK6 A;  3SFZ A;  3KCI A;  2B5L A;  5A2Q g;  3OKT A;  3ORV D;  3HFQ A;  4A09 A;  2H9M A;  5H17 A;  3V9F A;  2IUV A;  4Z7N A;  3MVD K;  4IMM A;  1SQ9 A;  1C9L A;  3DXM C;  4NAA A;  4CZX A;  4J81 A;  5CYK B;  1SHY B;  1XHM A;  3DM0 A;  2CO0 A;  4AMZ A;  3JZG A;  1N6F A;  2EID A;  3SHF A;  5EMJ B;  3UVM A;  4AN0 A;  4PBZ A;  3MUN A;  4L1Q D;  4Y5R D;  2CO0 C;  4I79 A;  2OK4 A;  3VH0 A;  4E54 A;  2XE4 A;  3EG6 A;  5IJ8 E;  2HYE A;  4ZN4 A;  2QXV A;  3F3G A;  1K8K C;  3DXK C;  3UVL A;  2XU7 A;  4ZOX A;  4L3G D;  5FXY A;  3I8C A;  5E6U A;  3ZE0 A;  4AOW A;  3I7O A;  3O4G A;  2H3X A;  3JPX A;  3MZK A;  3O4I A;  4O2W A;  3EI2 B;  4X61 B;  2OVR B;  2P9S C;  3A0F A;  1QNI A;  1A12 A;  1PGU A;  4A08 B;  4J8G A;  1NEX B;  5M5S A;  4CI2 A;  1S4U X;  4NSX A;  4AN1 A;  3IIY A;  3NID A;  3OL2 B;  4O1Q D;  3VA6 A;  3I8E A;  1TYE A;  2AGX A;  4CY5 A;  3UKR C;  2O9K A;  5FFG A;  4O3T B;  4IRZ A;  3JAM g;  4BCD A;  3MKQ A;  2CN2 A;  4O9D A;  1U2V C;  2OVQ B;  3IUN A;  1GXR A;  4FA9 D;  5IT9 g; 
#chains in the Genus database with same CATH homology
 5HQG A;  3UVK A;  5GSA A;  3PVW B;  5HYN B;  2GC7 A;  5GXH A;  2HXC A;  2IWK A;  3NVN A;  5GXI A;  5C2W B;  4BH6 A;  5B4W A;  4E54 B;  3B7F A;  4PC0 A;  5AJA A;  4X63 B;  3MXX A;  1PEV A;  5THA A;  4J77 A;  1JMX B;  5GMK n;  3EMH A;  3BWS A;  3W15 A;  5TDH B;  1VYH C;  4ERY A;  5CYK A;  2EBS A;  4E5Z A;  3CFS B;  2Z2O A;  3VGZ A;  3I7L A;  1GG2 B;  2I0T A;  1YFQ A;  5C9Z B;  1OLZ A;  2H6N A;  3OKW A;  2XL3 A;  4GGD A;  4GQ2 P;  2I0R A;  5HE3 B;  4J8B A;  4JSN C;  3F3P A;  1MDA H;  4JSV C;  4QL1 A;  3BG0 A;  3I2N A;  4L3H D;  2CE8 A;  2PM9 A;  4CY3 A;  4MK0 B;  4FWW A;  4LGN A;  4CZV A;  5CXB A;  4A08 A;  4UI9 R;  3OW8 A;  5EAP A;  3N0D A;  1TBG A;  3AL8 A;  5CXC A;  4AEZ A;  3E0C A;  2H9P A;  3IKO A;  3F3F A;  2OJY A;  3L4M D;  2CNX A;  3CFV A;  2XYI A;  3I7P A;  4FHL A;  1R5M A;  4A0B A;  4N14 A;  3FM0 A;  2H47 A;  4CC9 A;  4TZ4 A;  2I3T A;  4QT8 A;  5EMM B;  4GQB B;  4A7J A;  4BUJ C;  4E5Z B;  3RFH A;  3AFC A;  4GM9 A;  5EAM A;  2Z2N A;  4J82 A;  3RLM D;  2IAA A;  5TEE A;  4G56 B;  1GP2 B;  1U4C A;  2H6Q A;  4A11 A;  2Q7Q A;  2W18 A;  2PM9 B;  3PXW D;  2I3S A;  4OWR A;  2P9U C;  2P9P C;  3FGB A;  3I7N A;  4PSX B;  2P9I C;  2XL2 A;  5CXB B;  3V5W B;  4X60 B;  1A0R B;  1XKS A;  3SBP A;  3AL8 B;  4ZOY A;  5CXC B;  3EI1 A;  5EAR A;  3OKY A;  3GRE A;  4A0B B;  5SXM A;  5IGO A;  4GGC A;  4J73 A;  3BG1 A;  4CY2 A;  4QQE A;  2UZY B;  2P9L C;  4HDJ A;  1B9X A;  5AMS A;  2G99 A;  3I89 A;  3KRX B;  4JT5 C;  4H5I A;  3RMZ D;  2AGY A;  3UVN A;  4J78 A;  5EML B;  3RRM C;  4CY1 A;  4ZOZ A;  5IC7 A;  3AL9 A;  3J81 g;  4X3E A;  3JZN A;  2HKM A;  2OIZ A;  5K19 A;  2IUP A;  4A11 B;  4CI1 A;  2HJB A;  3C75 H;  2Z2P A;  1MG3 A;  2P9N C;  3IIW A;  2YNN A;  4L9O A;  4GGA A;  3C9C A;  3DWL C;  1JOF A;  2YBA A;  2MTA H;  4R7A B;  5H14 A;  4GZ8 A;  3MMY A;  3EI1 B;  4JSX C;  2PBI B;  2AH1 A;  1JJU B;  2J57 G;  4BL0 A;  1JMZ B;  3OKY B;  4Y7R A;  3SLE D;  2B4E A;  3PSL A;  5K1C C;  4ES0 A;  3EU7 A;  2H13 A;  5FQD A;  4CZY A;  5FLX g;  3UR4 A;  3I7K A;  5AFU 3;  2IUQ A;  3JRO A;  3RFG A;  3C99 A;  4FA4 D;  2H14 A;  4Z8L A;  2H9N A;  3SBR A;  5EAL A;  4FAV D;  4IA9 A;  5JWZ A;  4FB1 D;  4A0A B;  3GFC A;  5C2V B;  4ZOV A;  3UKU C;  2HES X;  4JSP C;  5FKR A;  2GNQ A;  3SCY A;  4FA1 D;  3PXT D;  4A2L A;  1XIP A;  2GC4 A;  5I5M A;  4CI3 A;  2AH0 A;  1P22 A;  2BBK H;  3KRW B;  4D0K A;  5FKS A;  2P9K C;  3DSM A;  3IJ0 A;  3ODT A;  2AGZ A;  5FKQ A;  3EI4 B;  5IGQ A;  2UZX B;  4J86 A;  4U1E I;  4GQ1 A;  2CE9 A;  3SN6 B;  1ERJ A;  4J84 A;  4A2M A;  2B5N A;  4O45 A;  4D6V A;  2IWF A;  3JRP A;  2QC5 A;  1SQJ A;  4J0W A;  4JXM A;  5EM2 A;  3K27 A;  5I5I A;  1N6E A;  3V7D B;  4PXW A;  3SWS D;  2YNP A;  2AQ5 A;  3I7H A;  3PE7 A;  4PBY A;  3EI3 A;  4J0X A;  2AGL A;  5IJ7 E;  1OMW B;  3RN1 D;  2G9A A;  5EMK B;  1N6D A;  2BCJ B;  3L4O D;  2CN3 A;  4XEI C;  3U4Y A;  3J80 g;  3JB9 L;  3CIK B;  3C5M A;  3ZWL B;  1Q47 A;  3SJL D;  1MG2 A;  4XYI A;  2OVP B;  4LG9 A;  1PI6 A;  4J79 A;  2B5M A;  2AGW A;  1PBY B;  4ERZ A;  4OZU A;  3AH8 B;  5TEF A;  4QRJ A;  3SVW D;  1RI6 A;  4A0A A;  4K3J B;  3JZH A;  4XYH A;  2H9L A;  5FKT A;  4PNK B;  4A09 B;  2HKR A;  3PXS D;  5EM2 B;  4GMB A;  3RSE C;  5H1M A;  3EWE A;  4FAN D;  4YVD A;  1L0Q A;  1K32 A;  3NVQ A;  3MZL A;  3P4F A;  2J56 H;  3EI3 B;  2IUR A;  2I0S A;  4O3U B;  3MKS B;  4LG8 A;  2J55 H;  3SBQ A;  3EI4 A;  2YNO A;  4KFM B;  3IJC A;  4PSW B;  3FRX A;  4GM3 A;  4JT6 C;  3PVU B;  4JD2 C;  4J87 A;  1GOT B;  5HE1 B;  4H5J A;  3N0E A;  2H6K A;  3K26 A;  3RN0 D;  4ESG A;  1TYQ C;  4K3I D;  3OTT A;  3IJ1 A;  4EWR A;  1B9Y A;  4CI8 A;  2PM7 B;  3PSC B;  4ERQ A;  2PM6 B;  1NR0 A;  5HE0 B;  2HJ4 A;  3SMR A;  2YB8 B;  3UVO A;  1FWX A;  5TF2 A;  3SXT D;  5KDO B;  4FA5 D;  2H68 A;  5FA5 B;  5I5J A;  3EI2 A;  4GM8 A;  4U7A A;  3NVX A;  3ULE C;  3OL2 A;  5HE2 B;  2TRC B;  2YMU A;  2OK6 A;  3SFZ A;  2B5L A;  5A2Q g;  3OKT A;  3ORV D;  3HFQ A;  4A09 A;  2H9M A;  5H17 A;  3V9F A;  2IUV A;  4IMM A;  1SQ9 A;  3DXM C;  4CZX A;  4J81 A;  5CYK B;  1SHY B;  1XHM A;  3DM0 A;  2CO0 A;  3JZG A;  1N6F A;  3SHF A;  5EMJ B;  3UVM A;  4PBZ A;  4L1Q D;  4Y5R D;  2CO0 C;  4I79 A;  2OK4 A;  3VH0 A;  4E54 A;  5IJ8 E;  3EG6 A;  2HYE A;  4ZN4 A;  2QXV A;  3F3G A;  1K8K C;  3DXK C;  3UVL A;  2XU7 A;  4ZOX A;  4L3G D;  5FXY A;  3I8C A;  4AOW A;  3I7O A;  2H3X A;  3JPX A;  3MZK A;  3EI2 B;  4X61 B;  2OVR B;  2P9S C;  3A0F A;  1PGU A;  1QNI A;  4A08 B;  4J8G A;  1NEX B;  4CI2 A;  1S4U X;  4NSX A;  3IIY A;  3OL2 B;  4O1Q D;  3VA6 A;  3I8E A;  2AGX A;  4CY5 A;  3UKR C;  2O9K A;  4O3T B;  3JAM g;  3MKQ A;  2CN2 A;  4O9D A;  1U2V C;  2OVQ B;  1GXR A;  4FA9 D;  5IT9 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...