3MUOA

Appep_pepclose+pp closed state
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
684
structure length
684
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Prolyl endopeptidase
total genus 215
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3muoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3muoA01
4NMWA 1H2YA 1QIHA 1C7JA 1WCYA 4PO3X 2RONA 3L1HA 5E4TA 4X97A 1CR6A 5LZ4A 1XLWA 1AMNA 3CCBA 2VSQA 3G9TA 1VA4A 4YK7A 5D3KA 4L0CA 1ODSA 3RM3A 3O4HA 2CZQA 2EDAA 3W05A 3M3DA 2CJPA 4W63A 4PW0A 1H2WA 4JNCA 2XUGA 5T4BA 2PPLA 4BATA 2B9VA 1XKLA 5ALVA 2WKWA 1E8DA 3C5WP 4KAFA 4X6XA 1N1MA 5AM5A 1E8NA 3K6KA 3PF8A 1JT2A 2P8SA 2R8BA 5FV4A 3BIWA 3STWA 4HXGA 4C01A 3DNMA 5AI9A 4BVJA 1W4LA 3W2TA 3C5VA 1E8MA 1BN6A 3HYSA 1BE0A 1DX4A 1CUXA 1P0QA 4KAJA 5AKLA 2AXEA 5AKHA 4DNOA 3HSSA 5DNVA 2BUBA 1MX5A 4ZRDA 1LPAB 5CBKA 4AZ3A 2VF2A 2HDWA 3BDVA 4UBLA 3QMVA 2W6CX 1IUOA 4F21A 2VAVA 2XQKA 4WCVA 2BFNA 3BJRA 3DYIA 4BRZA 4BC1A 1AGYA 5IH7A 3H2KA 5AOAA 1XZLA 3H2JA 3R3ZA 3WIOA 5AO9A 4DNQA 1MAAA 4ROTA 2PUHA 1CUJA 2HA3A 2ZJFA 5LIPA 3WJ1A 1UFOA 3IURA 1BCSA 3I6MA 1GT6A 2AJBA 1R3DA 2X76A 2PL5A 4ZWNA 4HXEB 3UUFA 2XMQA 4HTAA 5CH5A 1JFRA 3W04A 3EF3A 2W22A 2VT7A 3F67A 2K2QB 1GPNA 2PKYX 3ZLUA 4KE7A 1WHSA 2HA6A 2HU7A 2PUJA 5JAPA 3WIBA 5I8PA 1TCAA 3AJAA 3MVEA 4G4GA 4FFWA 1XQXA 5ALPA 5IVHA 2VAXA 2QXUA 1AC5A 1L7RA 3VISA 4OPMA 1QIJA 3R3WA 5K3EA 4EHBA 1ZI6A 4UHEA 2QZPA 1AQLA 5AK5A 3FVTA 1N8SA 1VE7A 1QIFA 4FDMA 3R40A 2JGKA 1XZJA 5C7YA 2QUBA 2WUDA 1UK8A 3H17A 1C7IA 4WY5A 5D6OA 4DLNA 3I2FA 4RE6A 3DQZA 4FBMA 1CUSA 2JGLA 1XFDA 1HL7A 5KBYA 4W1PA 3ZV7A 5CURA 1CEXA 3A6ZA 4FFVA 3EBLA 4Y2YA 3QMMA 2ES4A 4CG1A 4B0OA 5JD4A 3F8SA 2AJLI 4BCCA 5EGNA 2Y2UA 5K3DA 1F0PA 2G4LA 4FLFA 4UFNA 3FYTA 2HADA 4X92A 3I2KA 1GQSA 1N5RA 1JMKC 1P0PA 3O95A 4BTVA 1WPRA 2XMGA 5ALNA 4INZA 3FYUA 5HQ3A 5AM4A 3STTA 4X6YA 3I6ZA 4K6KA 5JZ9A 4N8DA 3C70A 4X90A 4I19A 5ALZA 4X94A 5DTJA 1YA8A 4BE4A 4BP9A 1YAJA 3B5EA 2OGZA 4O08A 1B6GA 2QOEA 1T2NA 3C6BA 1EXWA 1ACJA 4U2GA 4B0PA 1HKHA 4KR0A 5LZ8A 4Y2TA 1YB6A 4AN1A 3I1IA 1ZD5A 5HF8A 3WJ2A 1CQWA 4BVKA 2QTBA 4ZGBA 5CMLA 1GPKA 4GEGA 5H3HA 3QYJA 5AKJA 5AKXA 1XKTA 4EZIA 1EDDA 2HA4A 3EQ8A 1ORVA 2R11A 5D3ZA 4AMYA 3STYA 3WWCA 4N8SA 1QIMA 3GZJA 2PSHA 2O7VA 1XZKA 4K2AA 5IVKA 2GZRA 5EI5A 5AK3A 4A23A 3AIKA 4DSZA 5CTAA 3EQ9A 4OSEA 1LBTA 3ZPXA 5IKXA 5JARA 4FLEA 1LBSA 5FKJA 5HFAA 1CUGA 4H7DA 3AIMA 3H04A 1XQVA 3DCNA 4EY6A 1JI3A 3BIXA 3WK8A 3NWOA 2C5GA 1R9MA 5AM0A 1UXOA 1JJBA 3TRDA 1E66A 5CT9A 1E3QA 4Y2QA 4C4XA 1OCEA 3C8HA 2V96A 3FCXA 3G02A 5D7BA 4KRXA 2O2GA 4OYYA 4EY5A 3IUQA 4WFKA 1Q0RA 4EB0A 5DYWA 1CPYA 1FFEA 4AO8A 4GBGA 3G7NA 4DNFA 5JAUA 2XI4A 2HIHA 3I28A 2RIPA 3F97A 5SYNA 2OQVA 1EDBA 2FJ0A 3LLCA 1EA5A 3MUOA 2C58A 3O9VA 1ODTC 3WZLA 4LYDA 3HJUA 4P92A 1LPPA 1ZIXA 4GECA 1QIGA 5ALHA 1UKAA 1PV1A 2Y6UA 2PSJA 5FPQA 2WLSA 4IH4A 1R1DA 2C0QA 3G0BA 3WL5A 3FOBA 3PUIA 4Q82A 2OGSA 4C87A 3C43A 1CRLA 3BDIA 1K5PA 3GROA 3IDAA 3R3YA 2WTMA 2PVSA 3PFBA 4BDSA 4Q05A 3CN7A 1DWPA 2X8BA 2XUFA 5AM2A 3V1KA 4OU4A 4G4IA 5LKAA 1LZKA 1A88A 1LPNA 4MWSA 4UHHA 4XVCA 4OD0A 4G5XA 5KWIA 2WHRA 2QS9A 3AUKA 5K5EA 3ESAA 1LPMA 4QNNA 1ZI8A 2WFLB 2OCGA 1GPLA 4IH1A 1ZD2P 1UKCA 3H1BA 3PDCA 1EINA 5AP9A 2HA5A 3IVMA 2H1IA 2JIDA 1CUCA 5EIHA 4M0MA 3F98A 3WA7A 1CUWA 4G1FA 1LGYA 5AKKA 4HRXA 2XUPA 1LLFA 4PV7A 2Z3WA 5JAOA 5JD5A 3IIIA 3HC7A 2JEZA 5ALEA 5HFNA 2HA7A 1CUEA 2CUTA 4X85A 3WK7A 4E46A 5JALA 4Q3OA 5LLSA 1XQWA 4FOLA 3C8DA 3OOSA 3LP5A 3T52A 1BEZA 1CIJA 3R0VA 2BAGA 1MJ5A 3FLEA 4U2DA 5T4HA 2G63A 3E3AA 2ACKA 5AK6A 1AX9A 1CUFA 2QJRA 4C4YA 5A62A 4H7HA 4Y2JA 1BU8A 5J3JA 1A7UA 6YASA 2OCLA 3X3HA 2OAGA 5YASA 3P2MA 3I2IA 2JF0A 4ETWA 1FSSA 5AIBA 3S8YA 4FTWA 4E11A 3FSGD 5ALKA 1WHTA 3SC2A 3STUA 3K9BA 3F96A 2WUGA 3AIOA 4J7AA 5JZBA 1VXOA 2XUDA 1XROA 1MAHA 3AFIA 3C6YA 5FRDA 2LIPA 2ROQA 3H0CA 3HI4A 5AKIA 3ZWQA 1ACLA 3WKCA 2QR5A 3TJMA 2PSDA 1QE3A 1CQZA 1BS9A 2OQIA 1WOMA 4C4ZA 4GHWA 3MUNA 2VATA 2XQFA 1H2XA 2WIDA 2RHWA 3G0IA 5C81A 3VVMA 4F0JA 3FWHA 1TRHA 1DINA 2ZSIA 4C6HA 5HQ3B 1T4MA 1DX6A 2CMFA 1UOOA 3F9CA 4MQLA 1BEEA 2JBWA 5A7GA 3WI7A 5A71A 4OB7A 3V48A 1QIEA 2BKLA 2GYWA 2WHPB 4H35A 2X5XA 4LHEA 4I4CA 1VOTA 4FMPA 4CI9A 4PNZA 2ZYRA 4PQEA 1GXSA 4GLBA 4WDQA 1QGED 2DHEA 5AI8A 2ZYSA 1XRQA 5AM3A 1VA5A 3RARA 2YXPX 1J1IA 1G5FA 2VJAA 5ALFA 1XZCA 2GBGA 4CFSA 5A2GA 3H18A 2B4KA 2DHDA 4DMKA 3C45A 1QO7A 3JW8A 1AUOA 2YYSA 3WKDA 1H22A 4XJVA 4DYHA 4LKOA 1NX9A 1FFDA 2OCIA 5AI0A 4UFOA 2BGNA 1K63A 4L3WA 5CT8A 5ALXA 1MNQA 3QVMA 2XUOA 4Q34A 1U8EA 4LXIA 3WWPA 2BCEA 1B41A 4QDXA 4DNPA 3H2IA 5K3FA 5JYCA 1OILA 3W9UA 1ZJ5A 2QT9A 4ZXFA 2AJCA 4ARBA 1YS2X 3A2NA 2RHTA 1P0MA 2XLBA 1O6GA 3HABA 1WPXA 4J0GA 1IMJA 2FJPA 4BC0A 5DLPA 2Y2VA 3ZLTA 2VJCA 5EHNA 2HU5A 2V98A 5EIAA 3LIIA 2H7YA 3ED1A 1W76A 1CUBA 3TGLA 1WB5A 4JH0A 2C5FA 1ISPA 3U0VA 1W75A 4U2EA 3D59A 3WWEA 4N8EA 3AINA 4X7BA 1FFBA 3ICWA 1I6WA 3KDAA 3WK6A 4XWGA 1XZAA 5K3AA 1CVLA 4IO0A 4HXFB 2E3JA 1QFSA 2JGFA 2IITA 1A8UA 3AZPA 3CCCA 1CV2A 3V9AA 1XZHA 3QH4A 1OXMA 1QZ3A 1TKRA 1LZLA 4X00A 1AKNA 2ZJ6A 1L7AA 4J0DA 4WFJA 4UBIA 4X3CA 1D07A 1MO2A 4ZV7A 5BV7A 1THGA 4K6GA 4BCDA 3DJYA 3IUNA 1TCCA 1ZIYA 5AM1A 4W1RA 2WG0A 4AB1A 2XMBA 1CUIA 5DNWA 3B12A 5AI5A 4B80A 2OAEA 4BRSA 2ZSHA 1ZJ4A 2XUJA 3NUZA 1Y7HA 3D0KA 2RGUA 1UK6A 4BTLA 3A2LA 3AZQA 3U1TA 4MYDA 4JUIA 4RPCA 4BDTA 5C8ZA 5ALYA 4KE9A 4C88A 3ESDA 1XLUA 5HF9A 1UOQA 1K6EA 4EY8A 4Q1VA 5JZSA 1DTEA 4H7EA 5FP0A 4FLMA 1IUPA 4UUQA 4CIAA 5LP1A 5C8VA 5HCUA 2PX6A 1ZD4A 2NW6A 1S8OA 4QDUA 3ILSA 3NGMA 2OCKA 3OURA 3ICVA 5T4EA 4G8CA 1BROA 2EDCA 3WWOA 2DHCA 4H18A 2JGJA 2VJBA 3HACA 3QM1A 4JYPA 1FFCA 1H2ZA 1NU8A 3GUUA 1VZ2A 3H2GA 1Y37A 4ZV9A 2XMDA 1JKMA 3EQ7A 3ANTA 4HZGA 2WHQA 3M83A 1XQYA 4Q3KA 1XLVA 4N5IX 4IHAA 5EIEA 5CXUA 3FLBA 1E89A 3MGAA 4H77A 3G0DA 4KEAA 2O7RA 2G5PA 4G8BA 3WMRA 5FDFA 4NS4A 4TGLA 3DOHA 4AMZA 2ORYA 1JJFA 2XDWA 1SCQA 2WU4A 2PSEA 3OM8A 2Q0XA 4AO7A 2HRQA 5CW2A 3BJMA 2FX5A 5JADA 5ALDA 1CUYA 4BBZA 3WZMA 5K3FB 2WJ3A 5CT5A 3S2ZA 4F60A 2XUHA 2GBFA 4BAZA 4K5QA 4Y2VA 2ZJ7A 5DWDA 2XMSA 5CH3A 4J03A 4QDOA 5LZ7A 5K3CA 3STXA 1H23A 5BWBA 1CUZA 4I3FA 3PICA 1MNAA 2XQIA 2JGEA 5BOVA 3W06A 4QEKA 4W1SA 2WU3A 3V1NA 1JJIA 1Q84A 2QUAA 2VA9A 3WL7A 1FFAA 4M0EA 4F5ZA 5ALRA 2ZVDA 1VZ3A 4Y2SA 2DR0A 4A5SA 2VQ6A 4DTCA 4J0CA 1CUUA 1WB6A 1NU6A 1UZAA 2WIJA 3DL7A 3IUMA 1ZICA 2CKMA 4X95A 1J2EA 4UHFA 2Z8XA 2CBGA 3A70A 1ZGBA 2D5LA 2HU8A 5ALJA 1HPLA 3DLTA 3K2IA 5LZ9A 4X71A 5EHZA 4LYEA 4FWBA 4N5HX 2PBLA 3QPAA 2WM2A 5AKYA 1FJ2A 3D2AA 4OB6A 3QMWA 4K6HA 1YASA 3ESCA 4GI1A 2VEOA 4QWMA 1EHYA 1UKBA 1UK9A 1XZIA 3FAKA 4NZZA 1R9NA 3VXKA 1UWCA 3FVRA 4MQMA 5EHXA 5A7HA 3VVLA 2HL6A 1LPBB 4LXGA 2HRRA 3O9MA 3CXUA 2OPHA 5AKEA 2XMRA 3D4LA 4EY7A 2WSLA 1JU3A 3I6YA 1J06A 5T4FA 4KYVA 4CIBA 5ALLA 3DKKA 4UBKA 2C0PA 5FPPA 4GDMA 3VKFA 3SK0A 1MX1A 2J3DA 4WFIA 1MTZA 5CRIA 3YASA 3GBSA 2WFZA 2QRUA 3WKBA 1RYYA 5SYMA 1R88A 1QOZA 4UBJA 1QJ4A 1SCIA 2AJDA 5HK9A 2PM8A 5EFZA 2HFKA 4EA6A 4QDTA 2HFJA 4OCZA 3SX4A 4MEAA 2XMCA 1IUNA 1DQYA 2D0DA 1Y7IA 2XB6A 1TK3A 3WKEA 3NOXA 3LCRA 5ALIA 4OU5A 4DM7A 3JWEA 4HAIA 4L72A 2UZ0A 3FBWA 5AJHA 5LKRA 3W9BA 1C4XA 5IVIA 2HA2A 4U2BA 3V1LA 1Z68A 1YS1X 2XUIA 4B82A 3QPCA 1JU4A 2XQGA 1AURA 1XZDA 3E1GA 3KOOA 5JD6A 5AK4A 1TQHA 1RP1A 1X70A 2QJWA 3D3NA 1L7QA 5A7FA 1GQRA 3D2BA 1J07A 3IA2A 5I9IA 5EHQA 2QKYA 1W52X 2JGIA 5ISMA 1U4NA 1VKHA 1ZGCA 1SOMA 3G0CA 5KREA 1LNSA 2ZYHA 4BVLA 1XZFA 4BYMA 3WLAA 4B9AA 4QZVA 1ORWA 4EBBA 1DU4A 1ETHA 1E5TA 3LS2A 2WHPA 2GZSA 2VT6A 1VLQA 3VJMA 5AH0A 1EX9A 3QZUA 4B7ZA 2HM7A 2ZYIA 3WYDA 4J0KA 5AKZA 5A6VA 3BL8A 2YH2A 4BE9A 2OXEA 4BZWA 4AN0A 5HF6A 4QE3A 4GW3A 1QLWA 3IB3A 4ARAA 1CUVA 4UBMA 3WK9A 2J4CA 3G0GA 1ZOIA 4XX1A 1USWA 4DMFA 4HVTA 1K4YA 4DMCA 5E4JA 4B85A 1A8QA 2WIKA 4KACA 4GXNA 4M0FA 1PJAA 1IVYA 2WG1A 5CT6A 4QDZA 2CEKA 1IZ7A 1F8UA 1RWQA 4Y2RA 2BJHA 1SFRA 4KRYA 1G66A 3M82A 3VDXA 1EI9A 4B6GA 5ALMA 4J0HA 1WM1A 4QA9A 3PFCA 2J4FA 5ALQA 4UPDA 1F0NA 2QVBA 2OG1A 4DSAA 3B3QA 4OB8A 4J3JA 3DOIA 5AI6A 1AZWA 3STVA 2ONCA 1QIDA 3N2ZB 1XRRA 4LIPD 1XZEA 1CLEA 2C7BA 5CT4A 4Y7DA 2DSNA 5AKGA 4FHZA 3HEAA 2XUAA 4D9JA 4Y2XA 4CCWA 4H7FA 4PSCA 2DCMA 2JEYA 4CCYA 4MXDA 5LZ2A 3DEAA 3AILA 2AJ8A 5FLKA 5DNUA 4IQ4A 4G8DA 4MJ3A 2Z8ZA 4QWWA 2JGMA 3E0XA 1MN6A 3DKRA 1A8SA 3WK4A 3L1IA 1N5MA 3V1MA 3WL6A 4W9RA 1YA4A 2BUCA 2B61A 3C6XA 3ESBA 3D2CA 2RAUA 4UHBA 5IVDA 5BWCA 3HLKA 3Q8WA 3KXPA 4GWLA 1WB4A 4YASA 4BZZA 3C6ZA 3O4IA 4UBOA 3I2GA 3BXPA 4UHDA 4C89A 2I3ZA 5FOQA 5JIBA 1JMYA 4XIIA 3PF9A 3JYHA 5I7UA 5AOCA 2QM0A 1XRNA 4TVKA 2Z3ZA 5ESRA 1X2BA 3T4UA 3A2MA 2EEPA 2XQJA 4HRYA 3TEJA 3WYNA 2XE4A 1YB7A 2H9YA 1G42A 3O0DA 1ODCA 2C4HA 5HKBA 4E14A 1UT6A 4ITVA 1QONA 2WJ6A 3RKSA 1HLGA 3VJKA 3CN9A 4Y2PA 5LZ5A 2QXTA 3OC0A 1XRPA 2G5TA 1U2EA 1X2EA 5ALTA 5ALOA 4CG2A 3OPMA 4KAAA 3DD5A 3N0TA 4BB0A 2PU7A 4G9EA 1SCKA 1XZGA 4U2CA 2WTNA 1U65A 5AHXA 3SWWA 3OG9A 2RI6A 1DT5A 3KD2A 2WIFA 3R3XA 3O4JA 2ACEA 2XLCA 5KWJA 3O4GA 5E4YA 5ALSA 4AX4A 1EB9A 2IX9A 1QIKA 1EB8A 3KWJA 4S0XA 2WIGA 3G9UA 5AI4A 3VJLA 2J3QA 1GKLA 4B84A 2GYUA 2QMQA 3Q0TA 4DMHA 1HBJA 4B9EA 2Z5GA 4PSUA 3IULA 4WY8A 4ZREA 4L9AA 3UUEA 2V97A 1PFQA 3BWXA 4KE6A 1QIIA 4Q3LA 2HHAA 2WQZA 2V9ZA 1LPSA 4JEIA 1YAHA 3BF7A 1O6FA 4QLAA 4YX9A 3QPDA 1KU0A 1M33A 2BUAA 1DWOA 1QO9A 1ZD3A 2WJ4A 3R3UA 1BRTA 4MWTA 3DL4A 1XRMA 1MU0A 5HZGA 4J0IA 1CUAA 3BE8A 4TPKA 4CG3A 2WUEA 1W1IA 2ECFA 3IBTA 1TIBA 4UBNA 1KEZA 3ZLVA 4MEBA 2XUQA 3R3VA 2GYVA 5ALUA 3I2HA 3HZOA 3R41A 3FLAA 4P9NA 2O2HA 3PI6A 1QFMA 4AXBA 4BAGA 2WFLA 1EVEA 1GGVA 4A16A 4KE8A 4W1QA 2CB9A 4EUSA 5JANA 5E2IA 1EK1A 3KWFA 1HQDA 1QTIA 1THTA 4H7JA 3H1AA 3LIPA 5ALWA 2O2IA 3GELA 3I2JA 3DYVA 4P08A 4AQDA 2I3DA 1YR2A 4AO6A 1QTRA 3UMJA 4OYLA 1BN7A 5JATA 3DS8A 2XUKA 3FSGA 2I03A 2IIVA 2FUKA 2H7CA 7YASA 3PUHA 5FXMA 4B81A 3WWDA 1KU6A 3BF8A 1EVQA 3ANSA 3FNBA 2WILA 2DQYA 1GZ7A 4CCYB 3D5EA 4NVRA 2DFPA 5CH8A 4DIUA 1DT3A 2HA0A 1SC9A 3WA6A 4Y9SA 1MX9A 2B20A 4X91A 3H19A 5LYYA 1EH5A 2YASA 4UHCA 4P93A 2GBCA 5JAHA 4BP8A 2Y6VA 3G9XA 3RK4A 4U2FA 5AICA 1IZ8A 4PF1A 3WKAA 1XZMA 1DQZA 4RNCA 1VE6A 1EK2A 2XT0A 1R4ZA 5HF5A 4PSDA 3GFFA 3WK5A 5FUMA 2XMZA 5DJ5A 1P0IA 1W6RA 2BGRA 4X93A 3FCYA 3RLIA 2VTVA 2Y1KA 1XZBA 4WJLA 2WFMA 4FBLA 1EDEA 4MYSA 3PE6A 3AZOA 5K3BA 4UFPA 4LXHA 5DYTA 3G9ZA 1K8QA 5JASA 5F4ZA 4DGQA 1VJ5A 3ZI7A 2GBIA 2OGTA 4EY4A 1UOPA 4RE5A 3FYUC 4H0CA 3KSRA 5DYYA 1F6WA 1BCRA 2PSFA 4YPVA 4IH9A 1CUHA 3D7RA 1UK7A 4BAUA 1ZI9A 5ALGA 5HKAA 1YSCA 3H2HA 1TCBA 5CXXA 3QITA 4KJXA 5AIAA 2WUFA 3FYUB 3E4DA 1YCDA 2WG2A 4WDRA 4G4JA 4ZI5A 1GKKA 3I1YA 4J0JA 1Q83A 5DTIA 1CFJA 3IUJA 1MPXA 1MT3A 2DQZA 3HRHA 4AZ0A 2PU5A 3M81A 4H7IA 5HK8A 2H7XA 4G9GA 3EIOA 4QLOA 1DWQA 2I78A 4X6UA 3QBJA 3L1JA 1HDEA 3WL8A 4HS9A 3OTQA 4Z49A 1R50A 4B83A 3DDUA 1CUDA 2OLEA 3GA7A 4JYMA 3C87A 4V2IA 4FNMA 4FKBA 4BCBA 1VXRA 5AOBA 4FNGA 1TAHA 1LPOA 1Q0ZA 1G4HA 4RGYA 4E15A 3G8YA 4OUKX 2VJDA 5C8XA 1XRLA 3WQHA 3HXKA 4H7KA 4Y2UA
chains in the Genus database with same CATH superfamily
3D1VA 4R51A 4ZKDA 3MJCA 3IMFA 2QVCA 3EYAA 3I9MA 5A6SB 3UWKA 2F4VB 4ZOAA 3ZE0B 1M6YA 1C7JA 5BQ5A 4YAEA 5BVHB 2YWCA 1YDFA 2BGJA 3KLPX 4PLPA 4PO3X 5K0BA 1BGVA 2VPQA 3D5QA 1HT0A 1Q77A 2Q5CA 5AVTA 3IEMA 1EPUA 1IHUA 3FIUA 4X97A 3UB2A 4M1OA 5G4LA 1KR5A 3N2GA 4US0R 1ZN8A 4LZOA 4EHHA 3TNDA 2EKZA 2QLLA 1VPLA 1S01A 5BORA 3NGXA 1AMNA 1M7HA 2ORVA 4GRIA 5FT9A 3OCJA 4EI8A 1O0BA 4YK7A 4F38A 3INYA 5BXQC 3JQAB 1JT9A 4HNHA 3O38A 1GWNA 5CA1B 3DBOB 2BIFA 3E3LA 3RM3A 1UJMA 3JRXA 5LOVA 3RRYA 3O4HA 2LVBA 8OHMA 1UBEA 1K4MA 1Z7GA 1I3LA 2EJWA 2HX1A 4HR7A 3SQMA 1Y4SA 1POXA 4HAOA 4R7GA 2GCEA 2HF9A 3FDFA 1W96A 4BNXA 2CYAA 5CLHA 5EIOA 1G20E 1D6NA 2V55B 1K8RA 2I3TA 2HXGA 4YCDA 4YRQA 5AW4A 1XN4A 3H4TA 1ZBQA 3VM6A 2XUGA 2PAAA 1NW5A 5T4BA 1ZL2A 1GPJA 5LA6A 1KXZA 3SDBA 5CB0A 2JBHA 3SEZA 2XDQB 1BWSA 2LV8A 1TYDE 2ARKA 4KQ6A 3E8MA 5ALVA 2A4KA 2WKWA 2X41A 4GMGA 1KY5A 1PYOA 3UENA 3PXBA 4KO4S 4E5YA 4I3HA 4JX9A 4DQVA 5EJEA 1GG2B 1CP3A 3B82A 1CY0A 4G4SO 4C0JA 4CNQA 3QF4B 4EJ6A 2D3WA 4BXOB 4KAFA 4X7RA 1T10A 1U04A 4FYVA 1N1MA 4PRKA 5AM5A 5IC5A 3ZCTA 1JT2A 4U7AA 2R8BA 7MDHA 3S27A 3A1DA 4L16A 4YPOA 1HYGA 1SOAA 1NZFA 2PXXA 2EYUA 2VXYA 2ZWPA 3BIWA 3NV7A 1EVIA 2M6LA 4JC0A 1BOOA 4MUBA 3STWA 4EHNA 2JCVA 2AK3A 2FMHA 1UPXA 1PDOA 2X3UA 3AL3A 4HXGA 3PFKA 2P11A 5FHRA 4B75A 2QA5A 2WQ8A 4QLBA 5C5IA 1NFFA 3UFXB 2QF7A 3ESRA 4BO5A 2RK3A 4DT1B 1RWKA 4PGFA 2OO3A 4ECAA 1X7XA 4OJYA 2J1LA 3FRXA 3LBFA 1JAZA 2QNBA 2ZEJA 4BO1A 4WCFA 3HWSA 4YRTA 5T57A 1BE0A 1ATZA 3LZ6A 3OI7A 3AVXA 1N5IA 2B5MA 4D9CA 5E6UA 1ILEA 4KAJA 2A9VA 4NKRA 3DMGA 1O7JA 3AUXA 2F3TA 3DBHB 3WLOA 4DNOA 3GLVA 5EGSA 1J8YF 3OTOB 3HSSA 1CZOA 3CUUA 5HS6A 1AY0A 1MX5A 2J08A 4UNNA 3DTNA 1C4WA 3PPWA 3HRKA 4DWOA 4HYYA 1TFUA 2YOHA 2YVUA 1O4VA 3GJRA 5CLQA 4Z7JA 3ND6A 5LP6B 1M6VB 3OKWA 1K0UA 1LWNA 1R4NA 2COKA 2HDWA 2NV0A 2VF2A 2WPDA 3DXZA 3KXIA 3MM4A 4MUXA 4P80A 4UBLA 3PEYA 1X1SA 2CUKA 1VJCA 1P7VA 3MRSA 4L4RA 5REQA 3RRBA 1E1QA 4LMRA 4AU1A 1WHTB 1HF3A 3U3OA 4GYKA 2WF7A 5FWXB 2VAVA 2V59A 3KT6A 3UT5A 1WCV1 2MSDB 1Z36A 3ETEA 2DEUA 2XZDA 3CH5A 5EYPA 4ITUA 3QNMA 5LQAA 2BFNA 5IJZA 3BJRA 4Z4FA 1LX7A 4LDAA 1G6OA 4MUIA 1AGYA 4EYOA 3D9QX 2ASVA 1GZHB 4MCAA 4P86A 5AOAA 4L75A 2EKPA 3PNMA 2PBRA 3JB9L 1XZLA 2PX8A 1N6OA 1FYDA 1XCJA 2OORC 2YY6A 3QLUA 3WIOA 3BFXA 3PKJA 3DEZA 2PBIB 4ZJYA 5LDDC 5REQB 4ND5A 1CUJA 2W2KB 4TXLA 3RQSA 1O58A 3IPAA 4O5AA 4P4LA 1FDIA 4DRYA 4ZZ1A 1G21E 1I9CA 3AW8A 2P9KC 3FA2A 3K09C 3DE6X 4FZRA 5LIPA 3UMYA 3GRKA 3IURA 1BCSA 3VO2A 2YS7A 1S3IA 4FT4A 2BEUA 4CM6A 5JWRA 3D0QA 1D04A 3OCVA 4LY3A 4BFZA 3MJ4A 5GONB 2WB2A 2YIMA 4RQBA 3WNBA 2PYDA 6NULA 3LLMA 1YQQA 4QREA 2H52A 1BNCA 2X76A 3AWDA 4TWIA 2ICAA 2A0KA 5D8DA 2PL5A 4JBNA 2FPSA 1T91A 2OFXA 2VUHB 4HXEB 3UUFA 3WQBA 2FWMX 2XMQA 4HTAA 4LYHA 3KD3A 4MMYA 3V8VA 4NCIA 3GJYA 3KZMA 1UQRA 4GOND 2C29D 3GF4A 4GGPA 3T7TA 3W04A 4IX9A 2HMSA 4J7XA 3F67A 1N6PA 2OR3A 4X3PA 3LL7A 1GPNA 1PZFA 1RHUA 1NXTA 3LVRE 4ZU3A 1YDWA 3WB0A 5A06A 5HJEA 2V9CA 3R5FA 2R8RA 3Q9SA 4B4UA 1XNGA 3C8MA 3NYWA 1G19A 3T7CA 4P6VF 3KVNA 1F9AA 4FEAA 3Q87B 5CA0F 2HK8A 3ZOKA 5I8PA 2EVWX 4ASUD 1ANKA 2VF4X 3QWAA 2I6XA 1J22A 1S2GA 5DU2A 5HA5A 3II6X 3WGYA 3A10A 4WZBE 1XELA 2J57G 3V7YA 3H9QA 1GG2A 3MVEA 5CHYA 4G4GA 4C03A 4L8VA 5A9RA 4XB6B 1CRZA 1XQXA 3VYSB 2GEFA 1JB1A 1YMQA 3MIZA 5ALPA 1GGFA 1CK4A 3CNOA 3MWJA 4YMTA 1UC4B 4H59A 1YQTA 1JI0A 3DE4X 1Q7RA 2Q6VA 2B4EA 4HNSA 1JHOA 3SJAA 1QYXA 4D92A 5BV0A 1KTIA 4LVUA 2XBMA 1OYVA 3ND5A 3L0OA 2HCTA 4DY6A 2ASEA 2QZPA 2R4TA 4TL9A 5JAQA 5LBIA 3KSMA 2VDMA 3WB9A 3HGQA 4DRXB 1P8JA 3UVLA 4LECA 4HOYA 1OX5A 4N9QA 3FHTA 4IPTA 1Q91A 3CG0A 5E1BA 1D2NA 1OASA 3SJZA 3UVMA 1I2DA 1EJ0A 1GVHA 3I0NA 1MPTA 3BD7A 3DQPA 3O8OB 4JA2A 1QLJA 2IU4A 4NYJQ 3WOVA 4D9BA 5C7YA 2WY2D 3QEMA 3CVXA 1AM4D 4F2DA 4Q9KA 1CJBA 1UK8A 1OREA 1NVXQ 1AUVA 1RBZA 2JFWA 1JJ7A 2H11A 3I2FA 2JVJA 3U39A 3L4KA 4MWOA 1LRJA 3I6IA 4F3YA 1P31A 4FBMA 1WJGA 4X24A 4NCAA 5BVGA 1DDIA 1QG6A 4W1PA 2Q3FA 3CT6A 3GWGA 1DLJA 1V37A 2D1SA 1IXKA 1CETA 2JH9A 2ONYA 3DV0B 3DZJA 3EVTA 2W4QA 3MCWA 3MQFA 1XXLA 1XAGA 2CXSA 3EBLA 3O3CA 1SG0A 3DHEA 3UJCA 5IYZB 3U44A 3R7FA 4CQLB 4FA1D 2X0IA 1BVYF 2W2TA 5GZ6A 1ZO8A 4O4LB 4RORA 3F8SA 3V4LA 2AJLI 2PYZA 4QFDA 5I7HA 2H4XA 5EGNA 1QRSA 5JYDA 5K01A 2I6SA 4R2IA 1YT5A 1P3DA 1XDWA 3L8DA 2G4LA 4FLFA 1ESEA 4IMPA 2YJNA 4QHSA 4JODA 2C7OA 1IN7A 1TT5B 4N18A 4EVIA 4LQ4A 3GMIA 3QYAA 2FAXA 2O0HA 2AD5A 3SHQA 3I2KA 1FDOA 2ZBGA 2MOKA 3PIDA 3TQOA 4DJDC 5K8UA 3ROZA 4WKCA 4CIDA 3T7EA 4F7WA 5LOVF 3VKWA 1YNOA 2B7LA 4OOFA 5T6BA 3HJAA 3TZBA 3VR2D 4BTVA 3HMKA 5ALNA 3RS3A 5G0TA 3NQ41 4OX9Y 5K8LA 5FI3A 5HQ3A 4NV0A 4GNRA 3MTAA 4TLEA 3N2EA 4R4JA 3AV0B 5C35A 1X77A 1TYEB 1S5PA 3R3HA 4X6YA 4K6KA 4GPZA 4CI8A 1SY7A 2IPXA 4HNQA 2VDQB 4I19A 1TZKA 3TIGA 5B4WA 2J45A 4DPLA 5B58C 4GDFA 2YWBA 3PXSD 1VRVA 5DTJA 2H2IA 4W5WA 4RTLA 4KK4A 1E2FA 2WSMA 3G68A 4UMFA 4MHSA 4TLMB 4KGXA 2GDJA 2V4ZA 4O08A 4RFLA 2YN2A 3FGNA 2OXIA 2LR0A 5EXEA 4DSUA 1D4FA 3R0XA 4FZJA 3ZGXA 3C6BA 1EXWA 4V0LA 4FJ1A 4KV7A 4YQEA 2FE1A 1X13A 3SZLA 2H6KA 4ZMRA 1ZM9A 2GJKA 1NA5A 3V3KA 1VE3A 1H3FA 2PH3A 2CXOA 4TYWA 1SVNA 4BJ3A 4U00A 2E1RA 2N1MA 2X8JB 2JH8A 3VNAA 3MELA 2VDKA 4I55A 1SCNE 3CNNA 2GC4A 1Y8RA 4JT4A 2PRKA 4F91B 1M2VB 4BLRA 2QMOA 4ZYZA 4KKVA 1ZD5A 4NIMA 2X7XA 4EGSA 1W30A 4D9MA 3T0GA 1PNVA 3P7MA 3ROXA 3N6VA 3MW8A 1RLOA 1GPKA 5BW8A 1YQXA 2V7UA 2ZANA 3LTEA 1LK7A 1P44A 3FMVA 5FBHA 5TV2A 4DUZB 4JB0A 1T9ZA 4WKPA 4WTOA 1LTQA 2O2SA 5AKJA 1BX3A 2H9AA 1E2IA 2WJGA 5GVSA 3WP0A 1XKTA 1QUFA 2YDYA 1JMVA 4AW9A 2Y0PA 3SN6A 5BUQA 3T3PB 3GBVA 1O9GA 2FP4A 2W6ZA 1YD7A 2DH5A 1I4TD 1A7KA 3U4QA 4IXWA 1VI2A 1W85A 3EQ8A 5IUJC 3T1HB 1OU4A 1ORVA 5JEEA 4XSHA 2R11A 3JAMA 3SQWA 4PPNA 2J55H 2QBYA 3GVXA 5H1YA 1I3CA 1DZ3A 4QARA 1I7PA 1UBMS 4S0ZA 1C9MA 2ISCA 5B55A 1XGKA 3GZJA 3TL2A 4B4OA 2B2NA 4JSRA 3ZDCA 1MO6A 4QFCA 3EI1A 2FUG1 3NVAA 1TJPB 3ETLA 4RTRA 4HDRB 4GE3A 2O7VA 1GPWB 1QNFA 2CWDA 5JS8A 2PX5A 3X1ZA 2KS6A 2OMKA 5SZJA 3RSHA 2VTDA 3EPKA 4H3HB 3UK2A 4O2AA 5IVKA 5KU7A 5EI5A 5CLIA 3L4BA 3L01A 3HPRA 2NZVG 3CX8A 2CZGA 3BFPA 3EQ9A 2I34A 3BWBA 3ZPXA 1NVAA 1T9GR 2P78A 2YTZA 2HT6A 4PE5B 1E4VA 2ZJAA 1LBSA 1DI0A 1I5OA 4TT3D 5JARA 3SF8B 1CUGA 4EATA 3HVJA 1EFTA 2JFNA 3QELA 4DCJA 5K3OA 2J07A 3TO5A 3AIMA 1JJAA 4RKQA 3ROPA 2RG1A 4EEXA 1I2MB 1PEKE 3LPMA 4LF6B 1X80A 3O2JA 1R64A 1E2DA 1KBOA 2WHXA 4LF4B 5DCWA 1NBWB 2HK6A 1M1NA 5KNLA 4O02B 4M1YA 3AU9A 2OV6A 4RDCA 1E3QA 4Y2QA 3QENA 3PXWD 1QGUB 4LKRA 4S12A 4XYGA 5BN4B 1WBBA 1JG2A 4O2BB 4FGWA 2XVXA 4HEQA 1EDZA 4P5PA 1R2QA 3KV1A 4R3UC 1QG2A 2R6ZA 2QTCA 2HLNA 1XVTA 5D7BA 4KRXA 1NN0A 3AT1A 3G3EA 3LECA 4RZUA 1WCXA 2ZWAA 3IUQA 5EA2A 1ZK2A 4Z4QA 1MVLA 2ZJ2A 4OAQA 4DGSA 1Q0RA 4HRAA 1D2CA 4RTKA 1NTRA 1OWOA 1VCIA 4LVNA 3RTDA 1FFEA 3SSOA 2ZTVA 4N3AA 4DJEC 2PA0A 2GPAA 3DOFA 4E6EA 1IONA 3G7NA 1BXGA 2PWPA 3EISA 4Q1AA 1NJ8A 5JAUA 2RHCA 3P45A 3SMVA 2JAHA 2DQKA 1EWYA 3F5SA 1CJKC 2PMKA 2CLFB 3MWDA 4IJVA 2R0QC 5H0IA 1OBCA 2W83A 3MRTA 4Q4HA 2Z2ZA 3IKMB 3RJTA 1L5VA 5IBPA 2FSVA 4I66A 3VPBA 1A0OA 1U7HA 2J6BA 1U99A 4Q4CA 1EVLA 2ZT8A 4IIHA 1H1TA 4LN1A 4WD3A 4QQNA 1IB0A 2RGBA 1EDBA 3LLCA 1CXZA 1O95D 4NCXA 4O59O 4QYIB 4RPKA 4CDGA 1EA5A 4YROA 4CEHA 3BMCB 3KQMA 1KBZA 3KZXA 1TIKA 3X1XA 2QN6A 3WZLA 3DPUA 4M1KA 3U7FB 1M8PA 2EBSA 2H1OA 2W5UA 4LJRA 1SXJB 3GRFA 4G0NA 1BCRB 1BHJA 1JKXA 4IHJB 1Z47A 3TDNA 3GA0A 3B70A 4D3SA 4ZYXA 3TOVA 1PV1A 2Y6UA 2PS1A 4CZ2A 1QPGA 4D3ZA 1DJQA 4YRLA 4TLBA 2NVUA 3OLXA 4IMJB 3RHZA 1NSFA 1H6BA 1U7ZA 2EATA 2QX9A 1UWVA 1DG1G 1XMSA 2AN1A 4IJQA 1LW7A 2BDEA 4PXAA 4A2WA 5EKUA 2FSFA 3PUIA 1IVNA 1WQ1R 2OGSA 3GVCA 3NC0C 3QVTA 1Q6YA 3E1SA 3M4YA 4J1TC 1E96A 1C3XA 1LB1B 3C43A 2CL7X 3WLPA 2DY0A 1CRLA 4K0RA 4CUJA 4D98A 2XTZA 2BSXA 2IYUA 3GROA 4KQJA 5IK2A 1Z4LA 1A2QA 1IN8A 2PVSA 1WS6A 3NWEA 4OXIA 1E1KA 1Q14A 1YL6A 3EG5A 3EXHC 3CN7A 4LRXA 3GC3B 2FG7C 4GLOA 2H68A 2XWQA 4CY2A 4FU0A 5DW0A 2N42A 4BUJC 4G4IA 4OU4A 3UMFA 1HM5A 3GJ4A 3HJCA 4HLUA 4PLZA 3WOHA 1ENOA 1EUCB 1VMIA 5JJBA 5TT0A 4FYJA 4W5RA 3WRWA 4CLDA 1RJEA 4GKVA 1A88A 1LPNA 2ZRBA 1NRWA 3TZ6A 4X5OA 4D8WA 2XVYA 5GTDA 1HE1C 1CJVC 1UDBA 2RARA 1KAMA 3OZTA 3L8HA 2ETVA 1D4OA 3FUUA 3TPFA 4YI5A 5IGQA 4BGVA 3THSA 1B42A 5E7IA 5I4IA 3ZZ1A 1QH0A 3S29A 4ALNA 4DUPA 1MT0A 1LRKA 4P33A 2Z3VA 2R00C 2QS9A 3ZDZA 5A1JA 4C0BA 3JSXA 4G2TA 3HJGA 3M49A 1QK4A 3N76A 3LYHA 3ZV3A 2N1BA 3BK7A 3KTAB 5I48A 4A8JB 4ND3A 3F74A 3NDIA 4MS3B 1T3LA 4IH1A 1HT2E 3ROMA 1XUOA 3IIMA 1V9SA 1V8BA 1XZ8A 1E7YA 3CG4A 1U0OC 1R0WA 3K8YA 4EG5A 1N0WA 4O4IA 2QRJA 2B98A 1DNPA 2ZQYA 3BMNA 4GO1A 5EWLA 1PJTA 1FY2A 1CR2A 4L7VA 5AJTA 1CUCA 1I51A 1TM1E 1NYRA 1RW4A 3ITNA 3I92A 5K8CA 3EZLA 1V11B 3QA3E 1BXRB 1MD9A 4GR5A 4H5IA 4LNUB 3OHSX 4ZQGA 4Y0VA 3W6UA 1JSZA 3F98A 3ZCRA 3U1VA 4BNDB 6REQA 2IS1A 1NRJB 5E95A 4G1FA 3BMXA 3LHIA 1QCYA 1Y34E 2O0KA 2XUPA 4HRXA 4UCXA 1CFZA 5ENDA 4G0OA 1T29A 2TMKA 2QU7A 2X5OA 3RTAA 4W5QA 2I71A 3LWDA 3JQRA 1Q7CA 4J2HA 3KHUA 5JD5A 3WHKA 3L41A 3C3PA 2CE9A 3HC7A 2HGZA 1KNQA 3F4LA 5HQJA 2JEZA 5ALEA 5HFNA 4D42A 4OY3A 2CUTA 1DC3A 3L7IA 4X85A 2AVNA 4BMVA 2AC2A 2NGRA 1EGVB 3BTSA 3KETA 2ANBA 2VI5A 1P4RA 4V1CI 4LRQA 4Q3OA 5LLSA 1GUYA 2AF3C 2AG8A 2BFOA 5FORA 4EWLA 3IIWA 3U3RA 5LMUB 4FOLA 4ZDIA 1PD1A 3FWNA 4L15A 1XXHA 3P9RA 3LP5A 3R23A 4NBNA 1B73A 5ETJA 5HXAA 2QRHA 3OCYA 4DWVA 2RHJA 2GTHA 2WBLC 4UJ5A 1U1IA 4KDCA 2EYQA 1OW3B 1BEZA 3MTBA 1UBRS 4BQRA 1XC7A 2HJSA 4HQLA 4D8YA 1Z62A 1L2TA 1JQ5A 1MJ5A 3A9UA 1XYVA 3KZOA 4E3ZA 2OECA 4YRAA 1HH4A 3VGJA 3BE6A 3QE0A 3JYOA 4TUYF 2J5RA 1JBEA 1G9SA 1Z82A 3FRIA 5ELXA 1JHQA 1OJ7A 1S3GA 4MW4A 3SJLD 3ZNOA 4HNAB 2A2ZA 3EEBA 3EGVA 5AK6A 1AX9A 1M0SA 3QRWA 1MGOA 4KGVA 2WSSA 3E2PA 3RYCA 2QJRA 4AQ7A 4M8NE 1G16A 3JALA 4H7HA 3WIEA 1N2HA 3CW2A 1BU8A 3RN1D 1Z83A 3OLQA 5KYXB 1AUXA 5EJ7A 1A5BB 4LK2A 4CR6A 1ZY2A 2NVBA 1YBMA 1WMBA 1G5QA 1ZUIA 1FS4A 4QJ5A 1AT1A 4JL8A 2OAGA 3RT1A 3P2MA 4DCGA 4A15A 1RHRA 5D2CA 5L3RA 3I2IA 1YVPA 2JF0A 3RNOA 5K45A 2YINC 1UBLS 3VSCA 4QUGA 1MQAA 1OGIA 2FWRA 2HT1A 2BFCB 1N7IA 2R85A 1Y80A 2AOUB 2BRUC 2QMHA 2ZTHA 2R1VB 3ANNA 1FSSA 3N5KA 4PG7A 5KWVA 4J0FA 4HNVA 4KXLA 4MHOA 5A5VA 3PCTA 4Y9DA 3PB3A 1OI2A 5ALKA 3S6JA 2E5FA 1WHTA 4NULA 1M2WA 3A36A 3RS2A 3TLXA 4CV2A 2IDKA 3E5MA 3GFBA 5F76A 5EMKA 4ZDJA 3ZC3A 4XWYA 3GRUA 3D31A 3I9V1 5FA5B 2G4CA 5FHQA 2DLDA 1NV8A 3AIOA 4HH3C 4NF2A 1W9HA 3ZW9A 2GYYA 3Q6MA 4RTSA 1W8IA 3EE6A 3DXKC 3ISTA 3GLSA 4KPYA 1G7RA 3AB3A 4IZ6A 3THYB 3LX4A 2F3SA 1S3SA 1JKIA 2P4UA 2X6TA 3IDOA 3AEKA 1TVKA 2J3KA 4MUEA 1B26A 1E7WA 1R5JA 4E13A 1MAHA 5LFAA 1DCFA 1KIMA 3RG8A 2LIPA 4TKVB 1T8WA 4MICA 5IEBA 4A26A 3EZ9A 4BZPA 1OB2A 3FI9A 1ZK4A 1VJDA 1AGPA 1GPH1 2QD5A 2ZS8A 3HI4A 4JJAA 2RBEA 1I30A 1ZJZA 1ST3A 1HZZC 2YOGA 3TAUA 3WKCA 3AR2A 4FS8A 3ZZUA 3PX3A 4E5ZB 4M6WA 1T0HB 4RLHA 4XGNA 3QOWA 1JJVA 3PNQA 4KREA 2BMDA 3F5QA 5C5DA 5B2FA 1QF9A 3RASA 2FPMA 4O4IF 1D2AA 1JOFA 5FIUA 4F1JA 2O3RA 2WPDD 3ZS8A 3R9XA 2JJ8A 2P4HX 1VSBA 2OQIA 2R8XA 1FVFA 1JQAA 1N92A 1KI6B 1W5BA 3QF7A 5F73A 4DC0A 1RZRA 5B4VA 2AMVA 1MJFA 1V39A 2VTBA 4J94A 4XWTA 5TPWA 4BEWA 5CITA 5AVWA 521PA 3QF4A 4QO8A 3KKNA 4K9OA 4CT4B 2ZRAA 3CM0A 1UDWA 5C81A 2JLRA 2OHIA 3FHJA 2Q41A 3JY6A 4J1NA 2RCNA 2JFVA 3PNBA 1JVBA 5EXPA 2IYRA 3PI7A 3FWHA 3L6DA 3JR7A 1C4OA 3REOA 1JP7A 2DZDA 3T3HA 2DYKA 4TTVA 4MQEA 4Q3NA 3GEDA 2J3MA 1GAEO 3FX2A 4J2TA 3IESA 4RUKA 1G4UR 5JAMA 2Z98A 3U9LA 4CQJA 2OUIA 5MF6A 1T4MA 5KNCH 1NR1A 1W2GA 4HWRA 3IEKA 3GH1A 4HLDA 3E22B 7ABPA 4CKCB 4W8GA 1FRZA 4G0XA 1KKLA 3K0AA 4XA8A 3TM5A 3V5NA 4LFAB 3JYQA 1MAUA 5A0VA 2JBWA 3WI7A 2GI4A 1AKVA 2VDPB 4OB7A 3GYGA 3NCTA 2MR5A 3T7KA 1HT3A 2GYWA 2WHPB 2WT9A 2V1XA 3E5HA 1JDTA 2RC6A 4H35A 3RLMD 2KM1A 2YFHA 5EJGA 3W2FA 1DQPA 2ZDQA 5C1IA 4RXTA 1P75A 4EDFA 2PA3A 2XYQA 1XD8A 1Q1BA 3KU1A 4URVR 1BZYA 1TA4A 2ODPA 2WJVA 5FTNA 2IUUA 4PNZA 4PQEA 5JNUA 3KUCA 1YJAA 4EYGA 4GZ3A 5AUOB 3RS8A 2NYUA 3HHEA 3ZWLB 1PGNA 2F48A 2WTUA 2G1JA 2G83A 3M6UA 3V8EA 1QGED 5IULC 4URHA 3MMYA 4QUHA 4JQYA 5TQJA 3S70A 3ZBUA 4D2IA 3FMPB 4HDJA 4ZI7F 2DGDA 1FXWA 5A4AA 5BOSB 1A1SA 1ESZA 1RDFA 3ZJYA 2V8OA 2Z2JA 4UCFA 4EW3A 5BN4A 3N0XA 3LFHA 5IAGA 3CUWA 3UG6A 4HLQB 2GWRA 1XZCA 1R0SA 1VL0A 4IXTA 2V3WA 4MLPA 3SZMA 4K1XA 1W4CA 2ENWA 1TJ4A 2OZKA 3D4BA 2EGUA 5AYVA 3SP1A 2GBGA 4BLOA 4KHPB 2HRBA 4CFSA 2JI7A 3I89A 5IF3A 4ERNA 2B4KA 2DUWA 4XYIA 5D3MB 3KSDO 5IX8A 3C3AA 3GPDG 3OF7A 3C45A 3HKEB 4WRRA 3T1NA 1A5SB 4DMKA 1G8PA 3AL8A 2BZSA 3COWA 4CKBA 4ZYUA 1H94A 4NBSA 5FBVB 3U3ZA 2Q3EA 2G72A 1UZUA 2VDMB 2FNAA 3UAWA 5C53B 2VYFA 3BIJA 3HU3A 5KMGB 1AQYA 3HO1A 3JZGA 1Y3BE 3RUAA 1X9IA 1YQGA 4KPGA 1FFDA 3UWPA 1P80A 1SHKA 4GYWA 2W6PA 3Q9UA 5KCMA 1N2SA 3WC4A 4JBXA 2AH5A 2IDJA 2WJWA 2BGNA 1YQWA 3OFNA 1JEYA 3WRXA 4L3WA 2NO1A 5CT8A 3L4OD 4ZOXA 2EKQA 2A14A 3M4XA 4NONA 1MNQA 3RAGA 4P3PA 5FOWA 3DH0A 4CI3A 1IXZA 2PQ2A 3N7AA 2OCPA 2VK1A 1T8UA 3CRMA 4HWGA 4GSKA 3ZWKA 3L07A 5JVDF 2IX3A 2JIPA 2ZUWA 1R0BA 3OA0A 1FFGA 2PD6A 1U8EA 1L5GA 3MGKA 3O83A 3R24A 3P4XA 4BX8A 2Q3BA 1YUBA 2I66A 3QXJA 1QQ5A 3IELA 5KKAA 4CYMA 1BH2A 3QUCA 2YWJA 3H4VA 3R3JA 1B41A 3SIPA 1VJ1A 1OWPA 4DNPA 1NTOA 5F1OA 4EI9A 3TLMA 3ADBA 5K3FA 1C7FA 1AN9A 3IR6A 1OT3A 5JYCA 3U61B 1NQOA 4LOLA 3GGCA 3TUJC 1JQLB 4WUVA 2C5SA 3FIJA 1WZ2A 4ZXFA 4LOHA 3WIDA 3TLZA 3ZZTA 1O57A 4EI7A 1FX1A 1YI8A 2RHTA 5JCZA 4YIKA 1P0MA 2MYTA 3LUJA 2W70A 4CODB 1D2HA 1QZUA 2QTWB 2GARA 4WVLA 1EFVB 2C8LA 3DMRA 4L0MA 4ZOLF 1P4HA 3UFBA 1KJYA 2SCUB 1F8GA 3COYA 4TSKA 1W7AA 4JP8A 3HUTA 3P27A 1II8B 3ANXA 4IFIA 2X0DA 4D4IA 4C22A 1HNXB 2FCAA 4LJ6A 4ZCTA 1W49A 2J3JA 3AI7A 5SICE 3G7SA 4PN3A 5IXSA 3HXMA 1Q0UA 3NIFA 3ZLTA 1XVLA 1RFLA 3DEYX 4JI2B 2HU5A 1B0UA 3PENA 3U80A 2PUCA 2Q46A 3EBPA 4J7UA 5LLDA 4GP6A 3MWLA 3V7WA 1W34A 3EVDA 5KJEA 3DJFA 4NOJA 2OGUA 2ZIXA 4UXJA 1G1MA 1XVVA 3EHDA 2AXPA 3QPBA 1L5NA 3QV1A 2WV7A 4OK6A 3DZBA 3LGAA 4MZDA 4WA7A 2VAWA 1P4SA 1AA9A 5JDCA 2FF5A 4OV6B 3SKXA 4WNAA 3CNEA 2JFUA 2NQ8A 3IJEB 1E5XA 2BEUB 3NOQA 4KPUB 4FGKA 1I33A 4UU1A 1KI3A 5BWOA 2JASA 1HSZA 1N8NA 3GU3A 2BHRA 3N8GA 4K9PA 3BREA 4N8EA 1J4AA 5GZ1A 1QK3A 3PXAA 4N0PA 5DBFA 1Y7PA 1J2RA 1C3OA 1PJ4A 3AINA 1V7PC 1Z6XA 5B1DA 1PSDA 3V6LA 4P4SB 1ECLA 4LOAA 5H80A 1I6WA 2WJYA 3WLQA 3OKTA 4XWGA 4Y6GB 1RACA 2X7HA 5IC6A 5SZIA 5ICCA 2I2DA 5EG5A 3D4IA 2WR8A 2WIAA 4L85A 3MWDB 1KZHA 3R5KA 4RW0A 3UOGA 1N2CE 3FHLA 1ULAA 4E1AA 1WUKS 3CH7A 3Q40A 4LJLA 1ZR4A 2IF2A 4M1EA 1QFSA 1GLNA 1BRMA 1ZINA 1XWIA 2G70A 2IITA 2R00A 2UVPB 3AZPA 1DARA 3BH6A 3NKFA 2D8MA 3PEWA 2G5GX 3VA6A 3O73A 4L2IA 2OP1A 4JI5B 3IGFA 3ADOA 1OXMA 2WP8J 1GZ5A 3SYMA 1LZLA 2BMJA 3S2GA 1VLZA 1CNEA 1MG2A 5L8VA 3AVUA 2A9FA 4DARA 2BY4A 5KNDA 4G65A 4TLAA 4X00A 4XX0A 5DMHA 2P75A 4I50F 3IPYA 3VSBA 2AKYA 5LQCA 1QUEA 4TS4A 4X3CA 4YRDA 5BUCA 1V4VA 3AUUA 4S04A 4RK6A 1MO2A 3ILHA 5P8WA 1NBIA 1KJWA 4FM9A 3KVOA 3IUNA 3PE3A 5HMMA 1WSDA 2DKNA 2JFPA 4I9NA 1ST2A 2GTIA 3M6LA 1KVQA 2ZJZA 3DBLA 3LUCA 2HESX 2ZIVB 4ZOVA 3NBAA 2E48A 4KO3S 4W1RA 3KDSE 4BFUA 2XGOA 3W5SA 1QE5A 5BW6B 3JQGB 5THXA 3Q7TA 3ZCXA 1ZLYA 1HNWB 5AI5A 2O8FB 4B80A 1RI3A 3DW1X 3G0OA 1DADA 5HKLA 2WWRA 2ATVA 2GCIA 2ZSHA 3Q2KA 1PSWA 3OO1A 5TVKA 1L4GA 1M75A 4EAAA 1UK6A 2Z1NA 2VDRA 4BTLA 3KJFA 2BEKA 1TZCA 1V6CA 3JPYA 4D9FA 5C8YB 2ZM6B 2QLMA 3AZQA 4TLCA 3A3PA 4ND6A 5JSKA 5ENZA 3U1TA 2ZIEA 5M7EA 2PXHA 5C2JB 2C9BA 4FJ0A 1KJQA 1KEEB 1XEAA 4IZIA 1Y6QA 4JUIA 4Z0HO 1SKYE 3JQGA 3RC2A 3WRYA 4C0AC 3JVDA 4Z0NA 1VCOA 2HTFA 4KE9A 4YRGA 2VKQA 1QQ6A 3R7BA 3GAAA 2W2VA 3B3GA 3ESDA 2BFFB 4O1MA 5JBQA 2P6PA 1XLUA 3Q6NA 3H87A 4G97A 4F9GA 3GLGA 4NQRA 5CB4A 5J23A 5JSQA 2I1WA 3JQDA 1UOQA 1XAIA 5L3ZA 1RYEA 4GUDA 4LHWA 4EY8A 2ID9A 4F1WA 1DTEA 3KHTA 4AROA 1NSYA 4ARZB 3ZW7A 2AW5A 3RRFA 5FP0A 1IUPA 3ICPA 2EERA 3LT1A 1HOXA 3COZA 3SCZA 1NEXB 4KUHA 4LBYA 1W4BA 3K1JA 2YXDA 3MLEA 1RLJA 1WL8A 2EIBA 1XEFA 5C8VA 3ZD6A 3ZG6A 1A5AB 2W6NA 4QG7A 4V24A 5I5EA 3WGIA 4AJJA 3UICA 4DHEA 2RGAA 3JQ6A 1PJLA 1ZD8A 1ZUWA 4KXFB 3KL4A 4C6TA 4EAQA 4OATA 2GASA 3EGWA 2C7QA 3TPZA 1N6IA 4BMOB 4II2A 1FNSA 3G2LA 2VP5A 1PQWA 3K6JA 2Z0MA 1NVMB 1KKMA 4JSVC 2OCKA 3BMOB 1A4XA 3OIYA 2IYNA 5T4EA 5IJWA 4AKGA 4OKNA 1IWPB 2DHCA 4JBWA 3COJA 1PFUA 4UE6A 1KMQA 2O8BA 1KIFA 2ZP1A 3W7AA 1CS0A 4D82A 1JDSA 1VB5A 3I0MA 4NDZA 3FUTA 3FGZA 4AS2A 4Q9IA 1JFLA 4L8LA 3W34A 4RY2A 2VWHA 1M5TA 1YDEA 3OKCA 1H2ZA 1NU8A 2GBLA 2SHKA 5T8KA 2C7GA 5B3AA 1Y5MA 1Y98A 2PZMA 3B9PA 3KK0A 3DFIA 1MZVA 3ZKWB 4J7CA 4EO4A 5JTUA 3R5TA 3CVYA 3HVIA 5C1DA 2QTLA 3BD6A 1EFCA 1DIGA 4Y2HA 5IFLA 4XKJA 1EYZA 3PQ8A 3UJBA 4N5IX 2HJ4A 4FIZA 1L7NA 5IJ8E 5EIEA 3RK0A 3W79A 4GGDA 5ECWA 1QHXA 1CNMA 2QTRA 3EGXA 3KUDA 1VMAA 3PVSA 3VZDA 1E89A 3DSRA 3MGAA 3CV3A 3QK7A 2FPGA 4H77A 2P0YA 2DWOA 2P40A 4TYMA 4X20B 4BJHB 3MJFA 3AEXA 1KDYA 4BLSA 1P7PA 1SQFA 1DQNA 2GK3A 4M37A 3VU9A 2XTJA 3EEYA 3ZGVA 1QDEA 2G5PA 2J09A 4QELA 1V25A 4TTQA 3RF7A 3WMRA 3TKLA 4CMCA 4F56A 2XGMA 4QT0A 1GOHA 2BE9A 4ZEWA 2O20A 5BSHA 2NX2A 5CLGA 4BE7B 5J47A 5JECA 4KQ1A 3RVPA 4DJAA 3WFJA 3IEUA 1DE0A 2Q0XA 4AO7A 1Z18A 4MR7A 3U2QA 1E64A 2D1YA 2JCBA 3JD1A 2OD7A 2RAVA 5LSAA 1E2QA 1RAIA 4NAAA 4DEVA 2ABWA 2P4QA 4QUAA 2Q4OA 3QE2A 1QJCA 2FMXA 5I7AA 2X6RA 5JLAA 2JFGA 2BGKA 4NBUA 2O8CB 3MTDA 4GM0A 5AVJA 3U4DA 5H4HA 1UZLA 3GDHA 4FZ5A 4MPPA 3W6PA 4FD2A 1XHMA 4DNVA 2VIIA 3FCUA 3LK7A 3OAAD 5K3FB 4BKUA 2I62A 5CT5A 4D0NA 1VRWA 3NZEA 2XUHA 3ZJVA 3HFSA 1RJWA 3LCMA 1I7DA 3C3JA 4PWZA 5MFZA 1FZQA 2RH9B 1AK2A 2DM6A 2GBFA 2ZZNA 3LL4A 4JJ6A 2OTCA 4Y2VA 3WWZA 2WNSA 2BHLA 2Z4RA 4ZOQI 3OIVA 4FSXA 2KQUA 2ZJ7A 2OZPA 2Q49A 5CXCA 2XMSA 2Z9DA 3A27A 4V03A 4L6AA 3ILVA 4MVJH 1VCHA 2VHWA 2GLUA 2ZTUA 3PL1A 2XGJA 3IPLA 4J03A 4QDOA 2Q5QA 3HP7A 4JMLA 5K3CA 4RENA 5ADHA 3UAYA 3UWSA 2XGSA 4MP8A 1H23A 1M2OA 1PQUA 3NRJA 4BNJA 5KVCA 2WE7A 5ILOA 5BWBA 1OZFA 3KLMX 3UV6A 1G8MA 1JHDA 4FYYA 2IU3A 1OXKB 1L7OA 2X8AA 3AHIA 4DG8A 1V5IA 3MBIA 1RRGA 5FFFA 2AKAB 2JGEA 3MCZA 3DTVB 4XQGA 3ZK7A 3RSCA 3W06A 4D4HA 4QEKA 1IATA 5JWOA 5JT1A 5FLXA 4LF7B 4MHTA 1G2QA 3P26A 1L1QA 1NFQA 1UF9A 4MWCA 1BE6A 4KQWA 2VA9A 4UZFA 4KOEC 3ZDBA 1ND5A 4ZDWA 3VBEA 2KE5A 2RAPA 1FB5A 3BHMA 5I5GA 5TGZA 4CMHA 2X3YA 4LOJA 3DKIA 1FFAA 1GAXA 1TW2A 2WLTA 3DW3X 4QXPA 1GN9A 4GM1A 2DR0A 4Y2SA 2R96A 2Z08A 3D8BA 3WLRA 2B5OA 4DTCA 1KZGB 1TQDA 5KYYA 1UPUA 3LAWA 5I9BA 3DL7A 4EYKA 4D74A 2QAGB 3TW4A 3PIIA 4LFBB 5CXBA 1E5VA 1EK0A 4ZOYA 3ZIUA 1ZGBA 4J86A 3E5NA 3OOYA 5C4IA 3PRYA 3K8ZA 3I64A 2JLVA 3DCIA 1R66A 1UBHS 4GOOD 1YB2A 1J8VA 4TVOA 5CJJA 3ICEA 1HPLA 1UP6A 5KOHB 1P2GA 2J41A 3KFLA 4DV1B 1JXOA 3KE9A 4X71A 4KNWA 3JQCA 5EHZA 4X8MA 3TM4A 4LYEA 4KG7A 4CHTA 4IJMA 4TZ0A 3GVHA 1IY0A 3HCDA 5F1KA 3LUFA 1EP9A 1PG5A 2WAYA 1NXQA 2WK1A 3HJTA 1JTEA 1KI9A 4JOQA 4LMAA 3IQGX 3WV4A 3ZIDA 3CISA 3LT2A 3QMWA 3KJQA 3IHTA 1CJTC 3TLCA 1MIHA 3TDKA 4DR2B 3D81A 5IARA 1T34A 2ZDHA 1LBQA 1LS1A 1EHYA 1W5EA 1ZONA 2DU8A 2WYIA 3IERA 4JC4A 1Z0JA 1I80A 4NLLA 4DDWA 4D1YA 2H13A 1N3YA 1XA0A 5IC4A 1ZYUA 4IBOA 1R9NA 3SHVA 4EFDA 2WKPA 3UUGA 5KKCA 3HBMA 1BCSB 4M7PA 4DXDA 4LI0A 5BR4A 4LDNA 3V7NA 2CNXA 1FYVA 5A7HA 5EHXA 4ZTZB 1QGDA 3COPA 1JQBA 2ZI7A 2H57A 3ZTTA 2HLDD 4QKQA 1QBGA 1S9DA 2EGGA 1UMDB 3GLHA 4R1PA 3U3MA 4F5YA 2HMAA 3B7GA 4C21A 3I2YX 1DKRA 4JDUA 4YP5A 3GPIA 4OK5A 4G0YA 3PVZA 3CXUA 5COAA 2BMWA 1PVVA 2X6QA 5IJXA 4X7MA 4CBVA 3T3NA 2PIAA 2XMRA 1Z12A 1DKMA 2Q4BA 2GC7A 1O6BA 3NNSA 3ZHQA 4YH1A 2WSLA 4FHGA 4LJ5A 4N0MA 3K0EA 1JU3A 2YJ4A 1J06A 4KYVA 4O4LF 2CKDA 2L42A 2P2GA 3AKYA 1W85B 5ITZA 1G5TA 1V4NA 1ZNXA 1EZZA 2GILA 3DLAA 2QYTA 2C0PA 4S1WA 3UA3A 1L4EA 5C9ZB 1EWKA 4GMKA 4DANA 4XWOA 3BMCA 4GDMA 3VKFA 1MX1A 1L8LA 1ZC3A 1H6CA 4QTYA 5JSYA 3TR0A 3V80A 4WBNB 1NVUQ 3EVCA 1ZESA 2EG9A 2ZS7A 3GBSA 1OR8A 1YKSA 3ON5A 1KZ7B 2WFZA 2Y05A 1GPUA 3Q7PA 4RF3A 4M49A 2VJKA 4J81A 4CF3A 2EZ4A 5CA1A 4D96A 4KJZA 2ECOA 4DMLA 1FXWF 3B60A 4DA9A 2CLLB 1N2GA 4FD3A 3BYZA 3M6XA 4I2NA 4EA6A 1FDVA 2UXDB 4XIYA 4J90A 2XX3A 2W42A 3N2NA 4QDTA 1YOBA 2OY0A 5JAZA 2BSQA 1ZWKA 3KBBA 1RHKA 2JBAA 3V34A 1DRUA 2HFJA 3ZI4A 2NTYC 3Q8LA 3LW8A 4M9XA 1YS7A 3PQFA 1PR0A 1JLSA 1GGEA 3OOHA 4RDIA 3L8MA 3SSNA 2CN1A 2BDTA 3SSMA 1JDBC 3Q3CA 4H4EA 2JVIA 2VQEB 1Z8DA 1VQ1A 2CN3A 3G82C 3EIXA 4ZIRB 3L4MD 3PDIB 5CGQB 3TL6A 3PD7A 4QDZA 2DWQA 1IE3A 2GN6A 2WD9A 4OU5A 3Q1LA 4BGIA 4E1VA 1II9A 1LJLA 1Y9AA 2ONZA 2VP2A 3R4CA 1JEEA 4IKOA 4MVJA 4PZAA 4JUFA 4U63A 2BDUA 4IDQA 4QOGA 1WDWB 3N0VA 2Q3JA 1BDJA 3F4BA 1VFNA 3W9BA 3PEVA 3EWSA 1MA3A 4IW3B 4HAUA 3T35A 2ZAIA 1U7OA 3PSAA 1JU4A 1S4UX 3L3BA 3SD7A 5KYUB 4FCCA 3DGFC 1ZZEA 3GARA 3GWZA 2W00A 3NVDA 4NV3A 1T1JA 1NAHA 3OX3A 4BGEA 4W6ZA 5D01A 1XU4A 3KOOA 4XUEA 2IH4A 3MILA 1RXVA 2ZYVX 1TCUA 3LBNA 4C0KA 5DK4A 1KC3A 2FOXA 1X3SA 1AB6A 1WR8A 2Q21A 4EO7A 4EPVA 4WK4B 3U4GA 3L8GA 4I4LA 4IGEA 3KC2A 3H2SA 2LNDA 1UBFA 1G8GA 3G2IA 1FPMA 3MJTA 3O7WA 2KI5A 3KTOA 3NBXX 2QJWA 2Z9CA 2J9RA 1KY3A 2Q1TA 4C3UA 3JTEA 1P6QA 1X9HA 4HYEA 3SBEA 3ZKWA 2QTZA 2D2FA 1NN1A 1EXNA 4PZYA 5A7FA 3H6GA 3UJNA 5LWHA 2YNMA 4OP2A 1EFLA 2H3EA 1JA9A 3DC7A 5EN4A 4WLOA 2DH6A 4D9EA 5ISMA 3K26A 3HA3A 1VKHA 4RZXA 1Y1KE 4QUBA 3Q9LA 3TLGA 4QIHA 1GDHA 2GKOA 4KWCA 4U7FA 2BKUA 4CF5A 4HGPA 1E6LA 3G0CA 3SMQA 3TNYA 1U0EA 5DTRA 3JTMA 2ZATA 3T4EA 4DMMA 2JIZD 3E9RA 1VBNA 5EQFA 4JI4B 2ZYHA 4W7IA 2ODQA 2GRJA 4KX3A 2DPHA 2WA1A 2FN3A 1T2VA 1SA0B 2I65A 2ZQZA 4V0SA 5KJFA 1NBEA 1QOQB 4B3BA 4XX0B 2AE2A 2VRNA 2FR8C 1F17A 1OXSC 4JBHA 1E2KA 5GV7A 1U28C 2X8WA 4NHEA 4KH1A 4QZVA 5ITVA 2DERA 1WUTA 2O19A 4DBVO 2QX7A 1ETHA 3I7HA 3LS2A 2W2OA 4ENUA 3PYLA 4JLAA 1A76A 1WNTA 1IRIA 3V2HA 2WHPA 5I5IA 2ZSUA 3HNRA 4IINA 4DV4B 4MV9A 1M2VA 1H93A 3FFWA 4RKWA 4FK8A 4QASA 4MTLA 4W9NA 5AH0A 5F35A 3VJMA 2YZ7A 4C4RA 5M04A 1CY1A 1MOQA 3I12A 4PFQA 2G6BA 3W4IA 2QRGA 2DTDA 2BF4A 2P9BA 3PC7A 4GRDA 3WS7A 4FDAA 1LXCA 3ZXYA 2VUSA 2SECE 1PJQA 4MJ7A 1TFRA 4R8LA 4BVEA 1XSEA 4Q4DA 4XFKA 3KEFA 4YUZA 2GUGA 3OOJA 4GL2A 2YH2A 3NGLA 3TTUA 1YVEI 4B79A 4JWKA 1N6HA 3DLPX 5JMTA 1VHQA 4TQ9A 3ASVA 4W4TA 1L8XA 1T5LA 3L7YA 1L1RA 3R44A 2ZFUA 1JSLA 4H27A 1P74A 1Y6RA 3LXRA 4OMFG 4XIJA 2NUPA 4OREX 4WN9B 4ZVRA 5DNAA 4P7JA 4N49A 4F6RB 3WADA 4CKEA 4MKZA 1YOVB 4KR7A 1HFJA 3FCEA 5EZYF 3OHMA 3OPXA 1NQXA 3E9ZA 5AHRA 4Y9RA 1RU3A 4UM8B 3DXXA 4UEJA 3KSBC 2J4CA 2Z1DA 2ZI6A 3G0GA 3OMWA 3DNPA 4GSLA 5C1PA 2F8TA 1W2WB 4ND4A 3C9CA 2JJYA 3UANA 4DLUA 4HVTA 1N9GA 4C78A 2JAWA 1EX6A 2FZKA 5FPKA 1DKLA 4QQ8A 2HQSA 1GA6A 4JQZA 5E4JA 4B85A 3ESZA 1JR3D 1Z4KA 4C0WA 2ORIA 3F7MA 4KR3A 1VKJA 4PC3A 3OZBA 1OYYA 4B3SB 2A9JA 4BJ6A 5FKRA 1KK2A 1U4OA 2J5KA 4JUAA 5CT6A 3HFRA 1E94E 3DB2A 3QEOA 4PS0A 4PYKA 5AJWA 1G18A 4P31A 4R31A 4H5JA 3RNLA 4I1RA 2ZROA 5DM1A 3ZDQA 4KIWA 1HMYA 2NIPA 1RWQA 2PJUA 1E6WA 4QEZA 4Y2RA 1D6MA 4YACA 4C5BA 4BQNA 4AF6A 4QU8A 2BKVA 3L0BA 4LOIA 2VSFA 3KKKA 4XLZA 1QKJA 1GPAA 3CIOA 4IQFA 1G66A 1SWWA 4KDRA 2Q3HA 4GLLA 1MQ8B 3DOUA 4B6GA 2IY7A 4UM9B 5AW2A 3KT3A 4RIGA 3M89A 3LGSA 4YV7A 2Q6IA 2YVLA 1I01A 1XHFA 3PFCA 3ZEAA 3LNCA 5ALQA 4BPRA 3TW8B 4ALKA 4OLJA 4U7HA 4JSPC 4UPDA 4XDGA 5AUNB 2ZRHA 5BNZA 5I6DA 1QKKA 3ONVA 3QLEA 1RM3A 3Q2IA 3OKYA 3Q3HA 5BPHA 2JA1A 3H5WA 1EUQA 3RHSA 4BIMA 4PLVA 4DSAA 2VHXA 1JDPA 3IPCA 1RP7A 2WJZB 3GLIA 3Q3EA 4OB8A 2J0UB 4QFMA 1PEDA 3C3XA 2H14A 4Y2GA 4ZT4A 4UDYX 2VYVA 3DOIA 1ZWLA 1D2MA 3GUVA 2GHIA 5TPZA 2P3QA 3IPRA 3R0JA 2IS4A 1PW7A 5G53C 4L4SA 1P61B 3AR9A 1NV9A 2ONCA 1QH1A 4PX5A 1NKTA 3LT5A 3U4CA 2C31A 2IIQA 3L7OA 1ZUNA 5JCJD 1XZEA 3RS4A 4TXHA 2C7BA 5EMNA 4G24A 1C3EA 3IP3A 5FPYA 3R6DA 2YZMA 4J3NA 4XVRA 2CO0A 3EAGA 4IIXA 5AKGA 2HIGA 3RC1A 1O97D 1PR5A 5LQKA 1MDBA 2R5WA 4O4JF 4D7AA 4L4UA 1X7DA 5CTJA 3CLRC 3PYXA 1U3DA 3KOZA 4DQKA 3UGQA 3M70A 4Z8XA 3MERA 4CCWA 4N5MA 3VH3A 4F71A 1FNBA 3R8XA 4JXXA 3WDMA 4Y1RB 3DR3A 5GM1A 5JCOA 1Z0SA 3SYTA 2JEYA 4MXDA 1ID8A 1ML4A 1YRLA 4MVCA 4G1UC 2CO0C 4JXZA 2HNAA 3TD2A 1U4SA 3SS8A 2HKRA 5BR7A 3IHLA 2I6GA 2O7QA 1H2FA 2W0MA 5T41A 2XRZA 3SE7A 2XWSA 4J82A 1LI5A 1Y3AA 4G8DA 2FMKA 2R6DA 2PRSA 3A14A 4QQRA 5KS2A 2PUDA 4YBZA 5FI5A 5BSRA 1IBMB 3B20A 3X2FA 3IAM1 3LGXA 5L3SB 4RHXA 3SLRA 5BSWA 5D1NA 3KSZO 5A03A 3R9WA 2O8EB 4BNIA 5AR1A 4YCMA 4JT2A 1MN6A 4H1VA 1H4SA 3GG2A 1K27A 2J9FB 3QVVA 5HG0A 4OHZA 3TQHA 5K6AA 3NC1C 3P0EA 4N5DA 3GLGB 1H1DA 3LBIA 2HO4A 4DHWA 2FLWA 2OK8A 1N5MA 2ZE8A 3KCIA 3P9QA 1T4DA 4D02A 3VV2A 2BM0A 1SHTX 2B6HA 2RH5A 3EZGA 3V1MA 4IV8A 3WL6A 1I3NA 4A10A 4AKSA 4IWXA 4Z1OA 4E5KA 1CVIA 5EZYA 4N47A 2JGDA 5LA6B 4JYAB 1CE8B 2B61A 2Q3CA 1JKJA 2AQ8A 3DT6A 3WO1A 3CY6A 5JVDB 4XE5A 4YAUA 2CDBA 5IVDA 3RVRA 2RGRA 3KHSA 1OKKD 1KY2A 3MCTA 4PRZA 4BLQA 5B12A 5TEEA 4GWLA 4UHJA 2Z57A 4ZKEA 4S2UA 3V42A 4TMXA 2IHTA 3B2EA 1HQCA 3C6ZA 4LSZA 3T3MA 3PHHA 4EZEA 4ZOBA 1OWLA 2QVXX 4RF2A 3S5JA 4K46A 4UHDA 1U7WA 1SXPA 4C89A 1VBKA 3JQAA 3ZN2A 1XX6A 4CGYA 4F2WA 5BURA 5FOQA 5HJ7A 1QRAA 2BLNA 4AFNA 3JPXA 2H29A 4M3NA 3UJ7A 3FOCA 4A6XA 4XIIA 1XYYA 1LDEA 4Y98A 4DIKA 3JYHA 3NHFA 1P4AA 3P2KA 3H5VA 4L3VA 4OG2A 1D5WA 2R8OA 1LLDA 1C0LA 1UXIA 2Y1FA 4S1OA 3JQFC 3KZ1E 4OLHA 5AOCA 2BGTA 5BNIA 5JLJA 1XCOA 3L49A 2QI9F 4EKNB 2C92A 4TVKA 4KX5A 3WGJA 4CV0A 1R6AA 2PD4A 4PAOA 1PE0A 3RG2A 3NMUF 3H8JA 1CF2O 1YE3A 1QQAA 3NU1A 3ICQB 1JV2A 1YIAA 1M7BA 3EAQA 5DRTA 3PTZA 5DBEX 2XE4A 1RM0A 4C7BA 1KMNA 1KZ6A 1ZHFA 1VFPA 2H9YA 3QEBZ 4E14A 5IAKA 2ADMA 1EUCA 5CDYA 4LGYA 5AJYA 3ECAA 1GQOA 1K8XB 4B6JA 2LCQA 2PZEA 3OKPA 3O5AA 3A9VA 4Z4IA 4Q7MB 1K08A 4YDRA 1DWUA 1L5KA 4ZDKA 4RNDB 2IF0A 4XARA 5L6MB 3Q8MA 1JL3A 4N65A 3S55A 4EITA 3OC0A 3WNDA 3IAS6 2O6HA 1U2EA 3GUYA 1C7ZA 1R0RE 1X2EA 5G3YA 2JLQA 1S8NA 1OROA 4ILKA 1GRQA 3DULA 4KXQA 4E12A 1BMTA 1PGJA 2IYSA 2ZJOA 2W0SA 3OPMA 4KAAA 5H5JA 3WLHA 3AEQA 2BMEA 1WW2A 5BXYA 2AWNA 1OX6A 3IP5A 2PU7A 1YV9A 4EHIA 5L3QA 4P7KA 4PQGA 4U6NA 5KJCA 3L84A 1Y7TA 3QU7A 2J56H 1XZGA 4G9EA 3IJCA 4U2CA 5CYFA 3NT4A 3LPLA 1J70A 1IM5A 1U65A 2UVQA 4QVKA 4NBKA 5HPYB 1AKEA 1W0JA 3SWWA 1VG1A 5HCNA 4PSXB 3GDOA 4EW1A 4R9NA 2VBGA 3ZWNA 3DDSA 4INJA 1PLKA 1IDN1 2OQRA 2VNIA 1U28A 4O2AF 4QYIA 3FJ1A 4Y0AA 3MKQA 1EDOA 2Q7OE 4WA8A 3BHIA 5IWCA 4DLBA 3O4JA 2EFCB 2ACEA 3BL6A 1U8UA 1GZSA 2H3XA 1OFGA 1XB2A 1Z3IX 2C2BA 4NEGA 3H4IA 3HU1A 1HE4A 4BRWA 3R09A 3CEMA 4WXEA 4CR7A 3ZVKA 2A9RA 2KHZA 5IPFA 3CC8A 4ZQIA 3S99A 1I3OA 1KI4A 1ZG3A 1IAVA 1WKCA 3G9UA 1LEHA 5T6MA 1T3TA 1BC5A 2FTKE 1NLUA 1UXGA 2ON6A 1H4TA 2NSLA 3PC3A 4RC9A 3VJLA 3G88A 1KRXA 1N5LA 1SUAA 1GL3A 2Q2NA 4IKEA 1SK9A 4PR3A 1ZVMA 2J3QA 1WZIA 1GL7A 2V9PA 4JZKA 3F4KA 2GYUA 2Q1SA 2QRLA 1GITA 5LB4A 1E9SA 2XCRB 3Q0TA 4CY3A 2BBWA 1X7GA 3R9XB 1S2MA 1ZK3A 3QKUA 4QOHA 1LV8A 4O4JB 5KZMB 5AVZA 3IULA 4WLNA 1UEJA 1MB0A 3GYBA 4RXMA 5CFQA 3LA6A 3MPOA 1PUIA 4L9AA 1RRFA 2V97A 3OPYB 3UUEA 4C0XA 1IOLA 1KO1A 2VP9A 4Q4LA 4C0HA 4CU5A 2CFCA 1N33B 3MJEA 1QR2A 3F6YA 1Q95A 3KUKA 4NICA 4FFLA 4ZPJA 3S8EA 1GTSA 1FSPA 4UC0A 5ECDA 1CR4A 1ESCA 2OWEA 2ZK7A 4KN5A 2HHAA 4Q3LA 1T6ZA 1X80B 3SXJA 1JECA 2C2GA 4BO7A 3SZOA 1TVKB 2SNIE 2ISQA 1LPSA 4O4HF 2DR2A 1ZIPA 1C7RA 3W6NA 1O6FA 4R3WA 2Y68A 4YX9A 3ZDAA 1XLTA 4MV6A 4X61B 1IHPA 3RE1A 1KU0A 2ILTA 2GT1A 3MN1A 1JHMA 1XYGA 5BP7A 1FLDA 3IC5A 1PT9A 4RSMA 2BZ0A 1ZD3A 2WJ4A 5CDFE 1CG6A 1VL6A 1MMFB 1BFUA 4EEZA 3OQNA 2Q9BA 4XM2A 2YIJA 1FTWA 2H2HA 3AP2A 5HOEA 1MHPA 1RE1A 2YHUA 3QHQA 4HPWA 4J4TA 2F9LA 3IHKA 1MU0A 1CUAA 2BEJA 1T1RA 1J56A 6REQB 1PZXA 2G0NA 2BVNA 4M9RA 3AL8B 1UPAA 1SKAA 1LSUA 5FKSA 1T2AA 2R1VA 3H5NA 3GUZA 3IBTA 4MEBA 4YFVA 3VGPA 3HR7A 1P0FA 1Z39A 4TQAA 5T3YA 3I2HA 1KYXA 3ABZA 3ZVNA 3JQQA 3WIUA 1DAMA 2Q5LA 1EFVA 2H6EA 4GZ8A 3DEKA 3FLAA 3OFVA 3R41A 4G1EA 3EQ2A 1X7WB 4N6GA 2ZUTA 1CNFA 5JFTA 3PI6A 4A7JA 1QFMA 1Z0ZA 2H51A 3UVKA 3S1LA 3FUCA 2V6BA 3GD5A 1RXWA 4WXYB 4J2OA 1WSWA 2VF8A 5IK2D 5THQA 2QHXA 2RGNA 4KVFA 2GCNA 4OL9A 4OQQA 3T4PA 4AZSA 5AW1A 2HN9A 1T8PA 1E9BA 3R6TA 4KE8A 5K0ZA 4V0RA 1HDXA 4Y6SA 3GJ7A 3WHPA 4Z8LA 2CD7A 4C0LA 4Q9DA 1W2HA 1O94A 3IQDB 5GOTA 1JQ3A 2FRDA 4QFBA 5EZSA 4NXNB 4CC9A 2F3PA 2VXCA 4E54A 5FBWB 5DM60 3COVA 2R8PA 3L7JA 3V00A 4DJJA 4E08A 2P6NA 1ADJA 1P6UA 4IMIB 4UUBA 2F6RA 2X8JA 4PGAA 1OFUX 3TZKA 2D0IA 4DZZA 1XN1A 4H7JA 2X2PA 1HQYE 3I2NA 2XVMA 1KFBB 4IVNA 1H2RS 3HJHA 1TL7C 1PR1A 1H0SA 3WLIA 2OA0A 4IJWA 1CLUA 2G08A 4I99A 4NZMA 1JPUA 1VSQA 5B1HA 1AV7A 1YVRA 5FI0B 5GGXA 4KHZA 4ADSG 1M1YE 4KVGA 4YJ2A 2PUAA 3KOUA 4A7PA 1RHQA 3IA7A 1RTTA 1Z74A 3FVQA 4AO6A 2ZQ5A 4UAJA 4YO8A 1RBQA 4OYLA 3CW9A 1BN7A 3K8OE 1U4CA 5M5TA 1MH9A 4LRTB 2DUUA 5JATA 3ABOB 3ISJA 1H69A 1T36B 1FMLA 1W5AA 4I5EA 3DS8A 5DXAA 3W2HA 4CM4B 4WQMA 4ZANA 2XKBA 1OMOA 2JK1A 3FSGA 3LPDA 1NC1A 2BFBB 2PRJA 1R0CA 2H7CA 3DE7X 4DADA 1OAOC 3L4BC 4KQHA 4LXYA 1KK3A 5JDIA 4RABA 3IV6A 3I4LA 5L4SA 1Y81A 1HI9A 3FN4A 1XZPA 1EAYA 3AHHA 2NPFA 4E5SA 2X7JA 4M9QA 3WWDA 3HXQA 3GH3A 5U4XA 4YLGA 5I7WA 5LU9A 2F1IA 3ZQKA 1U3WA 3WBFA 3FGBA 1ZGGA 2RCYA 2BHSA 4I9GA 1P7ZA 2EKDA 5I9MA 5DCLA 3LO8A 3OJOA 4GYYA 1XA3A 1NBOA 5EIBD 1N6RA 1HG1A 1P1FA 4ZVVA 5LCXA 1R4MA 5CH8A 4YYZA 2DF8A 4LWQA 5K05A 1DT3A 4PNEA 1LJ8A 3RRMA 4RZ3A 5EKDA 2P2SA 2PVCA 3KUXA 3SKYA 4Y9SA 5KOIA 1MX9A 5LQJA 4JJ4A 1VLHA 1O9BA 1NLMA 3IALA 2FA9A 1ZCBA 4RF5A 1QOPB 2W37A 2OVRB 9MHTA 5A05A 2XNSA 4Z3OA 1UJ5A 1EE9A 1I32A 2H1SA 4WNIA 4GZ5A 3D4PA 4KIUA 1DJLA 2Y6VA 3G9XA 4HX9A 1OY1A 2F2TA 3SC6A 1MRZA 4MRAA 4L1QD 1IZ8A 4PF1A 5H4GA 4FGZA 5CA1F 1XZMA 2Q5FA 2IUFA 4M0DA 1EK2A 5HF5A 2QN8A 4O2BF 4CR8A 2O5EA 1BQ3A 2DBVO 2AR7A 2X4IA 3OQMA 4XDHA 4J9UE 2XMZA 2G0AA 4NH4A 4YHBA 1ISHA 2QRNA 4MGHA 3M6FA 2WW8A 5DJ5A 1NR5A 7ADHA 4NFYA 4PG6A 1YFQA 2M32A 2F1HA 3I1FA 1XQ6A 4PZDA 2IZ0A 5K0GA 5A3RA 3P5SA 2QB5A 2VTVA 3M5WA 3ORFA 1SHLA 1UKEA 1VJRA 3G5LA 3OC6A 4IDDA 5EJ6A 4JLWA 3D6HA 3G2PA 4D56A 4WJLA 2W48A 4N1AA 1RLIA 1NYTA 1T6YA 4D99A 1PS8A 5IBCA 1EDEA 2B4AA 3DAGA 1HE8B 1K8ZB 4AJ4A 4MYSA 1TZJA 2H31A 2X1LA 3E23A 3GI1A 4R71A 1VDMA 5B6IA 1ELOA 1F8FA 3K1YA 1K8QA 1T3ZA 3GT7A 4P53A 3RBVA 4AJHA 5KVAA 1Z5NA 3OFSA 2OBYA 3LOUA 4BGDA 1GLGA 3PLRA 2O57A 4L4ZA 5FTMA 1QZXA 1DCMA 2PO5A 1AE1A 1TJYA 3HQ4O 4MKXA 1B3BA 2OGTA 2XECA 3LYUA 2Q5OA 3IO3A 2YNNA 1UBUS 4Q1EA 3VZRA 3HR8A 2B7CA 1UOPA 1OX4B 1L3BA 4E30A 4CQMD 2GZ2A 1FW8A 2VUIB 5COBA 4BPBA 1ZIDA 1F6WA 3FGPA 2XYPA 1BCRA