3MUOA

Appep_pepclose+pp closed state
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
684
structure length
684
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Prolyl endopeptidase
publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
total genus 215
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3muoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3muoA01
2VJCA 5LP1A 4FFVA 1KU6A 5AI5A 2XUIA 1I6WA 3RKSA 4C4YA 2AJDA 2V96A 4J03A 5AO9A 5CH5A 2WM2A 2JIDA 1D07A 2RI6A 5T4HA 1BE0A 3VJMA 1EH5A 2O2HA 3QZUA 4X90A 4MYSA 5DNUA 2RHTA 5JAUA 4CG3A 5A2GA 1CEXA 5ALFA 5ALUA 4BAZA 3IA2A 3NOXA 1W1IA 3G8YA 5CXUA 1GT6A 2XUAA 1QFSA 2HRQA 3I2KA 2X8BA 4FNGA 3FCYA 4K6KA 2HU7A 3QMWA 2PSJA 5AKGA 5DTJA 1BU8A 1AUOA 1EHYA 5CURA 5K3BA 3TJMA 3DOIA 1YASA 4BAUA 4L9AA 1EDEA 3R3UA 4Y2YA 2WJ3A 5IVDA 3R3ZA 5DNVA 1T4MA 1B6GA 4KAFA 5FP0A 1LBTA 4KAJA 5ALYA 3WKEA 1JMKC 2FUKA 5AJHA 5AOCA 3VJLA 4DMKA 2PSFA 5D7BA 2BUCA 5ALHA 1XRPA 2ZJ6A 1U65A 2QZPA 4DM7A 4I4CA 4BC1A 2ZJFA 2Z5GA 3FVTA 4H7KA 2OCGA 2HADA 5AP9A 3AIKA 2EEPA 1H2XA 1A8QA 5FXMA 4DTCA 4BRSA 4AQDA 4IH1A 1CUZA 3A2NA 5T4FA 5E4TA 3EQ7A 5AH0A 4WY5A 4UBIA 2DQYA 1UK6A 1HBJA 2DHCA 3F8SA 3RM3A 4H18A 3I1YA 1E5TA 2XUGA 1L7QA 2GYWA 4AO6A 3FYUA 4L0CA 1LLFA 1LPSA 1ACLA 1EK2A 4AZ3A 4OYYA 3N2ZB 2BGRA 2WUDA 1TK3A 2IX9A 1XFDA 1O6GA 4X6YA 3ILSA 4H77A 3H1AA 4BDTA 5AI0A 4ZRDA 3PFCA 5FV4A 5AI6A 5K3FB 2J3DA 1CR6A 1BN6A 1WB5A 3SX4A 4M0FA 4BVKA 3V1KA 4RE5A 4C4XA 2HA4A 3CCCA 4HVTA 4H7DA 1CUYA 1AMNA 1QO7A 3PF8A 1XLVA 7YASA 1LPOA 4BVJA 2VT7A 1E89A 2HA6A 3QBJA 3DDUA 2H7YA 2WTNA 5ALJA 4BCDA 1BS9A 4X93A 4Y2SA 4ZXFA 1XRNA 1DINA 4OPMA 1YSCA 1U2EA 1LZLA 2Y6UA 3VDXA 5EFZA 4M0MA 4Q3KA 1BEEA 4KE6A 3R40A 2I3ZA 2Q0XA 5JYCA 1QIKA 2DFPA 3O9MA 3WYNA 1E8DA 3VVMA 2OCKA 3IDAA 5CTAA 5EHZA 5E4YA 3Q0TA 3HSSA 1WHTA 1RYYA 2C0QA 2W22A 4W1QA 5LZ8A 4C6HA 3BF7A 4D9JA 1CQZA 1NU8A 4UHHA 5A6VA 2VAVA 4X95A 2R11A 1X2EA 4Q3OA 2VQ6A 3WYDA 3FSGA 5ALRA 4PSUA 3G9TA 5KWJA 3L1JA 1HPLA 4A23A 2I78A 1H22A 1MX9A 2ZYHA 1XZHA 4C4ZA 1CUBA 5EHNA 1M33A 3KWFA 5BOVA 2JEYA 4BBZA 2C5GA 1MJ5A 1CPYA 4BCBA 4A16A 4AB1A 3FYUB 4Q05A 1IZ7A 5AKYA 4DNPA 1GQRA 1J1IA 2V9ZA 2O7RA 2GYUA 3F67A 2O2GA 1ACJA 2ORYA 4MYDA 1QJ4A 3HJUA 3BWXA 1ORVA 3QMVA 1EDBA 2W6CX 4QLOA 2GYVA 2FX5A 1HL7A 2OAEA 3IVMA 1HLGA 2VT6A 3ESCA 5AHXA 3GZJA 3HEAA 3STYA 4Y2RA 3BE8A 1CUXA 1BEZA 4V2IA 1WPRA 4WFKA 3WWDA 4K5QA 1BCRA 2XUDA 4X7BA 1XROA 1F0PA 2VATA 3FWHA 3G9UA 5HCUA 5C8VA 3S8YA 3C45A 4NS4A 1G66A 1JJFA 4E15A 3BDVA 3H0CA 2WIGA 1YAHA 4QDXA 2H7XA 1UWCA 4UBOA 5ALXA 1LNSA 5AI9A 4Y2UA 5SYNA 5D3KA 5FUMA 4KR0A 4DMFA 2OCLA 3OPMA 3G9XA 4NZZA 3TEJA 2CZQA 2WTMA 5LZ9A 1CUHA 1EX9A 4UPDA 3R3WA 4P93A 2QMQA 2JBWA 2HA2A 2ZYSA 4ZREA 4PSDA 2CMFA 3EIOA 1XZJA 3E4DA 4DSAA 3B5EA 3O4HA 1L7AA 5BV7A 1A8UA 4ZWNA 2EDCA 4U2BA 4G4IA 3FLBA 4XIIA 1H23A 5AM3A 3DKKA 2J4FA 2Z8ZA 4CIBA 1DTEA 1ISPA 1IUNA 4DNOA 1DWPA 3O9VA 5HQ3A 3IULA 3C43A 5CBKA 2VJBA 1C7IA 5ALGA 2I03A 1Y7IA 3DLTA 2XB6A 2D0DA 4H7EA 3QMMA 1UKCA 5AKIA 4K6GA 2XMBA 3CCBA 4RPCA 4UHCA 1DX6A 2BFNA 4Y9SA 3GUUA 2WFMA 5CW2A 3WLAA 2H7CA 3H2HA 3TGLA 3R0VA 1W76A 3A6ZA 5K3EA 4BYMA 3BIXA 3W05A 2QKYA 3WIOA 2ROQA 2RONA 1MPXA 3FYUC 3I6ZA 4FKBA 2I3DA 4J0HA 4QDTA 4Y7DA 4LYEA 1MX5A 5LLSA 1VZ3A 2ZYIA 1ZD4A 1E66A 1XQYA 5JADA 4KACA 4OB7A 4QDOA 5E4JA 1TCCA 3A2MA 4OCZA 4FTWA 1AZWA 2WIJA 4S0XA 4BTLA 1EVEA 2H9YA 2JGJA 4HXGA 4O08A 1UXOA 4QDZA 3WKBA 1ZD5A 3D4LA 4BE9A 5JZ9A 1KEZA 3BJRA 2XMCA 1QIEA 5AK6A 5J3JA 5K3CA 5DTIA 4UBLA 4PNZA 4G4GA 5CH3A 4Y2VA 2C0PA 1FFCA 3H19A 3QM1A 5ALTA 2D5LA 4TPKA 4HZGA 1ETHA 2AJCA 5FLKA 4BZWA 5AK3A 2VF2A 5JANA 4NVRA 1JU3A 4CI9A 3H2IA 1ODTC 4YX9A 4QWMA 1CUEA 1ZOIA 3AZOA 2ECFA 4EBBA 1QO9A 3C6XA 5ALDA 3EQ9A 2YYSA 3M3DA 3C5VA 1XQVA 2XQFA 2Y6VA 5AM0A 3ZV7A 3PF9A 3QPDA 2VTVA 4GWLA 4MEBA 4J7AA 3PUHA 3VXKA 3C8HA 1HDEA 2G63A 3OTQA 4F5ZA 3G0CA 2OPHA 4OD0A 3F98A 4J0IA 4IH9A 5AM1A 5T4BA 1VXOA 2Z8XA 3H04A 1EINA 3STWA 5HQ3B 3N0TA 1XZIA 1WB4A 1T2NA 1CRLA 3W9BA 4X71A 1E8NA 1CUGA 1QIDA 1G4HA 3KDAA 4UBJA 3W06A 1N8SA 4ARBA 2GZSA 2O7VA 1IVYA 1YA8A 3BJMA 4JYMA 2GBCA 3IURA 4FDMA 1XZCA 3AZPA 1B41A 1CLEA 2HRRA 1EXWA 1N1MA 5EHXA 1LPNA 2XLCA 4IHAA 1H2YA 2PSHA 4HTAA 4KE8A 4OYLA 5EIEA 2K2QB 4PW0A 3CN7A 4YK7A 1J07A 1MTZA 4U2FA 5JARA 1ZIYA 3TRDA 1GQSA 1CUFA 2XMDA 5LZ5A 3T52A 3HZOA 4QZVA 4W1SA 1JU4A 1GPLA 2VJDA 4DYHA 5D3ZA 3NUZA 3C6ZA 3PUIA 4QLAA 3ZLUA 4DNFA 1ZGCA 3OURA 1OILA 1DWOA 1RWQA 3I2IA 3JWEA 3ZPXA 1GZ7A 5AKKA 4G1FA 3W04A 4RGYA 2XQIA 1YB6A 2XMRA 3ED1A 4L72A 4EY5A 4F21A 2V98A 3O95A 3LIPA 1XZEA 5H3HA 2WQZA 2HDWA 4INZA 4B80A 3PI6A 3V1LA 1Y7HA 2WHQA 3ESBA 5IVKA 1C7JA 2CKMA 2Z3ZA 3OG9A 2WG1A 2VA9A 3G9ZA 5CH8A 1UK8A 1XQXA 4XVCA 4BB0A 2WU3A 4CCWA 3WQHA 4DNQA 1QIMA 4K2AA 4B6GA 5IVHA 2BUAA 2AXEA 1EB8A 1IUPA 3HC7A 3L1HA 4G5XA 1QIHA 3FYTA 1VXRA 4F0JA 4QE3A 1F0NA 5AIAA 2PU7A 4LXGA 1IZ8A 2WUFA 3I2GA 4FLEA 1X2BA 3O0DA 5DYTA 4HS9A 4B84A 4J0GA 5A71A 4AMYA 3PE6A 3K9BA 1CUAA 3LIIA 4EY7A 3WK5A 3WL7A 3I28A 2OAGA 4BC0A 3H2GA 2C5FA 1LPBB 4AX4A 5CT8A 1LGYA 3FLAA 1ZGBA 3G0GA 1TIBA 1SC9A 1L7RA 1JT2A 4BP8A 3DJYA 4EHBA 2OGSA 4UBKA 2YXPX 2VJAA 2IIVA 2OCIA 1R1DA 1MU0A 1XRRA 3ZI7A 2R8BA 4W1RA 1OXMA 1FFEA 2XQKA 3IUMA 2C58A 2WFLA 4FWBA 5K5EA 2FJ0A 4KJXA 1THGA 4UFPA 2OGTA 3D59A 4TGLA 4X91A 3V1MA 1XZMA 1SFRA 5HK8A 3WJ2A 3P2MA 2P8SA 3ANSA 2HA0A 1F6WA 3O4IA 4OU5A 1Q83A 2QT9A 2JGIA 1N5MA 2XI4A 4JUIA 2ONCA 4ZI5A 1AQLA 2G5PA 4Y2PA 4X97A 2JGLA 5AKHA 3A70A 3WA6A 1JMYA 1XZGA 3W2TA 2XT0A 1JJBA 1WOMA 3X3HA 5IH7A 3AINA 3GA7A 2OGZA 1CUCA 1AX9A 4Z49A 3SWWA 3T4UA 4UBNA 3WK4A 4LHEA 1VZ2A 1MN6A 4B0PA 1XZDA 1YS1X 4UUQA 3U0VA 4NMWA 1GPKA 3DEAA 1E3QA 3EQ8A 2ZJ7A 4KEAA 2QVBA 1EK1A 2XQJA 3S2ZA 1QZ3A 2WUGA 2WIKA 4EA6A 4K6HA 2RGUA 3GBSA 3G7NA 5HF6A 4BRZA 5FOQA 1JI3A 2BGNA 1CUIA 4BAGA 4FLFA 5AK4A 3WK8A 4H0CA 3C8DA 4WY8A 1BRTA 2PBLA 3R3VA 1LZKA 3MUOA 2OXEA 1UK9A 4PSCA 4X00A 1SCKA 1ZI9A 4OU4A 1K63A 3WL5A 4HRXA 2QJRA 3FCXA 5CT9A 4WCVA 1OCEA 4G8CA 2IITA 3V48A 2WHPA 2PSEA 3PFBA 2VAXA 4JNCA 2CB9A 2OG1A 2QUBA 3FVRA 5C7YA 3I2JA 1ZI6A 1TAHA 1GKKA 1WHSA 5AM4A 1GPNA 1U8EA 3OC0A 5ALLA 4EZIA 1NU6A 5ALNA 2LIPA 4ARAA 1BROA 2WLSA 4LXHA 4IQ4A 2B4KA 4I3FA 2OQVA 5HFAA 1VE6A 5DJ5A 2WJ6A 4EY8A 3C87A 4MQMA 4EB0A 1R3DA 3G0DA 1K4YA 4X92A 1YS2X 1XZBA 1MNQA 3D0KA 1WCYA 2BUBA 4XWGA 4MEAA 2J4CA 3HRHA 4C89A 5D6OA 4UFOA 2YH2A 1A88A 3VVLA 1GGVA 2QXUA 1LBSA 2DHDA 5AI4A 2VEOA 1ZI8A 4HRYA 5C8ZA 5HFNA 3H18A 2DSNA 2BAGA 2WUEA 3WWEA 2WG0A 5HK9A 2XUJA 3H2JA 4H7IA 3SK0A 4B82A 1P0QA 1ZD3A 1QOZA 3D2CA 1U4NA 5AICA 3O4GA 3I2HA 4Q1VA 5BWCA 2JF0A 5AKZA 5EIAA 3WZMA 4U2DA 1UFOA 2AJ8A 2E3JA 1SOMA 3UUEA 4RNCA 2XUPA 4LYDA 1EA5A 3R3XA 3NWOA 2Z3WA 3V1NA 1ODCA 4FNMA 4KE9A 3RK4A 2XMZA 3KSRA 1TRHA 1WM1A 1USWA 4B9EA 3QPAA 2AJLI 4XX1A 2HA3A 1VE7A 1TKRA 4X6XA 1DT3A 5A7HA 4CCYA 5FDFA 4Y2JA 5ISMA 5DNWA 1KU0A 4PQEA 5EGNA 1HKHA 3HACA 1XZKA 5FRDA 1ZD2P 1LPPA 3VKFA 5C81A 5JD5A 1H2WA 1VLQA 5ESRA 1R9NA 3U1TA 2FJPA 2QXTA 3MUNA 3QITA 4ZGBA 3WWOA 4BZZA 2QUAA 4DGQA 5FPPA 1THTA 1HQDA 3K2IA 4Y2TA 1UKAA 3IBTA 4ZV7A 3NGMA 3HYSA 2WFZA 1UOOA 2X5XA 5T4EA 3E0XA 1AGYA 1QE3A 1CUJA 3STVA 2PX6A 4EUSA 3D3NA 3MGAA 2O2IA 1Y37A 1ZJ4A 4LKOA 3AZQA 1XKTA 2JGFA 4GI1A 4CG1A 5AKXA 3FBWA 2BCEA 4P9NA 3I6MA 1DWQA 1YAJA 2DCMA 3IUJA 2XMSA 1ZIXA 5DWDA 1CUUA 4ZV9A 4QDUA 1SCQA 5LZ2A 1EB9A 2HM7A 5IKXA 2JGEA 2WJ4A 4BE4A 1JFRA 3M82A 2PM8A 1MAAA 1XRLA 1ORWA 3VISA 3HABA 2EDAA 5AKJA 3R41A 1WB6A 4OSEA 2CUTA 4U2GA 1VJ5A 5DYYA 3ESDA 5ALOA 4UHDA 1R4ZA 3F9CA 3DOHA 1R88A 2OQIA 5EIHA 4DLNA 2B9VA 3JYHA 1X70A 4OUKX 3RARA 2HL6A 4WDRA 3V9AA 4QWWA 5CRIA 5ALPA 2G4LA 4FFWA 3FSGD 2WKWA 4G9GA 5A62A 3DKRA 1XZLA 3AIOA 3UMJA 4J0KA 1G5FA 5HF8A 5JATA 3QYJA 1RP1A 5AKLA 4N8EA 5BWBA 4PF1A 3I2FA 3DS8A 5ALSA 3BL8A 4U2CA 5LYYA 1Q84A 4HXEB 3WWCA 3FNBA 5JAHA 4CCYB 4EY6A 2J3QA 2ZSHA 5I8PA 2UZ0A 4GBGA 3LS2A 4UFNA 3WWPA 1FSSA 2XMQA 2PUHA 2WG2A 4WJLA 1AURA 3UUFA 4B9AA 5JASA 4C01A 3DD5A 5ALQA 3JW8A 1PFQA 2RHWA 1UK7A 2JGKA 4GEGA 2GZRA 1R9MA 4ETWA 4QA9A 4GHWA 1DQZA 2PU5A 3HI4A 3DQZA 4FBLA 4FHZA 4J0CA 1QGED 1JKMA 4GLBA 3WK6A 2QJWA 4IO0A 3BIWA 4W9RA 5KREA 2QOEA 5CXXA 1MNAA 1ZICA 3CN9A 5ALVA 1WPXA 5JAOA 4AMZA 5JAPA 1UOQA 2VSQA 2YASA 3H2KA 4H7HA 1QIFA 4JYPA 3KXPA 5HF9A 3D5EA 1J06A 1G42A 3W9UA 1H2ZA 4BP9A 5KWIA 4X85A 4MJ3A 2BJHA 3ZLVA 3IB3A 4DIUA 3ZLTA 1ODSA 1P0PA 4N5IX 1UT6A 4MWTA 5AM2A 2XE4A 4E14A 5JD6A 2CJPA 3KWJA 5HZGA 5K3AA 4JH0A 3ANTA 3PDCA 4WFIA 4F60A 4BDSA 3WKAA 3B12A 4WFJA 2PL5A 4N5HX 4RE6A 4UHFA 1CQWA 1VA4A 3AUKA 1XRQA 3ZWQA 1YR2A 4EY4A 1TQHA 2ACEA 2GBGA 2PKYX 5A7FA 3FAKA 1ZJ5A 2XLBA 2G5TA 2C7BA 2XUHA 4UHBA 2X76A 5IVIA 3IUQA 1A8SA 1VKHA 1A7UA 2QR5A 3GROA 5I9IA 2PUJA 5CT6A 3MVEA 1W4LA 3WMRA 1XKLA 4MQLA 2QM0A 1FJ2A 2B61A 4PV7A 2ES4A 1LPMA 3AIMA 1QIIA 1CVLA 3WIBA 2HHAA 1PV1A 5HKAA 4G4JA 5AIBA 1QIGA 4L3WA 1AC5A 1XLUA 4G8BA 3I6YA 2WHRA 3H1BA 1P0MA 4CFSA 2RAUA 4CIAA 1DQYA 4C88A 4KYVA 3E1GA 4X6UA 2Y2VA 4FLMA 5LIPA 3H17A 2WIFA 1BCSA 4GDMA 5C8XA 3BXPA 1JJIA 2RIPA 5JZSA 3RLIA 1QLWA 2DR0A 2WSLA 1DT5A 4GXNA 5AK5A 3DYVA 4MXDA 4X3CA 4AXBA 2XUFA 3B3QA 1N5RA 4C87A 1E8MA 5KBYA 4B0OA 3F97A 4FBMA 2HU8A 2CBGA 1MAHA 4BATA 1IUOA 1XZFA 5ALEA 4UBMA 1PJAA 1Q0ZA 1CV2A 1EI9A 1MT3A 3D2AA 3KOOA 1IMJA 2BKLA 1FFBA 2GBFA 3DL4A 1MX1A 3M83A 4WDQA 4XJVA 4JEIA 1GKLA 2ZYRA 5AOAA 2Y2UA 2XUKA 5AI8A 3BDIA 1DU4A 2HA7A 3LP5A 1K6EA 1XLWA 1QFMA 3AFIA 1Q0RA 3GELA 3WKCA 2Y1KA 4P08A 3EF3A 5HKBA 1S8OA 4X94A 4UHEA 3SC2A 4YPVA 4AZ0A 5CT4A 3G02A 2JEZA 4H7FA 4GECA 4DMHA 4AO7A 4OB8A 1CUSA 5DYWA 1QTIA 3A2LA 4A5SA 1QONA 3PICA 3WZLA 4J3JA 4Y2QA 6YASA 4BCCA 2XQGA 3STXA 1MO2A 1F8UA 4AN0A 3IIIA 5JIBA 3OM8A 3R3YA 5ALMA 4Q34A 2QS9A 4B85A 2C4HA 1XZAA 2WIDA 3M81A 4B81A 2AJBA 3STTA 3C6YA 4Q82A 4U2EA 2OLEA 4H7JA 2PPLA 3QVMA 1UKBA 4W63A 3STUA 5LKRA 4W1PA 4GW3A 5LKAA 1LPAB 4I19A 2HFKA 3G0IA 3WL8A 2HA5A 1K5PA 4N8SA 4P92A 2DQZA 1GXSA 2JGMA 4E46A 5CMLA 3EBLA 4Q3LA 4AN1A 4BVLA 4J0DA 2HU5A 2WFLB 1YCDA 3HLKA 3QH4A 3WA7A 4FOLA 3LCRA 1CUWA 1O6FA 1TCBA 1UOPA 1W6RA 3WK9A 2B20A 1J2EA 5FKJA 1C4XA 5I7UA 5AOBA 1W75A 3WI7A 1CFJA 1R50A 1VOTA 2V97A 2NW6A 2WU4A 1AKNA 3WKDA 3O4JA 3CXUA 4ITVA 5AM5A 3DL7A 3D2BA 3ICWA 4DMCA 1YB7A 4FMPA 4OB6A 5LZ7A 5CT5A 4CG2A 1FFAA 5YASA 2QTBA 1K8QA 4M0EA 4KRYA 2CEKA 4MWSA 1XQWA 5AKEA 4IH4A 4ROTA 3DYIA 3HXKA 4YASA 4AO8A 2ZVDA 4G8DA 1BN7A 3Q8WA 3OOSA 1VA5A 3GFFA 5E2IA 4N8DA 1XRMA 4LXIA 5K3DA 4HXFB 3ESAA 3DNMA 3IUNA 4QNNA 3BF8A 5SYMA 4E11A 4LIPD 2QRUA 5ALZA 2XDWA 5ALKA 4H35A 4HAIA 4B83A 3G0BA 5A7GA 3C70A 2HFJA 1EVQA 5ALWA 3QPCA 4DSZA 2XUOA 1TCAA 2ZSIA 3L1IA 2HIHA 1Z68A 4B7ZA 2H1IA 5JD4A 4TVKA 1FFDA 4QEKA 3D7RA 5HF5A 4Y2XA 3LLCA 2DHEA 5F4ZA 2XMGA 3VJKA 1QIJA 5JZBA 2PVSA 5EHQA 5JALA 5ALIA 3YASA 4BTVA 3FLEA 1CIJA 4J0JA 2WHPB 1P0IA 2PSDA 4KAAA 3WJ1A 1W52X 5LZ4A 3WL6A 5EI5A 1NX9A 3ICVA 3C5WP 3FOBA 1CUDA 3F96A 4PO3X 3K6KA 3AILA 1DX4A 2WILA 1YA4A 3DCNA 1QTRA 4KE7A 3WK7A 3E3AA 1EDDA 2XUQA 2ACKA 3AJAA 3I1IA 5FPQA 1SCIA 2GBIA 4G9EA 3C6BA 3KD2A 5K3FA 5DLPA 1UZAA 4KRXA 1CUVA
chains in the Genus database with same CATH superfamily
1L8XA 3LQQA 2YVLA 1UINA 4D9FA 2RI6A 2FR8C 3KEFA 4JNKA 3D4OA 1F0KA 2NUPA 4JLSA 5JJKA 2NG1A 5I4IA 3Q3IA 2QQFA 4KQFA 2O8BB 1CEXA 4FGZA 3IXLA 1ZEMA 5B1IA 3IA2A 3GJXC 1M2VB 2DBQA 3C4JA 1XJ5A 1GWNA 4B44A 1NW5A 4Q39A 2J48A 2C4TA 2P4EA 1QH1B 4MH0R 4E0BA 2WYHA 1NNEA 4J43A 3H9JA 1V2HE 2FUKA 4XQEA 1ESEA 2K87A 1R6UA 2JI8A 4QHYA 3QXGA 2GC7A 4D3YA 5KEIA 3D4NA 1RWNA 5GONB 4QLBA 4WCFC 5HJ5A 4P4UA 3RFUA 1BFDA 4JI2B 1XCMA 3A2NA 4KH1A 5T4FA 5BWMA 3N0EA 4WLOA 1WV0A 3SS9X 4FC6A 4XEIC 5EYPA 2EFEB 1NBMD 3VDNB 1OAOA 2A9VA 4EX6A 3WJAA 5FAKA 3AH8B 4WOBA 1PNRA 4X6YA 4YGXB 2QLJA 2V5VA 3VU9A 3HCCA 1Z12A 1EX1A 2PWPA 5EGSA 4GNRA 4OAOA 5FV4A 4NF2A 1IHPA 3V8RA 1M6NA 3KTFA 1MB9A 1CVRA 4WAUA 4TVSA 3RVOA 1D2CA 4OMFG 3UPTA 3DEFA 4A6DA 3WSVA 2HHHB 3HN7A 1Q11A 3PF8A 1XTIA 1Z2NX 2IYRA 3AM5A 2QD5A 3TQHA 4W7IA 1E89A 3GV0A 2WTNA 3AR4A 3E1KA 4EG7A 1SQ0A 1DFGA 3FPHA 3G2HA 1L7PA 1EEHA 2IYYA 2PLWA 4ZVNA 2VP4A 3SZLA 1BEEA 2GEUA 1FP2A 1X7GA 3CIKB 2XRMA 1FYWA 2VIIA 4EHHA 2R25B 3PQFA 3VVMA 2GJSA 4HMOA 1AS3A 4Z0NA 5FQOA 1XO1A 2JZCA 5LZ8A 2XZGA 3WRWA 3JRNA 3ED5A 3NYRA 5JD3A 4PPNA 2ST1A 3JCZA 4ZC8A 4X95A 2HREA 3B85A 5JJIA 3G9TA 4JA2A 2A7QA 1AUVA 3HU1A 1KY3A 2IEBA 1M33A 4DUYB 2EARA 1FRFS 3VJRA 2X5NA 4Q05A 1K6MA 3BMQB 1L5VA 5K19A 4RNDB 3V7FA 1MB3A 3OT1B 2Q8QA 3AG5A 2PM6B 1XLTA 2O1SA 1GGNA 1NI4B 1ORVA 1GVNB 2CB0A 2NOAA 4XUGB 1USKA 3QXHA 3K4PA 4INPA 1LLDA 1M7HA 4F4UA 1WPRA 4AX8A 2DWUA 3BC1A 2D0OB 1L4KA 3ZVMA 2I2XB 3I1JA 1GN9A 1Q7TA 3G9UA 3Q3CA 5DDIP 1MJFA 4NS4A 4X1KB 1JSLA 4P3OA 3A9RA 3CNLA 1RRGA 5CIWA 3QWFA 4A11B 2F3QA 3BKWA 4Y2UA 3WDSA 3EQ6A 4Q03A 4LXXA 3SFVA 4PNHA 3WNZA 1MZPA 2BGUA 3UK1A 3UV6A 4K9KA 3OX3A 3JQBC 2WTMA 3HY6A 3PHBE 1R9JA 1PT8A 1R6XA 1RVDA 2ZYSA 4DQDA 2HJ4A 5A4FS 4TWAA 2OTCA 4LVCA 1QR2A 4OZUA 1AG9A 4JC8A 5CVEA 2ODNA 3C99A 1GOTB 3H11B 1QHHA 1CJCA 3P9CA 1O03A 5CB4A 3GQVA 4MRSA 1C7IA 2E18A 3G0OA 4FHDA 1WL8A 4RPCA 4IIJB 1DX6A 2QC5A 3UN1A 4M8NE 3GUUA 1A8PA 3GLIA 2P91A 1ZOSA 1V8FA 4RJKA 2C2HA 6REQA 3CWZA 1YZ3A 1IZ0A 3HEMA 4Y7DA 1Q20A 3SBXA 5JADA 1P18A 1SCUB 3IDOA 1PSWA 5D5HA 2VPTA 1GFIA 3RT7A 3ZV3A 5FNVA 3FUVA 1YVUA 3NGXA 1W25A 4D79A 5F73A 4B7XA 4MPJA 4BL5A 5TPWA 3HLYA 5IBRA 2QU8A 3KV1A 2IOQA 3LRXA 1Z25A 2NV2B 4DA0A 1NOKA 2O6LA 1HK7A 4UOEA 4EBBA 3IPRA 2BEVA 4PZEA 5H4GA 3M3DA 3C5VA 4UE6A 5KKNB 5F7JA 1KZ1A 4NZYA 4O2BF 5ESXA 3VXKA 3VI3B 4ESHA 4V1CB 1QM5A 5DK4A 2IYFA 3WDMA 4GPAA 1NW8A 2X8AA 1O1YA 3EA4A 1ZD8A 4JR0A 3QVKA 3E05A 1EINA 16PKA 1DKPA 1GUZA 3DR3A 3O1HB 1RLOA 3LQ4A 4PFKA 1P5RA 2EYUA 4AMGA 3ORSA 1CVIA 3KQKA 4BASA 5AHOA 3N70A 1LQTA 3N39C 3PA6A 3SAJA 2G7MC 4NE7A 4OH7A 4EWRA 4QD3A 4YJFB 2DP4E 3EOZA 2R86A 4G23A 1XNJA 4PS1A 4K8RB 3A58B 3KQOA 2GCOB 4BNDB 4GZMA 3SC3A 1XN1A 4U2FA 3PXGA 3R20A 3RC2A 1T0BA 4DR3B 4F93B 3P1JA 2AOTA 3OCZA 4RD0A 3GP3A 2XB9A 4C43A 4LE0A 5AD1A 1U6JA 1WAMA 1GPLA 2W6OA 2FW6A 5LXTF 1U80A 4YC7A 1ZAKA 3VI4A 2W2VA 2CYBA 2CVQA 4KO3S 1RM4A 1QHFA 2B8TA 2V6MA 4D3FA 3FNFA 5HZHA 3GEHA 3ZE1B 4D41A 2Z8YM 3I52A 2RIRA 5IP5A 1ZCJA 3NTVA 2XF8A 1NVAA 2AD5A 2V3CC 5DEIA 1L5HA 5DGCA 4EJ0A 3I89A 1NC1A 4DVGA 3PI6A 3QVOA 2O9KA 2VUSA 3E82A 5A5VA 4JQCA 2UZ4A 1U7DA 4EF4A 2WHQA 3ZE2B 1LSSA 3QF4A 4Q3BA 4F3TA 4CWAA 3CSDA 1NE2A 3NRBA 1G5IA 4H4EA 3EIWA 4BNKA 1GL7A 4R05A 3S68A 1YBVA 3T06B 2FN3A 4IHJB 5DTMA 2X23A 4HX5A 1I2BA 2PL3A 2GOYA 3RVKA 1M0EA 1EB8A 1HQKA 5EERA 1V7CA 4TWZA 2BR3A 4KODA 3QVXA 1AGRA 4LJYA 2BMDA 2WD8A 4OM8A 2ONJA 3P0EA 5FF9A 3ZHSA 2IDZA 2NZYA 4O3FA 3UANA 3OQ1A 5J4VA 1EXVA 3EHEA 3GLIE 1DBWA 1CJKC 1A12A 1M2GA 3JQCA 3IKJA 1DCMA 1B0PA 5L7WA 2WPDA 5H02A 2QRVB 4RV5A 1TYEB 2BJWA 4TWIA 4LWPA 5DNYB 1CZHA 1MP0A 4UI9R 2JCYA 3BD8A 3KQQA 2VHWA 2I0FA 3PGJA 3KUCA 2WSMA 2R8BA 2P0YA 2CVZA 3S1AB 1FL9A 4YXFA 2JGNA 2WFLA 2FW7A 3SQDA 2OMKA 2WSIA 1THGA 1S6YA 3V1MA 2VPIA 4YLEA 3UV3A 1X7YB 3KG2A 1P2BA 3D2LA 5LD2C 2FUEA 4LC9A 4JT6C 2Q4OA 2HT6A 3H5TA 2EF1A 1R3UA 4BNHA 5F33A 1WNTA 2NMVA 2VDNB 3L4MD 3GA7A 2Z9CA 2ZRIA 2J30A 4REQB 4ZAFA 3RVPA 3ZWBA 4LJ6A 4GSKA 2QRPA 4HWTA 4DRXA 2P6MA 4HH3C 3MJFA 1JZQA 2RMKA 1MN6A 1GPYA 1XVLA 1DV1A 5BWNA 4CY2A 1E3QA 1K6JA 4R9VA 3V7WA 5KOIA 3DFFA 3PNOA 1X19A 1SBTA 1AU9A 4TM7A 4BAGA 4ETMA 3GHYA 4WY8A 4EGFA 3MUOA 2P3QA 3GUVA 1W4CA 1HNXB 1WVIA 2CL6X 3U4YA 5KTMA 2G8NA 2FSHA 5LUAA 4EF5A 3T61A 3S81A 4OQPA 2H1LA 4R31A 3A06A 5B55A 5EJFA 4KU4A 3TAXA 2KM1A 4HF7A 4H60A 4XIGS 5A3QA 4GVLA 1P7WA 1M8PA 3W8RA 4I1RA 2P2NA 4P3NA 1SURA 3ECSA 2G6BA 2QJOA 1LI5A 2B4KA 1OXSC 4RPIA 5IKEA 4JIGA 1YDHA 2YICA 5BN5A 3GA5A 4ZAVA 1J5EB 3VU3A 3PQDA 3QEMB 4CMEC 1UAYA 1RJGA 4YJKA 3FHTA 1OH5A 3WB2A 3HRHA 4O4JF 4BL0A 3P9XA 2Q6IA 2XKAA 4L4YA 5DN6A 5EJIA 2YH2A 4ZEXA 4CI2A 5IJ7E 3FTFA 4RDHA 5IXJA 3Q5EA 3IH5A 4HRYA 4FYJA 3NRCA 3A1CA 4I1PA 4B47A 3JQ7A 1ZIPA 1HOTA 1GOGA 1UXJA 4Q7EA 1KYIA 4WK2A 2JC3A 3O4GA 5EMKA 2BPOA 2JF0A 1KHHA 4DCOA 3VNVA 5JNVA 4EK9A 5K6RA 4J7XA 3S8MA 3QE2A 4FNMA 1QG6A 2XMZA 3HR8A 4IFEA 1EUCB 1EFDN 5B6PA 3UMSA 1W5AA 1MD9A 2V6JA 3JWPA 4HNAB 721PA 1I6LA 4DL9A 2ILVA 3C7AA 5EGNA 1ODLA 3ZH2A 3G1TA 4QC2A 3CO0S 2ZT7A 4E70A 3V8PA 3U6BA 1S89A 4WK6A 5AUPB 1CP3A 1JJUB 5EXXA 2G7ZA 5H80A 4MKZA 1S2MA 1E92A 2GO1A 1WEHA 1ONSA 2ATIA 2GTHA 1X14A 4BMYA 1TVCA 1J0DA 5KAMA 1R6AA 4HJRA 1T8TA 4MCIA 2YNPA 5HE8A 1NP3A 1O94C 1EG7A 2PY6A 1WQ1R 3U3ZA 3ND9A 3KKKA 4IDHA 2WYIA 2XMSA 2BHLA 2PD6A 5M5RA 3DFMA 2A0UA 5DWDA 1AXGA 5LMZA 3RVQA 1YE3A 3QHYB 1PFVA 4PRYA 2QW8A 5IKXA 3GCDA 3CLHA 3AI2A 2FZ5A 3FMFA 1VG9B 1MAAA 3HABA 1VJ5A 1M2EA 2WJPA 1R4ZA 2WOOA 1ITZA 3PXDA 5CFLA 5KSPA 2WF5A 2QTGA 3JYHA 3WBJA 5KDOB 2CN3A 3RARA 3KZCA 2V7TA 2W6JD 1SVKA 4NK5A 3I9LA 4MVYA 5CDUA 3D5QA 1GA1A 2ZSEA 1V1JA 3TMKA 1EA7A 2P6OA 1H5QA 5ED4A 2W6NA 2I67A 1I5RA 4DSUA 2ZRNA 3ESYA 2DBZA 1TNDA 1LK5A 4FIDA 1YOVA 2YXBA 4CCYB 4P84A 3L0PA 2JEOA 1AB5A 1NDHA 5C3MA 4RKQA 1NQAO 3VO8A 4PLTA 4TYPA 1C80A 4PXSA 3JVIA 1P4RA 2QSYA 3BMCB 4HC4A 1DC4A 3K09C 421PA 4GEGA 3CZAA 1D7OA 1NR5A 4CKEB 4KXLA 2J1LA 4TRMA 2ZIVB 4ZT6A 1QH9A 3IAM1 2BY4A 2HKMA 1MNAA 3FKSD 3GRYA 3D81A 1FXSA 4UDXX 4O4IB 3DUFB 1WPXA 2XOKD 2RCYA 3UMVA 3GK3A 2V3WA 4LHSA 1F2DA 2NPIA 2PKRA 4M87A 3ER6A 3T0IA 5EP4A 3R0XA 4PGAA 2VYQA 3HZZA 4WBXC 2EC5A 5UKDA 3VDMA 3W2FA 4LQ4A 1SQ6A 2ODPA 2QTMA 3EMDA 4YR9A 1XKQA 4AKEA 4CLRB 3ELBA 5B4TA 1SXIA 2DERA 3BXZA 2B7CA 4NU8X 1TMKA 2DBYA 4UHFA 1DG1G 1WUKS 3W2HA 3EPJA 3ZHVA 1GQQA 5E1DA 3FAKA 4QPJC 2EX4A 3UB4A 5EINA 3ULKA 3PD0A 5C31A 4BMNA 2F4NA 5C7OO 1M72A 1XKLA 1E1YA 3AU9A 4YJ2A 3KWLA 3N8NA 4EPVA 4DM3A 3D4BA 1ZVKA 1KQOA 1VBFA 4N54A 2Q0SA 2GYYA 1P0MA 1VM6A 3PQ8A 2X0IA 2C61A 1Y3CE 1O5IA 2CL5A 4KXYA 5LIPA 4FLMA 1GKYA 4M86A 2OLKA 3E9CA 3EOBI 2OCYC 4AUEA 1WVMA 3F7NA 1G1MA 1X6VA 1FLNA 3P32A 1QLWA 3H4TA 5B1HA 4H6PA 4ZODA 1XYYA 2JLUA 2I1WA 2I66A 1IJKA 5KBYA 4B0OA 2MIIA 1V5EA 2D62A 2YXNA 3O38A 1T1EA 2Z83A 1U3GA 4JJ6A 1IUOA 4FI3F 4JSRA 5KPDA 1Y5RA 1YZKA 4XJVA 1U0LA 2O2JA 4UMFA 4GKAA 1U7XA 1K2WA 3HGMA 2Y2UA 4QXRA 1T36B 1L6RA 5KYNA 3V2HA 1RC1A 1C1XB 1UKEA 3JPXA 2IP2A 1MBZA 3L04A 1Z75A 1H2EA 3EIUA 3L0SA 2JEZA 4FHGA 4XI9A 5FL7D 4JLDA 2N0SA 4X24A 1G38A 2OE2A 4BCCA 3RU9A 2C4KA 2YNOA 3GDGA 4JHPC 4BJ1A 3UVOA 4JVMA 1R6BX 3IT3A 1L1EA 5DI3A 3AEZA 3NATA 4QFBA 1ZK0A 3NFRA 1ZSYA 1Y9JA 3NDPA 4ZOXA 1PS9A 4ZCRA 5CIYA 2AE2A 3GRPA 1G5PA 1G0NA 1YCDA 4YROA 5DW3A 1BA2A 1GA6A 2ZRCA 5I7UA 4OLHA 3A6DA 2H2DA 1QGAA 1SIUA 4AZSA 3WI7A 1CFJA 1VOTA 2V97A 4BEBA 5DF1A 2A9RA 4FEGA 4MV5A 5AM5A 1T4GA 4JSYA 3RFHA 3LV8A 3ZJVA 4FMPA 1QCCA 3SZUA 3BGDA 4OHYA 2XCIA 3ZVRA 3U4QA 3R5XA 2VK1A 2UVPB 4D2IA 1WD7A 3QUQA 2IL1A 2PA3A 3Q0EA 1B42A 1DRJA 4E2XA 4QNNA 5KYXA 2HN9A 4ER5A 2JVJA 2GK7A 4BJ6A 2LCQA 3CNEA 2G09A 3NHSA 2I4RA 3IV9A 3O8BA 4CM3A 4RSRA 3GLKA 2JHFA 1AQIA 4J73A 2BGWA 1Z68A 3DULA 5LFAA 2XJ4A 3L8ZA 3ZD7A 2ZQZA 1Q1BA 1KO4A 1OPXA 4F56A 3VYWA 3S2EA 3HN6A 2Y99A 1XWWA 3TNFA 3IEVA 3F90A 1CUDA 3I7HA 4B76A 3TQCA 4QYIB 4KE7A 3I64A 4B6FA 2DHRA 1UDRA 4OK3A 5KX5F 2OCDA 1F38A 3KKMA 1N0VC 3PFGA 4OUDA 1B6TA 2AGWA 3A11A 2XSZD 1CUVA 3MUEA 4BXOB 2A30A 2OCPA 5DRYA 5H3CA 3HY3A 5JTTA 4DS3A 1TJNA 1LRKA 1PIWA 1JUDA 3H1PA 4I1IA 3CFSB 1T8WA 4FMDF 3INYA 1TOAA 5DNUA 2QVXX 3I73A 1NJSA 4D6PA 1TPYA 4CZXA 4Z6KA 3MOSA 1DEKA 3DDZX 1O94D 3S5UA 4X3EA 3PRKE 1FVHA 4QASA 1AUOA 3LVFO 3ITDA 3N2NA 3MWDB 5FTJA 2XQVA 2ACWA 3A26A 2WFAA 4K6FA 4QELA 2W2TA 1X7DA 1D6MA 2VAPA 5CU7A 4JZYA 2BUCA 4YRRA 3H4IA 4CY3A 1GT91 1BDBA 1D2MA 2QZPA 4NAHA 4OQLA 1M7BA 2GXUA 3BH7A 4FHLA 2EEPA 1A8QA 3DDSA 3LUAA 4MJLA 4E51A 3GLHB 1FDTA 1U4OA 4WY5A 4KNWA 1JWLA 1S8NA 2YWDA 4LYFA 1RHJA 4YJGB 1F8XA 3TEFA 4UCFA 3FNIA 3Q8LA 1T2AA 1FSFA 2DG2A 4E03A 3LCMA 1CF4A 4UE2A 5AVQA 4LJ5A 2ECOA 3LM8A 1W9HA 3ZJUA 2BFPA 4TXNA 4UC0A 1DZ3A 1G3MA 4L9OA 1BN6A 4BY9E 5IYZA 3EXEB 3MGBA 2VUIB 1F0YA 1DC6A 2DUUA 2GEVA 3FBTA 4BQOA 4UJ3A 2HNAA 4Q24A 3MPOA 2QTZA 4A9AA 4FONA 4UASA 2GKSA 1PQPA 2XYRA 4YCNA 3GRUA 4BB5A 5KNCH 2AD1A 1VLZA 2JLRA 1RPJA 3NHJA 5F3RA 2AN3A 5T6BA 5D1NA 4HNQA 4UM9D 4J3NA 3CE9A 1WXHA 3AY0A 4GAEA 4IDCA 2PRJA 2YY5A 2QVCA 3RVMA 2ZZKA 4C0JA 5FFNA 4UMDA 2W22A 4JYAB 4IQGA 1IK6A 1NP6A 4GPD1 5FUXA 5EWJA 4PSUA 1QV9A 4QXPA 4HFMA 3TBKA 3OTHA 3EG6A 5MN4A 1JR3D 4KTVE 5TVKA 2PT5A 5C5EA 2C5GA 3OBBA 5JQGA 5LSAA 1IZ7A 1A2KC 4JU9A 4CN8A 3F3GA 2O4CA 1UMBA 4M1SA 2Q5IA 1SCDA 2ETXA 1ORRA 4M1QA 1AUXA 4AKTA 2R6DA 4EB3A 4KHPB 3X1XA 1EMDA 1ACJA 2W2XA 1SQJA 4XE5A 1F14A 2X0NA 3L7OA 3V4VA 1EM8A 4D9MA 2QL9A 1ZZGA 4ZV4A 1ONOA 2QG9A 4P81A 4MR9B 1NF9A 4R9RA 1FDVA 4D8WA 4IAOA 1D1TA 3HXOA 4GC9A 1TLTA 4BGEA 3GJ4A 2MYUA 3CYFA 1UADA 1BE8A 4V2UA 4RZUA 1ZJYA 4BTEA 5FUMA 3HWWA 3TPCA 4TYMA 4OXYA 1CJVC 4Z9XA 3HM2A 2BDTA 1Q7EA 1EX9A 4P58A 3OHPA 3IXMA 4IGAA 5L3QA 1OFGA 2P6NA 4DB4A 1L9XA 3SOPA 1XZJA 4TS9A 3P45A 5HG0A 1YVPA 3NBYC 4G2NA 1L7AA 1PUJA 1CIVA 1SZPA 1UODA 4BBAA 5FTNA 4Z3OA 2BR4A 2VVTA 5ENZA 3RRNA 2HXSA 3CRRA 4DV6B 5HGJA 2XCTB 3MTBA 1PEKE 2IP1A 5K8TA 2B30A 2QF7A 1JHZA 4QPCA 1OXXK 2PZGA 1D2AA 4TL8A 4MICA 2J3LA 3HCRA 2QN7A 3GLGE 1BS2A 1OWNA 3E9YA 5DXAA 1V3VA 3OD1A 2GZHA 3EZ6A 1L5OA 3ANMA 3DC7A 3ZX4A 5EJ9A 4JLVA 1S8FA 2H0RA 5MFPA 3B5JA 4BTLA 2G77B 2XADA 3V8BA 2JGJA 2P3LA 4L07A 4LQLA 1M0SA 3ABRB 3KJNA 4LNUA 5F12A 3QIAA 4KGVA 5DTIA 4ZN4A 4UNRA 1V7QA 4Y2VA 2XV1A 1R37A 1AUQA 4P54A 3EH1A 4HZGA 3PQ2A 1QVRA 4BZWA 1JU3A 1E3DA 4WX2B 2FY8A 1M2NA 3EZXA 2ON6A 4KXWA 3UVKA 1RTKA 2FFAA 1D6JA 3H75A 1CD5A 4ABYA 5HQTA 4DV3B 1F2UA 4D0NA 1JEQB 1KHTA 3DT6A 3I5MA 2AYXA 3H6GA 3DCJA 2GAIA 1N2ZA 1L5WA 2XZLA 4H1VA 3T7SA 3TFWA 4XIJA 3R0JA 5J2TA 5AYVA 4V03A 4O4LA 3OPXA 2GJ9A 5TEEA 4UE3S 4B73A 3HDJA 2V5UA 2FWPA 3TSYA 3COZA 2X13A 4D9KA 5G3ZA 2HEGA 3OKCA 1Z7YA 3LZ6A 3T3HA 2AJTA 3WL3A 2XTMA 4HWGA 1EFTA 4BNMA 4W8OA 3UHFA 4B3BA 5BWLA 1YT5A 5B3KA 2OFPA 4HGRA 5KYTA 3QLUC 4M37A 4US0R 3EFBA 4Z53A 5HZMA 4GUAA 2VJQA 1B15A 4GGOA 1R5JA 3M5PA 1NZJA 5H5JA 3BXFA 1CUFA 1FYDA 3ZTYA 3WLMA 4IIEA 1R6TA 1FXUA 2I1LA 4XYGA 5CA1F 2VYVD 2IIBA 1HTBA 3BXGA 4FZRA 5LP6F 2VDPA 2JW5A 5AKKA 1JDJA 2TMGA 4PLWA 3AHCA 3KC2A 4JODA 4EF6A 5J1SB 4TT8A 3UMGA 4RSGA 3T7TA 2R97A 5KNBA 2HT1A 2J33A 2PX5A 3O95A 4ON9A 3DKPA 4NNOA 5IDQA 1JHAA 3C6MA 3RHTA 3F3SA 4J16C 1Y7HA 3KO8A 3NHBA 1EUYA 2B6NA 1U5CA 1YMUA 2CKMA 2P0EA 2QZ9A 5CLIA 1QRAA 3G9ZA 1U2GA 5CH8A 1XWFA 5K3SA 2B9EA 4OQXA 5J4LA 1V4VA 3IO3A 3CMMA 3OM9A 4UD6A 3LY8A 3DLBA 1PR3A 4NPHA 1E9EA 1RMTA 3L1HA 1WW3A 4LUCA 3GCZA 3FYTA 3CIOA 4MDFA 3KT6A 3CO5A 3I2GA 2X77A 1L5GB 2VJPA 4PSAA 4J0GA 3SYLA 2DPGA 4MO2A 2EFGA 4JLBA 1CUAA 1WRBA 2IYLD 5IH3A 3ZGLA 4BC0A 1PUIA 1LU9A 2YCLA 2IVFA 1FTYA 2YR0A 4KO2S 1TF7A 1VYUA 1L7RA 3CRQA 1ZHOA 3AEKB 1TUEA 1WXDA 3ZI7A 3QFSA 3U80A 2A14A 1UZNA 4DCUA 4DBLC 3AU8A 2H2AA 3DOFA 3QTLA 2BV3A 3LBNA 5EYPB 3LXUX 3UW3A 1DIBA 4GL2A 4MCJA 1II9A 5I9NA 5SYAA 5T3YA 2EX0A 4BMOB 3VU9B 1DAMA 3AVUA 3I6QA 2GARA 5K8JB 1DRKA 2V1UA 2G8LA 5CP8A 3HEBA 3VR5D 5LM3A 3NOQA 2HOQA 4KLRA 2YXLA 1Z7BA 2GPTA 4CKBA 3DMGA 5KTPA 2FSUA 1XIVA 4TXMA 1ZMBA 3UJCA 2ZE7A 3U0VA 2EJVA 3AJ9A 4XYBA 4D57A 4ZOAA 2E48A 1XEWY 4D4JA 3DZ8A 2RGBA 2FYTA 3TR5A 3TIVA 4KG7A 3VR4A 1CUIA 4MULA 4AJPA 1E0SA 2OXEA 2J0UB 1KBOA 1QRTA 1MCZA 4I46A 3U3JA 1K63A 2XYIA 1N7IA 1JDBC 2FEKA 2BLLA 2QJRA 3FCXA 4ZEWA 1SNYA 3IMEA 4NYJQ 4KUEA 1SOUA 3QNUA 1I4WA 2P5TB 1G3QA 3F9IA 5KOJB 2AGYA 4WL0A 1NU6A 3KLOA 4EZIA 3BILA 3MMYA 1BROA 1NUPA 3RBVA 4IQ4A 3QWIA 1KEEA 3CZPA 2Z5LA 3IT2A 3ZDDA 4UD2A 3EI4B 2OQVA 3IBSA 2FSFA 4EY8A 4CKXA 4MQMA 4E12A 4HGQA 1X9GA 3IPXA 2JLYA 1WCYA 2IV2X 4MEAA 3RLFA 4C89A 1XU4A 2IS1A 4BRUA 1TF5A 2X9LA 1BKYA 4E33A 3ESZA 5M5UA 3EDOA 2N47A 1E98A 3IV6A 5KSWB 2OWDA 5CITA 3FZNA 2XUJA 2Q5LA 1JXAA 5AW8A 1ZD3A 1KS2A 1UFRA 1R9GA 3WNBA 1JJ7A 1I9GA 3GFCA 3WZMA 4U2DA 1UFOA 1SK8A 1H05A 4LF8B 2O5RA 3AHIA 4B3MB 4J29A 3NWOA 3G5UA 4P4NA 3D54D 2PHZA 4D3SA 2AE1A 5LQSA 4CGZA 1BMFA 2C78A 2H65A 3FPAA 3CVXA 4HHEA 4DT1A 2DPLA 1EU1A 4PQEA 3HACA 1OFUA 4C5AA 1DEOA 5TQVA 3LC0A 1WDLA 4DDTA 2GVNA 4DNWA 2XNDD 4IJQA 3F4LA 3FDIA 1GGMA 2I65A 1Z6AA 2I3SA 3INRA 3MTIA 4JOCA 2P69A 4KK3A 3E0XA 3K2QA 3IR7A 4YRAA 4BV3A 2YDYA 1N2HA 1QHHB 3SBOA 5EKUA 1TJ3A 3D3NA 3GRZA 3MGAA 2O2IA 5AJXA 4JJ7A 2R79A 3OIWA 4RD1A 5ARCA 5JO0A 2WHEA 2WINI 3M1YA 2DMRA 2OHVA 3GLIB 4RVDA 4TZ4A 1AO3A 2ZB2A 3PHCA 1I80A 2HV8A 2HM7A 5PNTA 2PM8A 4FYPA 3QGMA 5GIPE 4GM4A 2XGSA 4TLEA 1NMEA 3PXUA 2PVPA 1IDOA 3HB7A 5DYYA 4X84A 4OQYA 3NIDA 4NABA 4G0VA 1FUKA 3I7LA 4BQSA 2G4LA 3RV3A 2FDRA 4G9GA 2W4QA 3FTCA 4D8UA 4IG4A 5HJEA 3PR3A 4CYMA 4Q1CA 1NR1A 3JPYA 1PKXA 3EUFA 1GILA 3E5RA 1ID1A 2HXGA 4XM2A 1BGVA 3MB5A 3JWGA 4ER3A 2AGLA 2KMLA 5FWNA 2BEVB 4G65A 1Q92A 2PYZA 4B9AA 2OZVA 4H17A 1NBIA 2ZR8A 4BNIA 1A9YA 3K5HA 1YZQA 5K2OA 3RANA 4U7AA 1CE8A 4LJ8A 4ETWA 1OF1A 4GHWA 3ZS9A 4PN7A 3UT5B 2Q6KA 1QGED 1U2QA 3DHNA 3R7NA 2FRVA 5BVGA 3PC2A 4OJMX 4ZZ0A 4PHHA 2VRCA 4FN4A 1NPYA 3H5WA 3M70A 3AOGA 2XZDA 1RNLA 3IUBA 3QHAA 1UZUA 3O4RA 4JSNC 5A4AA 4ER7A 3KIPA 4RACA 5GAJA 5AVVA 4PC2A 4J1TC 2HYEA 3LY7A 4PO1A 4BP9A 1UQUA 4PX2A 1PAUA 1LDNA 4QTTB 1T4BA 3OKFA 1Y42X 4L5CA 4E14A 1XMJA 5K3AA 4BU0A 2P9QA 4B34A 1BDIA 3NC1C 4YUVA 4NE2A 1NXXA 3G2IA 3SQNA 2QPAA 1Q3TA 3T5AA 1UFKA 2WTXA 1R8XA 3JQ6A 3I3SR 3ERCA 2HK7A 1CZNA 2P79A 2JHPA 2CHEA 2AOTB 2B4QA 3MVEA 2NTVA 1P9NA 2AMFA 5H17A 4L74A 1NQ5A 4PV7A 1JLLA 3VR2D 2HHAA 4L15A 3T0FA 1C9LA 5KTYA 3VI4B 4WK4B 3OEEA 3O26A 1AC5A 4MI3A 4IKOA 3IQWA 1T0PA 5A03A 3PPWA 4PRZA 2AX4A 4O1HA 4RTSA 5A2QA 4XQGA 1L5HB 3RFXA 2V9CA 3TUIC 4YRTA 3ADOA 1LLCA 4F4HA 1TTTA 2CBGA 1OI3A 2VWPA 4UBMA 1PJAA 1MUUA 2ZYGA 3LQKA 4M6WB 1K92A 3K9CA 5C32A 1Z6TA 3WGMA 5JXIA 4LG1A 3SJCA 4MCHA 1KY5A 3GELA 4W9NC 3GAZA 2NSLA 4HQ0A 2BRUC 3EVCA 5EUQB 4AZ0A 5CA0A 4H7FA 4DMHA 1XFAA 4NH0A 2V7UA 4D6YA 1U5AA 1ETUA 5CLGA 2JFZA 5HM8A 1QONA 4FA1D 2IUQA 2ERXA 3VR3A 4ERNA 1NQUA 3R3YA 2C54A 1H4QA 1DARA 3E7FA 3Q3EA 3ZQ4A 5D8DA 1HYHA 5DEOA 4H7JA 4QOEA 3OJWA 1U2PA 1DOHA 2PGJA 5H1MA 3H9BA 1WF6A 3SBPA 3P5SA 3A1FA 1ZMOA 1KFJB 2YHSA 1Y9AA 3LHSA 2DQZA 2Z6QA 5H3LA 4CUJA 2WFLB 4GOMD 3ADCA 4FOLA 1CUWA 4BV9A 1UOPA 3N6XA 4R81A 5FBZA 2QI9F 2ZTVA 3TQIA 1Y8CA 3I39X 1N92A 3BGIA 2Y4NA 3AUAA 4REOA 5A3SA 3PRYA 1DTWB 3MUFA 3NM5A 2G70A 1L6IA 5CT5A 1YONA 2IYZA 2NUTA 1SXHA 2E85A 3GVIA 2WC1A 1XQWA 2GTPA 5GGYA 1EWTA 1JXMA 5EIOA 2P6UA 4QBHA 1DE0A 3JYNA 4DRXB 3M33A 5K3DA 1RWWA 2H13A 5KTOA 2AG5A 2JIZA 4KLCA 1NVKA 2NYRA 3OQOA 3CPSA 2H31A 3UATA 3ZIUA 3DHWC 3OTWA 2D1QA 5C1BA 1A9TA 1P19A 1IWPB 2WA1A 3EGWA 5LNK6 4TL9A 2ZZMA 5JWHA 1H2FA 3GYBA 3I9NA 1SVMA 4MEJA 4QYXA 2YNNA 1DIRA 4DFDA 4BTVA 1MO3A 3UHPA 3ZDCA 2VNHA 3D31A 1AN0A 1U0BB 5AXBA 2P40A 3USZA 1V16A 5F9MA 5GP1A 1AMOA 3OLQA 2XTJA 3R74A 3C98A 3I5XA 3WYAA 3V1UA 1YUBA 4KZPA 5L3ZA 2RDMA 5BN5B 3JVUA 1P3JA 3KZXA 3V9FA 1YDFA 3F7OA 1O5TA 3KSMA 4Z9AA 3Q2OA 5CVUA 1LSJA 1BDHA 5LP1A 1DAFA 5JCJD 2PQ0A 3MCUA 3LC2O 3BORA 2JIDA 4CV1A 1D07A 1DRWA 5BRNA 1O87A 3ZIDA 2CJXA 5DGIA 2O2HA 1OHHD 3RABA 5CVDA 1VPDA 1FU4A 3JQ7B 4CG3A 1W1IA 4OHMA 3G8YA 3KYCB 4YRDA 1GT6A 3RKUA 1XTUA 5CFNA 4C6SA 3QMWA 4PNPA 4MUKA 1EYZA 3E7DA 3GGCA 4O2LA 4C5CA 4MAAA 1EHYA 1YRQA 3MJTA 1PS8A 1US8A 3W4JA 4C3OB 1XTRA 4N76A 3KDSE 1XC7A 3L7AA 3RSCA 1ZCBA 4V0KA 1IH8A 3HKBA 2Z4RA 1F48A 1OX4B 1YB4A 4NOJA 3QU4A 3A7DA 4XJTA 1WZCA 3GJ6A 2R1VA 5DBIA 5E4TA 1T4CA 2DQYA 5BN4A 1UT5A 2DHCA 2JBHA 5B6JA 1U8CB 3LPMA 2JFXA 4Z1MD 3ZY3A 4BX8A 1SULA 2PKWA 4RZXA 3PT5A 1W36B 4CBVA 1ZN9A 3ILSA 1XCPA 1URPA 2ZIEA 2CNWD 5A3VA 3UJDA 1M8GA 3V1KA 4ASUA 4EGQA 3CBGA 5HNKA 4FGJA 2ECQA 2NUAA 2V45A 1VIDA 1JQLB 3WTCA 3FI9A 5BNWA 4L2IB 4GD3Q 3WGYA 3K15A 5IDYA 3W4KA 3WWYA 5E6UA 1BEUB 1TQDA 4WFQA 2VJNA 2GA8A 4OPMA 3UAYA 1YSCA 4CR7A 2H4HA 4OLAA 2Y6UA 1W59A 4PQGA 3FWYA 3SX0A 5KTNA 2I3ZA 3CF4A 1ZW6A 1W85A 3ZE8A 2JIBA 1II0A 5BQ3A 2Z2OA 3BL5A 2EKPA 2HJ9A 3WE7A 4EHNA 1PGOA 3IDAA 1PDVA 2HMTA 1DAOA 4EW3A 1KEPA 1YOVB 2J9FB 4AG6A 1BD4A 1FNNA 4M8IA 5GZ3A 3ROZA 2RFLA 4LGYA 1K97A 5KMGA 2VQ6A 3HUUA 2O3UA 3FRHA 1P8AA 2XE6A 4TTSA 4ZOLA 4ANFA 6ADHA 5CYPA 1A1VA 2ZYHA 4C4ZA 3FUCA 2ZGVA 4CQLA 1T3SA 1NG1A 3BSSA 1C7QA 1ZA1A 4MLCA 1CPYA 1RRCA 4W5HA 4D4LA 3RO7A 1XOIA 1GQRA 4MUFA 2X4LA 4HGOA 2RI0A 4O8ZA 4ZK6A 1SVWA 3TUJC 3CH4B 4HPWA 4FM9A 4XIFA 3N75A 2PWAA 5A9RA 1BH2A 3SSNA 2FMFA 2HUPA 4M36A 1XTJA 1NJ1A 4FGUA 4Q47A 3ZGVA 1IHUA 1M2HA 1RFGE 4HDRA 3COSA 2H0AA 3EZNA 1Y8AA 2IHVA 3GFGA 2Q2QA 3GRKA 1U02A 4QAJA 3FHOA 1QR6A 4JB8A 1HZZA 4PXAA 1WKBA 4U8GA 3DXYA 1XVAA 1SM4A 4W7SA 1JNXX 2VSNA 2CNOA 3D3EA 3EC2A 4BQFA 1YBMA 1EVKA 5AI9A 4ALIA 3K9LA 1S4UX 3IJ1A 1Z8NA 4B7AA 1Y3AA 1SUPA 3BH6A 3BFVA 1NSYA 5JDCA 3C5EA 5IEBA 3EVZA 4Q15A 3DZIA 1E3WB 1OXUA 1PQ4A 1JTDB 2R6R1 4G4SP 2E87A 4NNJA 2Q4RA 3CFYA 4A08A 1OB5A 4R2LA 2V6IA 1D9ZA 1QE5A 4RXTA 5JYDA 2ZXUA 1HT3A 4ARSA 3HDGA 4PAQA 1WU8A 5CFMA 4CM9A 3L4KA 3AEYA 4U8HA 1GAQA 4HR7A 1ULZA 5AVSA 1BIFA 2D0DA 3D3QA 2WJIA 1P72A 4M1WA 3OSZA 3OX4A 1JW9B 1N6OA 3EC1A 4HDMA 2GD2A 3R0VA 2G72A 2VDQA 5CVVA 3FYUC 3VNUA 1CJMA 4BVAA 4J4BA 2HIAA 1FTSA 1DUVG 1OV4A 2GB4A 4Y9TA 5B5SA 4YO8A 3SEFA 4QDOA 4M9ZA 1JIIA 2I8AA 4UMEA 3VYUB 1EVEA 4KP7A 2P30A 4EW1A 4BE9A 4B1FA 3U61B 3DAHA 2MU1A 2UXBB 2D8MA 2WJGA 1J22A 2EU8A 2IOYA 4M53A 2VK4A 3B7WA 3NZEA 4ALMA 1JA0A 1MT0A 5HP4A 2AQKA 3W6UA 2HMVA 1CUEA 4NBNA 4WBNF 2AFHA 3DBRA 4JEHA 4MS3A 3VC3A 1JEDA 4D3ZA 1HI9A 5AM0A 1D1SA 1OLOA 3PF9A 5CJJA 3UAVA 1EQUA 3NJ8A 3W5JA 1Y1QA 2EAUA 5FTMA 3AHGA 1DJMA 2EZ9A 1Z0ZA 3V8NA 4OD0A 2VXOA 4N47A 4N5LA 4MR7A 4YIHA 3DWFA 3EAGA 3DFZA 3DUWA 5AFSA 3BWMA 3UXMA 2I33A 1T6NA 3ZX5A 5KYGA 3U4QB 3C8ZA 3GY0A 3EW9A 1NI3A 1RAEA 3RV4A 4L16A 1AKTA 1RE1A 4R1QA 4HNGA 3B7FA 2GM5A 3P19A 1CTQA 4BECA 1B41A 3HXLA 5CB6A 4U5XA 1N1MA 1QX4A 1E9CA 2PTHA 2GPBA 3VBEA 2VBCA 3K2EA 4O2WA 4TZ6A 3STHA 1II8A 2HTFA 3F0TA 2NACA 4DNUA 4JLPA 2JIMA 1DCTA 3KUXA 3CZ5A 4TRJA 3NASA 4NHEA 1XQ9A 3J80g 4G97A 4DXHA 4MQ6A 4EARA 3TLJA 4H15A 4EB6A 3DWGA 2VJYA 3OURA 3DE5X 5HE0B 4PBTA 3TLAA 1N0IA 1U2DA 4DPMA 1OFIA 2XYVA 5C35A 2C2GA 1Q16A 3NHLA 1QORA 2NZXA 4V0OA 2FPIA 5H8WA 3KV3O 3VH3A 1Z5OA 2BFDA 5A4MS 5I4KA 3H0KA 1DMSA 4ZZIA 1EJ0A 5CVTA 2RHBA 3K73O 2P1ZA 3M2TA 1C3JA 1QRRA 2XGOA 3JQFA 1KZHA 4AJKA 1NVVR 2Z56A 1P4HA 1MO4A 3M0EA 1MVOA 4DILA 1F3OA 3I8CA 1U63A 5C1PA 2PU7A 2WNHA 3KJQA 2J6IA 1E3SA 2QJTA 5DYTA 1NJ8A 2VPWA 4PAWA 1ADGA 2ZUSA 1I01A 2FQXA 4BE7B 3FNRA 5LYJF 1QFJA 3WL7A 3MZKA 1JDNA 2Q50A 5K01A 5B36A 3EGCA 2RHDA 3VU1A 3GVXA 1PU2A 3I30X 4R3WA 2D1FA 2OGSA 4MGIR 4UBKA 1KAMA 2UU9B 4XVUA 2GSWA 3OLXA 4D44A 4O25A 8ATCA 4E2YA 1PJTA 2Z3VA 1FFEA 4DLZA 1YR1A 4L0MA 3GLGB 3T4EA 3RRMC 2OGTA 1JEYA 4X91A 5BSMA 3P2MA 3ANSA 5GADl 4B4KA 4B7UA 1IC6A 4Y3UA 3ZE0A 1K7FB 3ZU5A 4TTPA 1A9QA 1TIPA 4GM9A 5EARA 3LBHA 3A70A 1K86A 4A10A 1X80A 1BJTA 2WV7A 3K9HA 2XW6A 2H07A 3KKNA 3K1TA 5TPZD 4ZK2A 1WOMA 2O48X 4NICA 5GJVC 4CL0A 4ZICA 5FOUA 2VG8A 3CLTC 1C3LA 3R5FA 3IJRA 2RJNA 3HVKA 3DVQX 1PLJA 3PCRB 2BHRA 2OVBA 2G0TA 2Q5CA 5I7HA 2ZB4A 3CCFA 1GPKA 3EQ8A 3PHGA 3TDNA 2QL5A 4K6HA 4PYOA 2P9NC 4CY5A 1WXIA 3CX8A 3FGBA 1KEWA 4REMA 5CUQA 3DWIA 1ZI9A 5FYQA 3I76A 1M10A 1P5ZB 2CFRA 1K7XB 1VYTA 4LW8A 4TT3D 1AK1A 3H7AA 3IAS6 2RG7A 4PGHA 2ATEA 2PSEA 3CNQS 2VAXA 4FSDA 4JNCA 4X60B 1PT5A 3I2JA 1SZDA 1XEAA 1UKYA 3N9IA 2F3TA 3HN2A 4QFMA 3FMVA 3W7BA 2A84A 1AHHA 2CE7A 2NP6A 2QUKA 3P96A 3NVAA 1EZZA 2KPOA 1PJRA 5IC7A 4MIYA 5JQGB 1G2IA 1SBNE 3X1YA 5AJVB 1UMBB 2ADMA 1T1IA 4Z3DA 4LHZA 4ZYYA 2OKGA 2ZCUA 2C4MA 2B3DA 1ENOA 1IM5A 4M46A 2JI6A 4CFZA 2VDUE 5C2VB 2WUEA 3N0DA 1ILWA 3MJVA 1BKSB 2P9FA 2KYRA 4B3HA 2RGNA 2CVFA 4CDRA 4QYTA 2MR6A 4RK0A 5TMEA 4RNCA 4BNTA 3KL2A 4XSGA 5FPHA 4ROSA 4YBZA 4MVJG 2OHJA 1SOAA 4DLUA 1PQUA 4C4OA 3L82B 2H6KA 3R44A 2A33A 1AKYA 4EKNB 3AWDA 2W2OA 4GPIB 3IDFA 4MW9A 4BZPA 2AA3A 2J59A 1RWVA 2QUZA 4FP9A 2WM9B 5C8YF 1G17A 1ZW1A 1JEEA 4RVOA 1NN5A 2ZROA 1NVWQ 1FP4B 4UQLA 4IIGA 2WZCA 2VZ9A 3STVA 4Q1EA 4JEMA 4GVXA 1WDMA 4YDRA 4FUQA 3CINA 5E7IA 1DKRA 1G5HA 2JGFA 2BM0A 3GLQA 4GI1A 1H3EA 3K0EA 3GAMA 4LPSA 1RU3A 3ZU2A 3LP6A 3BWVA 2W90A 5JSHA 1GTJ1 1MC8A 1SCQA 3PEWA 3N87A 3IAUA 4PRKA 5IT9g 5FWYA 2GHTA 3F9CA 3DOCA 1ISSA 4OHUA 1PL6A 4BVHA 3E61A 4LNUB 4KQGA 3BB4A 3JQPA 1TYBE 5FOSA 4E5KA 3UWMA 4WK0B 2X2EA 4Q1FA 1FNBA 3C7CB 4WKOA 2LNDA 3QEOA 1YL6A 4D56A 4GQAA 1E94E 3RMZD 1MEOA 3TCNA 4LFCB 3EMKA 4L0DA 1J8YF 3LDFA 4BQQA 1FSSA 1T1SA 2FEPA 4RVSA 4XDGA 3R3JA 1TPZA 4R8LA 4JSVC 1V9CA 1KRHA 5FBVB 2FMKA 3IOMA 1QGUB 5JH7F 5LOVA 5HCNA 4DV1B 3EPRA 2EIEA 3NP7A 3ZW7A 4PVCA 5JWRA 3EODA 1UC4B 4AMVA 2QJWA 2BHTA 4O4HF 5EPEA 3ZK8A 4EG6A 1Y4ZA 5J2TB 1TM2A 4O4LB 3K30A 2VT3A 4FK8A 2PR7A 1D4AA 3CBQA 4E5PA 2WWYA 1NPDA 5KC9A 2CFOA 5E4FA 2Q5QA 3RK0A 3AR7A 4RFVA 4R0MA 4MK0B 4ZVSA 2NT4A 4BVEA 2FK7A 1QNIA 3ZLTA 2MDTA 3ANNA 3I9V1 3HNRA 3F4BA 3PDCA 1WP9A 3GN1A 1F20A 4EZEA 4OJQA 1FUEA 1HH4A 1D0IA 2YOFA 1XCGB 2ZRFA 3JQAA 4KBYA 4CI8A 3C3EA 2ZJ0A 1PL8A 5F35A 3KPWA 3CRNA 2XUHA 4URUR 1A8SA 3EWNA 1G8FA 3OKYA 3DP7A 5F2EA 1SWVA 1ECLA 3KLBA 3Q41A 2A1UB 1YQ9A 3S5JA 2RH5A 4R7GA 4MI6A 2VDPB 3TXYA 3BPSA 4EJSC 4DC9A 1WMBA 2J9GA 4MVWA 4U9IS 4IIVA 2IZ6A 5ADVA 3PX2A 4PHFA 5IUKC 3GT3A 4ZOBA 1C7ZA 4KQ6A 3KQNA 4MDYA 4MXDA 4X3CA 5JVDF 1ZGHA 1N5RA 5GXHA 3ILHA 4FBMA 4CL2A 1MAHA 4IWXA 3WNQA 2V0GA 1RYEA 2FDXA 2ARKA 4YHBA 2IHZA 3RS7A 1TAUA 1EVZA 1VCMA 4KNVA 2QP9X 4JOBA 1Q0RA 5E9WA 5JS7A 2XTZA 2UUBB 5HYNB 1YR9A 3S1LA 5JRZA 1ZOOA 2X3YA 3EQZA 4X3PA 2HLNA 4DKXA 3DQQA 4G5HA 3WZLA 2OO3A 2QW0X 4PBZA 4B3XA 3OJFA 3JYQA 1GIAA 3CLTD 7ADHA 3RU7A 1FLDA 3IEIA 4GM8A 2B82A 3ZDRA 1X1AA 5SICE 4U2EA 3BJZA 3W5HA 4TTRA 3GFBA 2B36A 2CUNA 1N2EA 2I9KA 2WMDA 3WL8A 4FFMA 4N8SA 4KMMA 4K9NA 3LT5A 3M4JA 4UOZA 1KOJA 3EBLA 4Q3LA 3KFVA 4N41A 4BVLA 4MUYA 3JWIA 5F7XA 2CE9A 2H8GA 2O9JA 1C4XA 1N6IA 4EFKA 1E99A 5JNTA 2QTNA 3B82A 1LDYA 4ZAYA 2WWFA 1IDN1 1WMSA 1QH0A 4RLHA 2QK4A 4JENA 1CJBA 2OT3B 5TSDA 3VR5H 2PH5A 5YASA 4I4TF 1VE5A 4MWSA 2J67A 3PNKA 4DXDA 5FUYA 4PLYA 4AI6A 4FX2A 4DR1B 3R09A 3RS2A 2JKYA 4RAOA 3BF8A 1M1NA 5JMOA 4I5EA 2DQKA 2QRUA 1O5OA 5TMBA 2IWKA 1YE5A 2KI5A 3M6WA 4O0LA 2VTDA 3QPCA 4TUYA 4IEFB 3F7MA 2AW5A 3OWHA 1VIAA 1VKJA 1FXWF 2PJUA 2PJDA 1P73A 2GXAA 2XVMA 1L4UA 5IF3A 5C4GB 4OL0A 3QEKA 4CXMA 3FLEA 3PDIB 5EAPA 3BZUA 2PSDA 4G41A 1RVV1 4DCJA 4N0EA 3RJMA 3ELWA 2NUBA 1COZA 1HY3A 1EDDA 2W2LD 3DZKA 1L1QA 1L5ZA 2R8PA 3DVSX 3VR6A 1GFSA 3K0AA 3H83A 4KRXA 4DARA 1SC1A 2VDRA 1X13A 4YT5A 3AVXA 2B5VA 4ZAXA 3KT3A 2YUIA 1PZMA 2AZDA 4OGKA 1DSSG 1GHTA 3P0IA 3JROA 3QVGA 2P7HA 3LUBA 4RCYA 4AEZA 2ZIAA 5HIAA 2PUVA 4HD8A 1E6KA 2DR3A 2ZVPX 4BAZA 2VHTA 1XHEA 1K89A 3GGDA 5CXUA 2D5IA 4EWLA 4WJKA 4K8OA 4K6KA 4RHCA 3THSA 4AYTA 2EJUA 2OK8A 3HFRA 4UXIA 2FWJA 4I2VA 4D43A 1SMKA 4LZPA 1YS7A 4OTZA 2BONA 5F1PA 3A25A 2NT3A 4MLDA 4XYMA 2GHIA 1T4MA 1O0BA 5SY9A 5IG2A 3WKEA 1D03A 1K5DA 2W9XA 2PSFA 1Y7TA 5IVPA 5TGZA 4I4CA 4DT1B 4ZVVA 1MB4A 3G68A 3BSYA 3X1DA 2QR2A 3UGTA 1KQFA 2G9AA 1TVKB 1N57A 3IJ0A 5EQDA 4UUOA 3KFLA 4UBIA 2ZYWX 2AH0A 3ZWLB 4U7FA 1WUJS 2E4ZA 4R0NA 2XUGA 2F3UA 3V97A 3LH5A 4OYYA 1T2FA 3TAHA 2BGRA 3GWZA 4FFNA 3RU2A 3PUYA 1VIYA 2XNCA 3KQHA 3R6DA 1R8SA 2ZSKA 2J3KA 2H2IA 2J3DA 1XZNA 4MLZA 1IHYA 2FPSA 3GLFA 2VHEA 2KWIA 3OSUA 5FO1A 1MW8X 3TEMA 1CUYA 1Z6XA 2VAMA 4GU5A 1TEZA 2NUPB 3NYQA 3LE8A 3EARA 3K8ZA 1VL1A 3NIDB 2CYCA 1V7PC 2QZZA 3A05A 4S0ZA 2G82A 1UXKA 5FCDA 3PNSA 3OFKA 1MF7A 2Z1MA 4PY2A 3THOA 1RRFA 3IJCA 4W5RA 1ZXLA 1LZLA 5G0WA 1VYHA 3QW2A 4M0MA 3ZNOA 3IFSA 1Z8DA 5CHEA 4AP6A 2PX8A 3MZ0A 3RFCA 3F9RA 3DLHA 2VLBA 1GGHA 5E4YA 2OESA 4ZMSA 3AFNA 1KGSA 2ZYVX 3DZBA 1FS6A 4HGYA 5CCXA 4JMPA 3OX1A 4I55A 2XNKA 4Q3OA 2RHLA 4PPFA 3RSGA 3F71A 1XPUA 2Z2XA 3CZ4A 4URZR 3QFHA 2WWHA 2WRZA 3L7CA 2AFIA 3QKIA 1U1CA 2A67A 1EJ2A 2J31A 3CURA 4ALJA 5AKYA 3CX6A 3A4NA 2X6RA 3QSYA 5I9TA 2O7RA 1W4RA 4WCDA 3PTZA 2FFQA 1K98A 3S2UA 1G5TA 5AJTA 6PFKA 1QJ4A 3PD7A 3N7AA 3I4CA 4DA6A 1U8AA 2OHIA 2ZM5A 2XOEA 4RLQA 3UMFA 1J39A 5AVWA 2C9YA 4XUCA 1SR8A 4K5QA 5JJBA 1F5SA 4X7BA 1T5DX 4Q7KA 4A2MA 3GZ4A 3S55A 4KSCA 4LDRA 1JPVA 3M4NA 3L2OB 1G66A 1ZC4A 4W5TA 5GTDA 3QELA 1ZAYA 3KJIA 2JVKA 3CW9A 2QL6A 1G6KA 4M0PA 3R7AA 3RROA 2ZATA 1SPXA 1IULA 2ID8A 2A5DA 2CZQA 5M2QA 1KP3A 4BMDA 1YIDA 2YMPA 4E1AA 2I4OA 4FDLA 3L4JA 3ZDXA 3UR4A 4GOJA 2E4WA 2EWVA 4DSAA 3B5EA 2XUZA 2CLSA 4NTZA 2BMEA 2EF0A 3FLBA 2YBEA 4ZVQA 1W4AA 2P2LA 2WIAA 1GUBA 4B6RA 2HXYA 1P61B 3UXHA 1MV8A 1HNWB 1E7SA 1GO2A 1Y7IA 2WYVA 2XYQA 3ND8A 1KARA 1DKMA 3WR5A 3GJYA 3O3NB 3B7PA 4UNIA 1HT1E 3B2EA 4H08A 4PIMA 2GPYA 5EMJA 3UOAB 1GPBA 3ZBQA 4QPNA 4HPJB 2IYXA 3A4LA 2IWHA 1JR6A 1Z45A 1ZD4A 3GG2A 1XQYA 3JZIA 2YMUA 1AZWA 5CA0B 4LYYA 3LOQA 3X2EA 4QDZA 4XCXA 4KCGA 4RU1A 1KEZA 1OWPA 2PNFA 1Z4OA 5K3CA 4A6XA 5D85A 4CL8A 4NENA 3S4YA 3GLFE 5IUNC 4C0HA 1TYAE 3QLJA 1E5DA 3ONWA 2O0MA 3UH1A 1P2VA 2I99A 1ZHFA 2AJCA 3RAGA 2CLFB 2FA9A 3H2IA 1GNRA 1UBMS 3CONA 2NP7A 3PYXA 4P6VF 4RS3A 4W5JA 4O8CA 3C6XA 4G1CA 4HEQA 3Q0IA 3GREA 5JMPA 5BORA 5DCLA 4F9EA 4U7GA 3TI9A 4TSFD 1L5MA 2RHJA 1TC1A 1CQIA 3OIDA 3RJTA 1JFFA 2IY8A 2VJMA 2WMYA 4E5DA 2G63A 5CEFA 2QZJA 2ATCA 3G0CA 4X20A 1FTNA 3ZGNA 3F98A 2ENUA 4J0IA 5U1PA 3WLLA 1DV2A 5CB4B 3H1FA 3TNYA 1J56A 5DX0A 6Q21A 1OI4A 2NUTB 2HWUA 1T2NA 3PRJA 1GG8A 1W1UA 3W77A 4H1WA 1T0UA 3DDNA 1N8SA 3UK0A 2X1HA 4NMLA 5IK2A 6REQB 1HYEA 4IW3B 3KXIA 2ANCA 3IVXA 4ZDKA 5JFGA 3Q6MA 4N9WA 2O7SA 1PZFA 1ARZA 2BYTA 1EFCA 1I24A 4FN5A 3ZD9A 1NG9A 5FNVB 4EUKA 2OD7A 2I2DA 5E9QA 1KVRA 1BHO1 4MIEA 2HRZA 2YJ4A 3S44A 5TPWB 3D3JA 1TYZA 2PZ8A 5EZQA 1E9RA 1KYZA 3I42A 1JHXA 4NQZA 3AP1A 4IJWA 3QHPA 1SHJA 2RHHA 2XWSA 2C1EA 1MOSA 2YIJA 2NQ2C 1RQ2A 4ECEA 1YB6A 4F86A 1JQ3A 2DUMA 4HJXA 2GRJA 1BYUA 1KS9A 4KQCA 2OHHA 3O2SB 2VQFB 1E1DA 2JKXA 5T64A 3QE9Y 2FSVC 1EGHA 2B0CA 5DHSA 3V2IA 4EMTA 4A0HA 2Z3ZA 3U4AA 1FX0A 2W6QA 4WXPA 2ESRA 1BAPA 3N8DA 2FE4A 3ETLA 3OEYA 2GCPA 4WEOA 1HTWA 1KFKB 4YECA 3BAZA 4G5XA 4Q7QA 2P2SA 1KEKA 3SI7A 4FCWA 2WEKA 1SY7A 1J5PA 1D9XA 3K9BA 3QWAA 4WUVA 2BEWA 4DCVA 4F1JA 1DHRA 1YBHA 4ZAZA 1PK9A 1WLYA 5DM70 4L8FA 4C08A 5CT8A 4WXMA 4ZI3A 1TIBA 2VTEA 2GFHA 2YFKA 4DCSA 1IBRA 4KN9S 4K9SA 4EHBA 4G07A 3HKBB 3A14A 1MU0A 3FYDA 2P67A 1I3LA 2SECE 3GR6A 3OP4A 2WU8A 3EE6A 2W58A 2I3AA 2TRSB 3JV7A 2R1VB 3A31A 1MW9X 4MWGA 1T4CB 3UEOA 1EG2A 2NO4A 5BN4B 3D59A 2IZ0A 1U1EA 5CPBA 4DLSA 1AS2A 2P8SA 3SYRA 3NAQA 1OIVA 2HA0A 1YR3A 5DPMA 2JA1A 3E70C 3ESXA 3L1VA 1A76A 1W8DA 1BVRA 3EUAA 2PPVA 1I2MA 4ZHQA 3QF4B 1OT3A 3PFNA 4U1RA 5CB0A 1KFCB 3FDFA 4MITA 3VVCA 4LYGA 1V5WA 2ZJOA 2E49A 4Z49A 4DJ5X 4WGGA 3IVRA 2RGEA 2YYYA 4OHKA 1IWBB 2Q2VA 3VGZA 3ML1A 4LN1A 4NCKA 4RZIA 5BMVF 4URXR 3RHSA 1SGWA 4KQ2A 1GPMA 3F6YA 5IW8A 5E6UB 3LK6A 1GYPA 4XWTA 4KEAA 1K5GA 3PYMA 4KDRA 2VDLA 1PGPA 2UZIR 3FB4A 1MQ8B 2H1VA 4NV1A 4GI5A 2ZYDA 2OUKA 3E81A 5ERYA 2QTRA 5C46F 1W85B 3TB6A 1Q2UA 2LR0A 3W78A 4XASA 3QX3A 1TD1A 4OU4A 2R87A 4EGJA 1JG2A 1FP7A 2VNJA 1N5JA 3O1JC 1E1RA 3WHKA 1PT6A 1TAHA 3ANLA 5KMGB 4U3JA 3K0SA 3VSBA 2DLCX 1LV7A 2FGKA 1J8DA 3HZHA 4I3FA 1JBQA 3L9WA 4CQLB 2C7QA 2PX3A 2UZAA 5TRTA 2WJ6A 1P3DA 3CC8A 3D6AA 4M7OA 3JTMA 4YJHA 1K4YA 1DOAA 4ME6A 1DUSA 3VA7A 2WJVA 5FORA 4BFCA 4K86A 1C14A 4GKVA 5FV7A 1R8YA 3IHTA 1EFKA 4MRMA 3HO1A 4DLAA 4AT1A 1LKZA 2L82A 2EBUA 3LTEA 4R83A 4B8ZA 5BWCA 4KMSA 1H9CA 3UC5A 3IP7A 2UUPA 3LHKA 4QTUB 4Q6WA 3UKJA 1L2TA 1E9FA 1CY4A 1ISIA 1FY2A 4BQNA 1MG0A 2R00A 3L0CA 5IU6A 1I51A 5JXGA 4LTDA 4NOMA 1I7DA 2R7MA 4MHTA 4HMQA 5FDFA 2NQTA 4YV2A 3ZXIA 2W2KA 4L51A 1XZKA 2FLKA 2VDJA 5C81A 1VLQA 2F67A 1Z4MA 3W3AD 3RQSA 1VYVA 1NUQA 4A08B 2ZBVA 5FPPA 1I94B 3UJ3X 1NC3A 3VA6A 3GDWA 2YY7A 4ID9A 1KEVA 1QE3A 4LEIA 1CUJA 4JROA 2ATVA 2BCJB 1X38A 3GMSA 1U5BA 3ZXSA 2O7QA 3IDSA 1JFLA 1DI0A 3H8JA 3N05A 4LOIA 5JFOA 3D8SA 2R5NA 1PEVA 3DKIA 3GBPA 4HDMB 4D7AA 4RGBA 1VPLA 2Y1FA 1EFAA 1EB9A 2VDQB 3Q3GE 2WJ4A 1G8MA 2CNBA 1XTZA 4WTOA 1WB6A 2EJBA 1JIKA 4ESGA 2DETA 5I5JA 1MG5A 4P3KA 1CCWA 1AF4A 4WK2B 4QWWA 4CZ2A 5EMKB 2ZI4A 5A62A 3O8CA 3BRWA 2ZI5A 1YCFA 2FTKE 3OLZA 5K7SA 4K05A 4Z8LA 2CSUA 5AW9A 1YU6A 5JAHA 1E7WA 2DULA 1HFKA 4N9QA 3RC3A 4JL8A 5JXHA 1M54A 5DULA 3T38A 2QMEA 3JW8A 1DZIA 2NO9A 1OFVA 3EXG2 3I12A 5AT1A 2KS6A 2R5WA 3BIWA 4PX5A 5KREA 4MR7B 3ILXA 3C97A 4V3BA 3BTVA 5AVOA 5B4UA 2QTWB 2YASA 1MKYA 2V8OA 4TTIA 2LKCA 3T99A 3NTOA 3PNVA 2Q45A 3B8EA 4F1KA 3LCJA 3TN7A 4OQZA 4A73A 3A4YA 1SHZA 3IB3A 3HO8A 1UT6A 2JNWA 4X64B 1KQNA 3HG7A 5FOTA 5H9WA 5HZGA 4JH0A 1B0AA 3ANTA 1J0AA 1W48A 1PKEA 2J5BA 3UJAA 5DHTA 4B31A 4F60A 1DC3A 4OBWA 1KIMA 2IYTA 1UWKA 5KVAA 1UJ6A 3PSCB 4G5OA 4FE7A 2C3UA 2YW2A 3KSUA 5B1YA 4RY9A 2QR5A 3DZGA 5CT6A 4IVPA 3M2PA 3DEJA 3TL2A 3IAXA 1PGUA 1QIIA 3ZE6A 1IUKA 4EB6B 1KI6A 2HGZA 4JQZA 4OQNA 3AV0B 2GUGA 1T5LA 3I6YA 1YDGA 4ESVA 1T3LA 4MPPA 2XT9A 4F5YA 3JQDA 4C4TA 3LY9A 4Y0NA 2RIPA 3W34A 3UJ6A 3I7OA 2DR0A 2WSLA 3HKCA 5CDSA 3HGQA 1BO6A 4IG9A 4QGHA 2FPIB 3OZCA 3TVTA 2HIMA 3NHRA 4H4DA 2BFDB 2ZBQA 1HDYA 3GU3A 3GW8A 3VH2A 2BJVA 3HJGA 4XSHA 3DL4A 3P0FA 3K1ZA 4I5IA 3H5AA 1JV2A 4RPKA 5AOAA 3I4FA 3QXJA 1S2GA 1QFMA 3QY9A 4QUHA 2E1RA 3EF3A 2XRFA 3QUCA 1KAHA 4QEDA 1RZRA 3UJHA 1A9OA 3OBIA 3FZGA 5FNZA 4D8YA 3NWEA 4BYGA 3KOUA 3DV9A 2FRDC 1LS1A 1FSGA 1F8UA 1MO2A 2GJ8A 3OM8A 1ABBA 4KPGA 1VL5A 4B85A 5F21A 4H2DA 4R2MA 2QAGA 5LKAA 4PS0A 1HRDA 4I19A 3HCFA 4YJDA 3VPHA