3MUOA

Appep_pepclose+pp closed state
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
684
structure length
684
Chain Sequence
b'LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl endopeptidase
publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
molecule tags Hydrolase/hydrolase inhibitor
total genus 215
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3muoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3muoA01
3B5EA 4UHFA 4NMWA 3R3WA 1YAHA 2G4LA 3C6ZA 4B9AA 1SFRA 3STYA 1QZ3A 4JUIA 4LYEA 5ALVA 2FJ0A 1H2YA 3Q0TA 5JAPA 5JASA 3AILA 2CMFA 3S2ZA 4BZZA 1XKTA 2XUPA 3F9CA 3ZLTA 5A6VA 1DX6A 3RKSA 1SCIA 3OM8A 2WHPA 5ALOA 3KXPA 1HPLA 4KACA 3WKBA 1NU6A 4LKOA 1WOMA 3V1LA 4WFJA 4GEGA 1DU4A 3OPMA 3S8YA 5CXUA 3ICWA 3M81A 4ARBA 3I2GA 4X6YA 2X76A 4KE9A 2JGFA 4DNOA 1QLWA 3EIOA 2ROQA 3N2ZB 1XZAA 2I3DA 3ILSA 1I6WA 3IURA 2Z3WA 3AIMA 3DKRA 4HRXA 5AJHA 2PX6A 3GUUA 2CKMA 2JGLA 3E3AA 4EUSA 4ZWNA 3WK5A 3V1MA 2R8BA 4KRXA 4FLMA 3DOIA 2C0QA 1CUZA 2O7RA 4X7BA 3OTQA 3ESAA 3JW8A 3L1HA 5HF5A 5IVHA 5HF6A 5AM2A 2VJDA 3ZI7A 4P92A 5A71A 5AOAA 1ZIXA 3ZWQA 4EZIA 1QFSA 5FPPA 4EY4A 2WIKA 3HJUA 1LZKA 4MQLA 3C45A 1UXOA 4TGLA 4FMPA 4JYPA 4JH0A 3C43A 4L9AA 4OYLA 3EQ7A 3GELA 1Y37A 1HDEA 1EH5A 1Q0ZA 2PSJA 1EB9A 1UZAA 1T4MA 5IKXA 1O6GA 1QJ4A 1DX4A 4BYMA 1BEZA 3QPAA 1C7JA 1TKRA 2J4FA 5AK6A 3D5EA 3I28A 3IUNA 2GYVA 4G8CA 3HYSA 4I3FA 3WA7A 2W6CX 3HI4A 4QNNA 1A7UA 1MU0A 1CUJA 4Q05A 2WILA 5ALPA 3PUIA 2WSLA 5HZGA 4G9EA 2ZYSA 3UMJA 1U8EA 4KAJA 2VJBA 2I3ZA 1CUWA 5EIEA 1CUIA 3G0CA 1TIBA 1XZMA 2G63A 1ZD4A 4BCCA 4AQDA 2G5PA 2XUQA 3BDVA 4A23A 1MX5A 1YCDA 2QJWA 1F0PA 2QTBA 3BXPA 3FAKA 5ALEA 3FBWA 1TAHA 4G4JA 3CCBA 3KD2A 5ALJA 5K3AA 2Z8ZA 2ZYHA 3WI7A 1TQHA 4C89A 3G02A 2DSNA 3O9VA 1EB8A 1LPAB 1CRLA 2XMGA 5CH3A 4LHEA 4UBOA 3FYTA 5C8VA 1YA4A 4WJLA 5A62A 1J2EA 1EINA 3C8HA 3T4UA 4MQMA 5HF8A 3R41A 3AFIA 5AKXA 3IBTA 2HRRA 3WWOA 3I6MA 4Y9SA 4H35A 5C8XA 1UKCA 4UFPA 1RP1A 4CIAA 2WHPB 4IHAA 5AM1A 3WL6A 3G9UA 4H7FA 4OB6A 1F8UA 4J0DA 3SK0A 1CV2A 3U0VA 4K2AA 5DYYA 4N8DA 3FNBA 1P0MA 1JU3A 5K3FA 4BTLA 5HK8A 4UBNA 3GA7A 2WJ3A 2XMSA 4HXGA 1GT6A 2VATA 4BDSA 4J7AA 1JJIA 4X95A 3WL5A 1JJFA 5ALLA 2LIPA 2QKYA 4BAGA 4KE7A 3H18A 3PF8A 4X90A 4WY8A 1BS9A 4C6HA 3FLBA 4YPVA 1BCRA 4H7JA 1KU6A 3N0TA 2BAGA 5A7FA 3W9BA 2OAGA 1EDEA 1O6FA 3OC0A 5AKIA 3H04A 1C7IA 4H7KA 3VJKA 4X6UA 4FTWA 2XLCA 1UFOA 3AIOA 4HTAA 5K3BA 2QXTA 2WJ4A 4XWGA 5AKKA 3QPDA 4FNGA 5EFZA 5LKAA 4B7ZA 3E4DA 3LIPA 2VAVA 2VQ6A 3VISA 5FUMA 5FLKA 4QA9A 1X2BA 2HA6A 5CBKA 5E2IA 2OGSA 2XUFA 1XKLA 1L7RA 5DYWA 3IA2A 1ACJA 2JGIA 4U2DA 4GWLA 3WKCA 3DJYA 4K6HA 2HL6A 5FKJA 3C6XA 5JARA 3F96A 1LNSA 4BRSA 1L7QA 2H9YA 4DMFA 5LZ2A 1XFDA 2OGZA 2RONA 1EDBA 4L0CA 4CG3A 4CG1A 1ODSA 4UBKA 2GYWA 2PSDA 2V96A 4G8DA 4L3WA 3FLEA 2WIDA 5C8ZA 5AK4A 3H17A 5CW2A 1IZ7A 1AX9A 4Y2SA 1B41A 4FFVA 2VT7A 1GPLA 2WJ6A 4AMYA 1FFEA 3O9MA 4FBLA 1NX9A 3WIOA 1VZ3A 3IUQA 1QOZA 5A7GA 3AIKA 4H18A 3BWXA 3QMWA 2OCKA 4MEBA 4C4ZA 5AK3A 5T4FA 4NS4A 4ETWA 1QIIA 1VXRA 2I03A 3TRDA 3OG9A 1ZICA 2D0DA 1QIKA 2EDCA 3WWDA 1JKMA 1UK6A 1G4HA 5I7UA 3G9XA 5EI5A 2WFMA 4J0IA 1YSCA 3K9BA 4E46A 4M0MA 2DQZA 4DIUA 4QDXA 5ALRA 5AIAA 3WJ1A 5AIBA 4IQ4A 2ORYA 1YR2A 2RAUA 2XQGA 3MUOA 5AOBA 1W52X 1MJ5A 5AP9A 3JYHA 5T4HA 4EY8A 2XUIA 1IVYA 2DR0A 4UHCA 4C87A 4RNCA 3DDUA 5D6OA 1MN6A 1XROA 4H7HA 2PUJA 3O4GA 2EDAA 4UBMA 3UUFA 3IDAA 4ZXFA 5K5EA 2WTMA 3DEAA 5AKZA 4FHZA 3QZUA 1R9NA 1HL7A 5ALHA 2ECFA 5EGNA 3QH4A 2GBCA 2VJAA 4J0JA 1CQWA 4B0OA 2DHEA 2ACKA 3WQHA 4ARAA 3DLTA 3IUMA 4RE5A 4Y2TA 4Y7DA 4Y2YA 2GBFA 5FV4A 4PO3X 1R9MA 4BCDA 1DTEA 4QDUA 1F6WA 3X3HA 4AMZA 5K3FB 4AZ0A 3R0VA 4J0KA 5ALSA 1BEEA 5HQ3A 4HAIA 4H77A 4C4XA 4DYHA 1VOTA 3D2BA 3FOBA 2B20A 4J3JA 2QXUA 3ZLVA 7YASA 3VKFA 1UWCA 1CUYA 1W76A 4Y2RA 3NUZA 3VDXA 4QE3A 4C4YA 5YASA 4LIPD 3FWHA 5HF9A 3L1IA 1ODTC 1HLGA 4B82A 4FWBA 1QIMA 1YAJA 4DSZA 4FLEA 1TCCA 2CJPA 1LPMA 3V48A 1XQVA 1K4YA 5ALMA 2YXPX 4Y2PA 1XZJA 3G0BA 2RHTA 2Q0XA 1TRHA 5AOCA 5E4TA 1ZIYA 3O0DA 1TCAA 5HFNA 1D07A 3VVMA 2O2GA 2QR5A 2ZSIA 1SC9A 4DMKA 3RM3A 3FYUC 4BVKA 2BUBA 1JMKC 1TCBA 5I9IA 1THTA 3EBLA 4PSDA 2GYUA 1MX9A 2OAEA 4OU4A 4ZV9A 1EK2A 1CUFA 4NVRA 1BROA 4PSUA 5FPQA 1BN6A 3Q8WA 5JD4A 3F97A 1XRNA 2Z5GA 1C4XA 4A16A 3WKDA 2YASA 5LKRA 4QWMA 4UBJA 1E8MA 3I2HA 4HS9A 4J0GA 3VXKA 4DLNA 1G42A 5HCUA 5AM4A 2OPHA 5HFAA 1WHSA 4OPMA 3I1IA 4UUQA 2XUOA 2XDWA 1E8NA 4EY7A 3WIBA 1CUEA 1MX1A 1XQWA 4PSCA 4BTVA 2IIVA 3ZV7A 1QE3A 1LPOA 1GPNA 5D3KA 5CT9A 1A8QA 1WPRA 4Y2JA 2X8BA 4BE9A 3TEJA 2HADA 3W04A 1QIJA 1LBTA 1UK9A 1Q0RA 5ALYA 5ALNA 1PJAA 3C5VA 4U2GA 3AINA 1MAHA 4ZGBA 3PI6A 3R3UA 5BOVA 3ESCA 2WUDA 3VJMA 2OCIA 5EIHA 1FFCA 4EY5A 4OB8A 5FXMA 1CUUA 1ZI6A 3W9UA 4KEAA 5AO9A 1LPSA 2HA2A 5K3CA 3HC7A 4X3CA 1K63A 4Q3OA 3FVRA 1XRMA 2QUBA 2C7BA 2XMBA 4W1RA 5AI4A 3STTA 1E3QA 4MYSA 2QRUA 5DNUA 1BRTA 1UOPA 2IITA 4A5SA 2O2HA 5JIBA 4K5QA 1N8SA 4JEIA 2V9ZA 2XQIA 3MUNA 4F60A 2VAXA 5CXXA 4Y2XA 5HQ3B 2HA4A 4H7EA 1VA5A 4C01A 4BBZA 4CCWA 1WCYA 3FSGA 4DGQA 1BCSA 5EIAA 2WIFA 3DL4A 1H2WA 3MGAA 5DJ5A 4E11A 3QVMA 4INZA 2BCEA 3V1NA 3C6BA 2XUGA 4U2CA 2O7VA 1LLFA 3GBSA 5LLSA 4AO6A 5LZ8A 1K8QA 2V97A 1WB5A 1CUXA 1ISPA 3CN7A 5IVKA 3R3YA 2JEZA 3LP5A 3V9AA 5ALWA 2D5LA 5LZ7A 3A2LA 3NGMA 3ANTA 2HDWA 3BDIA 3WK9A 5JD6A 1CUSA 2PKYX 2ZJ7A 3STWA 1EVEA 2P8SA 1CVLA 3O4HA 3R3XA 5AKJA 4B9EA 4C88A 1VZ2A 2AJLI 1P0IA 3CXUA 2QZPA 3QMMA 2OGTA 4OD0A 1YS1X 2ACEA 2ES4A 2VEOA 1F0NA 1IZ8A 1ZJ5A 4X97A 1ZI8A 1LZLA 4XX1A 1ORVA 3HRHA 4AX4A 2XE4A 1USWA 3HEAA 3FCYA 4M0FA 3QPCA 1AMNA 3RK4A 3E1GA 1ZD3A 2QUAA 3KSRA 4ZREA 5ALZA 5ESRA 4N5HX 3HABA 2VF2A 2JEYA 2QVBA 3H1AA 4GI1A 5DTJA 3DNMA 2WLSA 5T4BA 2PSFA 4G5XA 3WK6A 1H2XA 1QTRA 3PDCA 5AICA 3F67A 3BL8A 2IX9A 1R88A 3YASA 2AJ8A 3G0DA 5AI6A 4Y2QA 5EHQA 2AXEA 4KJXA 5ISMA 4CFSA 5JZBA 1XZIA 1JT2A 1JMYA 4GBGA 5DYTA 1FSSA 5CH5A 4X71A 1U4NA 3DCNA 4BP9A 1CLEA 2DHCA 1QIHA 1UOQA 2FJPA 2WQZA 2Y2UA 5JZ9A 1S8OA 3I6ZA 4BAUA 1XQXA 3A70A 4HXEB 4X91A 1J06A 1U65A 4FDMA 1CUDA 2Y1KA 1GPKA 2CBGA 1KEZA 4CCYB 2WU4A 4V2IA 4W63A 3V1KA 5BWCA 4QEKA 4Q82A 3FYUB 4N8SA 3D2AA 4HZGA 5CT6A 2PPLA 1WB6A 2QT9A 3EQ9A 2XQFA 2JGJA 1QGED 5T4EA 4BDTA 1EXWA 1CIJA 1FJ2A 2Z8XA 4DNQA 3GFFA 4BB0A 3H2GA 3I2IA 4XVCA 3WWPA 1DQZA 3H2IA 3TJMA 3HSSA 4WFIA 2HIHA 3BJRA 4KAAA 1UKBA 2I78A 1E5TA 4F0JA 2W22A 1YASA 4OU5A 1VJ5A 4YX9A 5ALDA 1WPXA 4OB7A 3F8SA 1GQSA 2PL5A 2HA3A 5AKLA 2BGRA 4H7DA 3BE8A 3F98A 4XIIA 5AM0A 5AI0A 3STUA 1K5PA 4FKBA 1DWOA 1MTZA 5LZ5A 2C5FA 4EY6A 6YASA 1CPYA 1A88A 1AURA 3L1JA 5EHZA 4K6KA 3UUEA 3HXKA 1FFDA 4G4IA 1DWPA 2QS9A 5AI9A 3G0IA 1XZHA 2HA5A 3WL7A 4I4CA 5SYMA 2XB6A 2OQIA 1MPXA 1DT3A 3D7RA 1H22A 1JFRA 4L72A 3WKEA 3DL7A 1GZ7A 4JNCA 1QIFA 3D59A 1QIDA 1Q84A 3WZLA 3B12A 2K2QB 3WA6A 3LS2A 4PW0A 5CRIA 2Y6UA 5K3EA 4BATA 4P08A 2OLEA 2C4HA 3BF7A 5HKBA 3C6YA 4B0PA 4WCVA 4LXIA 2Y2VA 5I8PA 2WFLB 2WG1A 3ESBA 4DSAA 3BJMA 2VTVA 3DD5A 1ZD2P 3C8DA 4BC1A 4CIBA 3R3VA 3C5WP 5H3HA 1QO7A 3FVTA 4MWSA 4FNMA 3ED1A 1QO9A 3W06A 4BVLA 2WTNA 3LIIA 3W05A 5JAOA 4AN0A 1A8UA 4IH1A 3ESDA 1CUGA 1G66A 1MNAA 4P93A 3JWEA 3PE6A 1K6EA 2Z3ZA 1YB6A 1TK3A 4GLBA 4F5ZA 3K2IA 1GXSA 4MEAA 2DHDA 4RPCA 3DQZA 1JU4A 5A2GA 3A2MA 2WUFA 2EEPA 4W1SA 2RI6A 2ONCA 1EVQA 1OILA 3KDAA 4BE4A 5ALXA 5AI8A 1Y7IA 3MVEA 1CEXA 2CB9A 3A2NA 5FOQA 4X00A 4RGYA 3IUJA 1XLVA 4UBIA 5HK9A 2HU5A 1ORWA 2X5XA 5CTAA 4XJVA 1XZBA 3HZOA 1DQYA 3WYNA 2C58A 5AKHA 3QMVA 1M33A 3RLIA 2V98A 3TGLA 1WB4A 3BIXA 5IVIA 1P0PA 1J1IA 4WY5A 2PU5A 3D2CA 4N8EA 2Y6VA 5JZSA 5BWBA 1HKHA 1QTIA 2VSQA 1VE7A 4OYYA 4B6GA 1LPBB 2XMCA 3WL8A 4AB1A 1MO2A 3I1YA 1OXMA 2BKLA 2XQJA 4FLFA 4X92A 3AZQA 3E0XA 3GZJA 3DKKA 4BZWA 2JGMA 2B9VA 1XZCA 3DOHA 1Z68A 1RYYA 1LPNA 1L7AA 3QYJA 2XUJA 1SCKA 3M82A 2HHAA 4IO0A 3LCRA 2BFNA 2GZRA 2PM8A 2OCGA 1CUCA 3R40A 2GZSA 4ITVA 5JANA 3LLCA 2WIJA 3ZLUA 4G4GA 4I19A 2XMRA 1E8DA 2WU3A 2WKWA 2PVSA 1THGA 1DT5A 2J3DA 5C81A 4AXBA 5JD5A 1CUAA 2RIPA 3NOXA 2VA9A 2VJCA 2ZJ6A 1PV1A 1LPPA 1XZEA 3OOSA 1ETHA 4MYDA 3I6YA 2YYSA 5ALFA 1VE6A 3KWFA 1XLWA 3O4IA 4X94A 2OCLA 4QDOA 4UBLA 3HACA 2CZQA 4JYMA 3BIWA 3WK7A 5AM5A 2XI4A 3I2JA 4LXGA 3AZOA 4CCYA 5JADA 2YH2A 4W1QA 1BE0A 3FYUA 1IUPA 1NU8A 3M83A 2OG1A 4UPDA 4HVTA 4DNFA 4FOLA 2DQYA 4WFKA 3H2KA 1ZJ4A 2XUKA 5AI5A 1GQRA 5DTIA 1BU8A 1SCQA 2H1IA 3WMRA 4DMCA 3FCXA 2JGEA 5E4JA 2QM0A 2O2IA 5KWJA 1QFMA 1R50A 4GDMA 1EX9A 1X70A 2H7XA 4UHEA 1IMJA 3I2KA 2WHRA 4BVJA 3P2MA 2J4CA 1UOOA 4KRYA 4U2EA 3D0KA 5FP0A 4Y2VA 3WWCA 3M3DA 2B4KA 1N1MA 1N5RA 1U2EA 1N5MA 4DM7A 1QIGA 2C5GA 4KE6A 4UHHA 4TVKA 2C0PA 2JF0A 4EB0A 2XT0A 1IUNA 3WK4A 2BUCA 3STVA 2HU8A 5JYCA 4G9GA 2XMQA 3PICA 3KWJA 1BN7A 1J07A 4ZI5A 2WUEA 1VLQA 1ZGCA 5ALKA 4W9RA 2CUTA 1EHYA 1MNQA 2WG2A 5LP1A 2DCMA 2WM2A 2E3JA 3DYVA 2XQKA 3WKAA 2JGKA 4DTCA 4RE6A 4BRZA 2XUHA 2HU7A 4U2BA 3O95A 1JJBA 4PQEA 1SOMA 3DYIA 5LZ9A 3NWOA 1QIEA 5DWDA 1UK7A 3PFBA 1G5FA 4YASA 2H7CA 4ROTA 4DMHA 1W4LA 1XRRA 3VJLA 5KWIA 5ALUA 4Y2UA 4GHWA 1LBSA 1PFQA 4UFOA 2J3QA 4X85A 4QLAA 1XZLA 4Q3LA 3G8YA 5IVDA 3PUHA 3IIIA 1RWQA 1IUOA 1H2ZA 2OXEA 2WFLA 4KAFA 1UKAA 1H23A 4UFNA 1CQZA 1YS2X 5EHNA 4G1FA 2QOEA 5K3DA 5CMLA 3SC2A 4BC0A 2AJBA 5AKYA 1A8SA 1R4ZA 3G0GA 4OCZA 4AN1A 3IULA 2G5TA 2HFJA 1XRPA 2ZSHA 5F4ZA 1DINA 3AJAA 1T2NA 4MJ3A 2QJRA 1W75A 4OUKX 2HA7A 4EBBA 3C87A 1CFJA 2OQVA 1YA8A 3IB3A 5AM3A 5CT5A 1B6GA 4UHBA 4QDZA 4U2FA 3PFCA 1ZOIA 1EDDA 4LYDA 1KU0A 4QDTA 4AZ3A 1EK1A 4QWWA 2WFZA 1VXOA 2ZVDA 3U1TA 4AO7A 5D3ZA 1XZGA 3WYDA 1UK8A 3QM1A 2GBIA 2R11A 5DLPA 2RGUA 4IH4A 4E14A 4BAZA 4KE8A 1GGVA 2PBLA 3STXA 4CI9A 4M0EA 3W2TA 1W1IA 4KR0A 1ZGBA 5CT8A 5LZ4A 2NW6A 2PU7A 4K6GA 1HBJA 3H1BA 5KBYA 3QITA 1WM1A 3H2JA 1VA4A 5SYNA 3HLKA 4GXNA 4FBMA 3CN9A 1AC5A 4CG2A 3D4LA 2QMQA 4Q1VA 5FDFA 3WLAA 4J03A 3FSGD 4H0CA 1MT3A 4Z49A 4PF1A 5AKEA 4QZVA 1LGYA 2AJCA 4B84A 1XQYA 3WK8A 4PNZA 4HRYA 4YK7A 3AZPA 5D7BA 3O4JA 3T52A 2HA0A 3SWWA 1R1DA 3G7NA 1R3DA 1XZKA 4ZRDA 2WHQA 3C70A 1GKLA 3PF9A 3WWEA 2FX5A 2PSEA 2JIDA 4W1PA 5J3JA 1Y7HA 3FLAA 2DFPA 5ALGA 3WJ2A 2PSHA 2AJDA 3KOOA 5CT4A 3CCCA 4FFWA 2PUHA 4Q3KA 3B3QA 4GW3A 3R3ZA 2CEKA 1Q83A 4G8BA 5A7HA 3K6KA 4B83A 5AHXA 1HQDA 5KREA 5EHXA 5ALQA 1MAAA 2ZYIA 2FUKA 4QLOA 5AH0A 1CUVA 5AK5A 3SX4A 4X6XA 1GKKA 3G9TA 2RHWA 2BUAA 4B81A 5AKGA 3D3NA 5JALA 1DWQA 2XMZA 5LYYA 5LIPA 5IH7A 3I2FA 2XMDA 3EF3A 2HRQA 3ZPXA 5CURA 5HKAA 4O08A 2HM7A 2BGNA 1UT6A 4EA6A 1W6RA 2XLBA 1AUOA 1XZDA 2UZ0A 5CH8A 5ALTA 1XZFA 4H7IA 3QBJA 1ZI9A 1AQLA 4AO8A 5JAHA 4N5IX 1VKHA 5C7YA 3DS8A 3BF8A 3WZMA 1ODCA 4WDQA 2BJHA 1AKNA 1AGYA 2WUGA 5E4YA 4UHDA 4F21A 1QONA 3A6ZA 2VT6A 1JI3A 1WHTA 4BCBA 4S0XA 4J0CA 4GECA 1CUBA 4D9JA 1YB7A 4Q34A 1ACLA 2HFKA 5FRDA 5DNVA 4ZV7A 4P9NA 3VVLA 5ALIA 4PV7A 2WG0A 1E89A 2ZJFA 4BP8A 1FFAA 1CUHA 1E66A 2ZYRA 4KYVA 4B80A 4OSEA 1XLUA 2JBWA 5JATA 1XRLA 1AZWA 4X93A 4DNPA 4IH9A 4MXDA 3AUKA 1XRQA 1FFBA 4J0HA 3RARA 4TPKA 4MWTA 4B85A 5JAUA 2XUAA 1P0QA 4WDRA 3ICVA 5DNWA 1CR6A 3H2HA 2WIGA 3H0CA 1EA5A 4HXFB 5BV7A 3EQ8A 2B61A 3ANSA 2GBGA 4EHBA 2H7YA 3G9ZA 2XUDA 1X2EA 3GROA 1EI9A 3H19A 1OCEA 4NZZA 3OURA 3IVMA 4E15A 4LXHA 1ZD5A
chains in the Genus database with same CATH superfamily
2XRYA 3T38A 5KQLA 3U6KA 1JWBB 1BJTA 5ES4B 2D8MA 2GRUA 1SCDA 1YZVA 2C7GA 3EK2A 4R3WA 2NMVA 3G2LA 2CMFA 3NI2A 1W44A 4QBFA 2Q3MA 4Y9TA 4B3FX 2H9PA 3ZLTA 1CQJA 5FOSA 4D9KA 3KXPA 3LX6A 3AEKA 5JYBA 4BHTA 1ZM4A 5C5IA 3AR5A 3OZRA 4GXRA 3OTGA 1KDVA 2OXTA 2I3DA 3PUXA 3TPZA 3GRYA 4HRXA 4AYWA 2EP7A 3OIYA 4FLMA 5B53A 2D2IA 4RGBA 2ZR8A 4ND8B 1UIMA 5AHRA 4LX0A 2Q29A 2QRHA 2JH8A 3OQJA 4FIDA 5KB3A 1Y1RA 3M6XA 3JW8A 1UL1X 4S1PA 3I04A 1GIAA 2VH2A 3DZ8A 3LBYA 3TX2A 4MHTA 1YMUA 3SQWA 1XLTA 2WZQA 4YJHB 2GAIA 4EZIA 4JZYA 1LBHA 3K5WA 2JCVA 4OJQA 3PQDA 2HMVA 3C45A 1Y5NA 3MCAA 4UNRA 4RGVA 4ENVA 4O33A 3RV4A 4TKMA 1UZAA 1EUYA 3GEPA 1JG4A 3RT9A 2D62A 2BR3A 2O3TA 3UG7A 4MR9A 4G8CA 3ORHA 4I3FA 2ZTVA 4O3FA 3T5TA 4R2LA 2VP9A 5TV2A 2WM8A 4JI5B 4XIGS 4CV0A 4JC4A 1D2CA 4E5DA 4CM5A 3T5AA 1A72A 1AKWA 1E58A 4YPFA 4IZIA 4AJJA 1K08A 1DOHA 4TZ6A 3L4BC 1GUDA 3LUBA 3RDPA 2F3SA 3WLJA 4AVYA 3WFZA 3BWDD 2K5UA 4KR7A 3CE9A 4JI7B 3WYEA 1V1MB 5FOXA 5AW5A 4EJMA 4IMMA 5TX7A 3GCDA 4G0UA 2X9QA 1T0JB 4B46A 5TIIA 5JCJD 3HBLA 4WJLA 2Z30A 1EINA 2PV0A 2LKDA 4OXKA 3HLTA 1WNTA 1Z4IA 3A9WA 3I5AA 1LTKA 1DCTA 4BQFA 3RTAA 4Z4FA 1Q21A 4WLNA 4MIKA 5C8XA 1X15A 3UCFA 4OOEA 3ESYA 2X13A 4H7FA 1AUXA 1EIWA 3SICE 3U0VA 4MW9A 2P1RA 1UMDB 2J6IA 1JU3A 5KTMA 4OIMA 2OTCA 1A9TA 1NUHA 3OEEA 1KSFX 3V33A 1DCMA 2HWUA 3WL5A 3E8MA 5HCNA 4BQPA 4LNUA 3CRRA 2IHJA 4BAGA 2ATVA 3H18A 2A2ZA 1NHGA 1KEUA 4P7GA 2CDCA 4REMA 7MHTA 2YV4A 1GG8A 3MFQA 2EX0A 4MO9A 5AKIA 3AU9A 1C7IA 1QQ5A 3OU7A 3PDIA 3AY3A 3KJGA 3PQ6A 2IV2X 2YNMA 2IL1A 1E1NA 4XWGA 5KC9A 1JAHA 2I34A 3IQDB 2N1BA 5FLKA 4JOCA 3T41A 1WPGA 3DJYA 1M34A 5I7RA 2FPMA 1MO5A 1YI1A 4EHJA 1SZJG 2DFDA 4CG1A 1NQWA 2QPLA 1E9SA 2I2DA 1U5BA 2JJ2A 3U1BA 1A9XB 1QHSA 5A4IS 3K7EA 3CRMA 5HFJA 4L8GA 1FLVA 2RGEA 2VT7A 2PZMA 3CX4A 1Z6QA 2HSJA 2Q27A 4E1AA 1C1XB 1G6OA 5HA5A 1ZBQA 1O96B 3KT3A 2HPVA 2Q49A 4L22A 2VHEA 4J79A 3W9YA 4YRNA 2IHUA 1IJKA 1PHRA 3AFMA 5H0IA 3AGQA 2FPKA 2XQGA 3TNYA 4TXHA 5AOBA 4X41A 3ULEC 2OSBA 2BKVA 3O3MB 5J4HA 1S3SA 4DR5B 2ISSD 1WWKA 3KSUA 5D6OA 1QDUA 1A8IA 1OFIA 1DWUA 1ZLXA 1JLRA 2W6NA 4GOOD 5A0FA 3MJDA 1TQ2A 3T3OA 2ZSDA 3NEPX 1RJDA 4M86A 4LG8A 1V2HE 2ZPAA 1SC4A 1X8JA 1DJNA 2D1QA 3TDNA 1HL7A 3HA3A 4PLHA 4C7OB 2VJAA 1VKOA 1CQWA 5K0JA 4MAAA 1CYDA 1FRQA 3UH0A 3TFOA 1LBQA 2FPUA 3DVAB 1WBBA 5JNVA 2JIMA 4B33A 3DEIA 5ALSA 4PU0A 3IAAA 4XQ0A 3MD9A 1E3JA 4QNRA 5D5HA 4ZAZA 3ND5A 2W0SA 2R4QA 5DT9A 1LSUA 1GNPA 5JY6A 2XDQB 5AW8A 5HX7A 4M60A 4NOKA 1JILA 3ROFA 1EP9A 1NN3A 4HEA6 1LTHR 5PNTA 1TCAA 3PUVA 4TWRA 1ECFA 3VPBA 1TT5B 1VL0A 2ZSIA 1NBHA 1HQCA 3PQFA 4CTOA 2PJUA 1APBA 4DLVA 5M3BA 3JQ8A 3KPJA 4IVRA 1YJ8A 4ZFNA 2EXXA 1NLFA 1C4XA 4NYIR 2QRLA 5HQTA 5I7HA 1E8MA 3VHRA 3ZDDA 2ZDQA 3BSFA 3W5HA 1OU4A 5CFLA 5CPFA 4BJ5A 1P4GA 5AT1A 2H1OA 2XDWA 1QHNA 3OICA 3GT7A 3ZWKA 2H6KA 3ZXXA 3PIRA 1NJ5A 2JJ8A 2QL7A 2I0SA 1QPGA 2W00A 2ZVQX 2KI5A 3K30A 3VYTB 3KG2A 2RGYA 2VS1A 1YZ3A 4F3CA 5JEDA 1ODJA 3DP7A 3AINA 1N2HA 2QTVA 1N0UA 1RYFA 3U3JA 2EF1A 5KHAA 4O2RA 5C3MA 3QK7A 2FTKE 1I4DD 3ZXUB 2F1HA 3BWYA 1QR6A 4D9IA 3H9QA 2C4NA 5C18A 4YI5A 1EVIA 4KZKA 4P53A 1OI2A 1ESDA 2Z6VA 2L82A 3EOZA 3S5UA 4PNPA 2XQIA 4OM8A 4JI6B 1UBGA 4QAQA 1T3SA 1JLHA 1Z7GA 1OHHD 3KQHA 2NU7A 1QDEA 3L9XA 3L8CA 2OLKA 1YKGA 4TUYB 3GVXA 4U2CA 3RO7A 1V0JA 4D3XA 5BUQA 2NO5A 2L2QA 3AOEC 4HO1X 3V6LA 3NORA 2GR9A 3FCEA 2C29D 3CMCO 3ADPA 5I9BA 3LP5A 4QG7A 1V5GA 3ZE7A 4EELA 2H51A 2OD7A 5F5LA 3N8GA 1T3ZA 1BWRA 3RC9A 4D4MA 3F74A 1CVLA 1QS0A 1L5RA 5B58C 4UJ5A 3L7CA 5HS6A 2BY4A 3QMMA 1RD4A 1Y9JA 1HNWB 3ENWA 2BI7A 4PN3A 2Q6TA 4R3NA 3K0EA 5EEHA 3DVQX 3OZUA 1WMDA 3T3EA 1VYUA 4YJFA 1RIIA 2W6PA 2MJLA 2RGBA 3W5SA 4L95C 3BGWA 4KQFA 3UOWA 4NCHA 2FRXA 1WCWA 1Q3KA 3G8AA 2CKDA 2PSFA 4JYAB 5HKLA 1U3TA 1R88A 2RSLA 4MKHA 3S28A 1LUAA 4CFSA 4QRJA 4MVWA 5C37A 2ZWPA 3WGKA 3D8SA 3E0CA 2HQRA 2WB4A 4YCBA 4ZRNA 2C2BA 2XNCA 1V8BA 3QE3A 3PGXA 1PJBA 1TF7A 1SZCA 1POWA 2IYZA 3DLBA 3BN3A 4P22A 2PH1A 3FSJX 3EFBA 2WYOA 1T2DA 4RMGA 1U1CA 4GG1A 3WJAA 2XWPA 4D9HA 3BBPA 4PZYA 4BDTA 3CZ4A 4J43A 1Z6AA 3DKVA 1VG9B 3T5DA 4BZXA 4ZEOA 4F85A 2PR2A 1JB9A 3CUEF 2PAAA 4IGAA 1HY3A 3VR4H 3U26A 4BNUA 3CLKA 2JFFA 1WXXA 4KXVA 2Z2KA 2O8NA 4OU5A 3FWYA 1L8XA 3SJCA 1TMYA 2XDAA 4F2DA 1CE8A 4XEIC 1XCLA 4X1IB 5FIUA 3FLMA 3ILHA 1GV1A 5LZ5A 3CB2A 5L95A 3M4JA 6YASA 3IJPA 3R7NA 1PV4A 1Y8QB 1KY2A 5THAA 1RE1A 1SAYA 5TXGA 1U1IA 4YJGB 2OQIA 2P90A 1OXVA 2WTEA 3M70A 2HKIA 4U7HA 1B6SA 3OM1A 4CLEA 2YDYA 1FFXA 5HSGA 4PHHA 2H85A 3FWNA 2YNNA 4ZU3A 2GK4A 4X20A 1E2KA 1B43A 5DCYA 3RW9A 1I4TD 2FEOA 4UU1A 4JHPC 3JD4A 2B5WA 1VSUA 1PNTA 1WP4A 1IWBB 1TQ8A 2LWIA 2IHYA 1UKVY 4V02A 3W90A 2YRWA 1Z5VA 3QHAA 1A8UA 1QHXA 3OFND 1KFCB 4IH1A 1QZXA 1U2QA 3QVOA 1L5ZA 3FPHA 2NNWB 2M6LA 1A4IA 4J87A 1O9GA 1J8FA 3A6DA 3NC1C 1JQAA 3BMNA 3DD1A 2WC1A 3M5PA 3RYIA 4N65A 1Z5OA 1Y7IA 1YQWA 5HR5A 1O9HA 1RRVA 1I2BA 2RCYA 3IUJA 4UBIA 5CXCB 3G7UA 1JHOA 2GARA 1EUDB 2JRLA 4RENA 2RH8A 1K5GA 2C54A 1G1MA 4A8TA 1LSSA 4MICA 3GLRA 4RHCA 2HXGA 3IV6A 4XM1A 1WB4A 4X60A 2HRBA 5IT9g 2Y4OA 1NMXA 4LRQA 1H93A 3ZGZA 2X8JA 2Y6VA 5FO0A 4JC0A 3A7EA 4P84A 5A1TA 3U3RA 1I3OA 4AJLA 2VUSA 3F6RA 3MIIA 4HQLA 1WQ3A 3PYXA 3E05A 4B6EA 3C5MA 4YACA 3RSSA 4HDQB 3ENKA 2JHFA 4RKEA 3TQSA 4QX6A 1RYYA 3QYJA 1TM5E 1Z6PA 2VTBA 4E2YA 2HUNA 4LWQA 1T5HX 2A14A 4FJ2A 5CLLA 3BERA 3RRYA 3DEYX 1E8DA 3PGVA 2PGDA 4G9BA 1OR8A 3JQGA 3FYSA 2YJ4A 2C2KA 2GEKA 3QOFA 1NYTA 5FKSA 2EATA 2G99A 3OHPA 2IT1A 5HM8A 3LV8A 1F9AA 4HGYA 3DAOA 1BGWA 2GM9A 2BMJA 2CZQA 1GTL1 1DJLA 4ZOQI 3ACCA 2FQXA 1DJMA 1EMDA 2DQYA 3BWEA 3I8SA 5B1DA 1BG6A 4D6YA 3OFJA 1X14A 2XUKA 5AMSA 1Z28A 1NXOA 2OCPA 4UU7A 1UODA 1X7HA 3C3PA 4UE3S 1W5EA 3UATA 2O2IA 4Q4JB 1KDTA 2FVXA 5DYNA 2RAFA 1BHO1 3I2KA 4KPGA 3D1VA 4MRRA 1GZHB 1FFWA 5E2BA 3TTVA 4BZQA 3PGKA 2JBAB 1RXCA 3B89A 2II6A 1U2EA 5FA8A 4H15A 3MF4A 4GLFA 4DM7A 3ELWA 5JCOC 4CY2A 3CZ5A 4ERXA 1XEWX 3L7DA 3WK4A 1Q16A 3P8ZA 5G3ZA 1ZL0A 1BN7A 4XCVA 1QMGA 3WKAA 5AJAA 2NACA 5ECWA 4XYIA 1WU8A 4C29A 1WD7A 5HJ2A 5TF4A 1U9IA 1X1CA 3NHLA 3QFCA 2MSWA 5E6SB 2VO1A 1T2CA 1UK7A 1KGSA 4ZCQA 1BA3A 1SKAA 1U7UA 3K0BA 1WU7A 1OTYA 4OGFA 1L1QA 4NYJQ 2J3QA 2HJHA 3A4IA 2BR4A 1Z07A 1H2ZA 2WFLA 2N75A 2OZLA 5K4AA 3KVRA 4CM6A 2AE1A 2G71A 4PC6A 2XAUA 1JEQA 4BQNA 2FUCA 2JI8A 1HX7A 4ZVRA 4YCAA 5IC7A 2Q99A 4BMOB 2PZAA 4CIDA 2PT7A 4D0NA 4Z9FA 4H0FA 5I01A 2A9PA 5EKTA 4EBBA 8ATCA 3UKRC 1DEOA 2VP3A 1XALA 2YZMA 4L51A 4TWJA 5CT5A 5DP2A 3QTLA 2CLDX 1KOJA 4UHBA 4QDZA 1FPMA 3MWEB 1BH6A 2YXBA 5FI3A 1GXRA 3EN0A 4J81A 4Q3DA 2AN5A 3K0SA 1SPXA 4BGEA 5K0CA 4WVFA 3I39X 2J33A 4O5AA 4CQJA 5FTWA 2O3JA 1NP6A 4IH4A 2VDNB 4JA0A 3K15A 1KPHA 2QENA 1PO7A 2I6GA 4MVJF 1W5BA 4M1ZA 4ZJPA 2QN9A 1ZG3A 4L75A 1JHQA 2FRVA 4ZEVA 5F21A 2FPLA 4FUQA 2XADA 3H2JA 3FR8A 2HW8A 3LVFO 3HLKA 5MGNA 2G6TA 3GZTB 5KNDA 3KS9A 5DSXA 3REQB 3GT3A 2ZW9A 3Q7PA 2AJCA 2VAPA 4B87A 4BX9A 3D6MA 2QD2A 1PW5A 3HHPA 2YTZA 3U4IA 1L5GA 1V2GA 4PIVA 2TS1A 1WTCA 4L2IA 1QGYA 4C0HA 4F8EA 2EG5A 3BXFA 1NUQA 3C70A 1GKLA 2KHZA 4A91A 1U0LA 3T9EA 4E5NA 4FGSA 2BBOA 1EEXB 5A5FA 1NBIA 2OMEA 4MOWA 1GCGA 4O2BB 1Q83A 1E4OA 1U9ZA 4IJMA 5J5AA 4QPCA 1V3TA 1WZ2A 3LAWA 4PLVA 4CPDA 1DFGA 3EXG2 3WLMA 4XR4A 2YZNA 3I23A 3JSXA 3RHTA 4TTVA 2OBBA 5IT9A 3AR7A 1YIDA 3M6WA 5IARA 3I2FA 2XZTA 1MEEA 3QVVA 4ZYZA 1CS0A 3ZPXA 3MUEA 4CIYA 3DE6X 3V97A 2HT1A 3GH1A 4RSMA 1XYGA 2G40A 1AUOA 5KJ6A 2FUNB 3ENQA 1MVOA 2OZPA 2VNJA 1A76A 1BFDA 4JQZA 2GCEA 3FR7A 4KRFA 1BMFD 1FCJA 3NEJA 1TEVA 2BL4A 5FBWB 2WPNA 4CLDA 4E54A 1A12A 3QOYA 1AHIA 1WHTA 3OUZA 4E03A 1R16A 4YECA 4DEVA 4H59A 3UGQA 3VVLA 5ALIA 3WIEA 2WG0A 3U4DA 3JQDA 1JSLA 4R1NA 5DT2A 3FPLA 1TU3A 3W2IA 3NYIA 5JATA 4Z4EA 4EHIA 4WNCA 3W5BA 4E30A 4EJ6A 4DJ5X 3FJOA 4MWTA 2ID9A 4HTFB 2CY0A 4URHA 5JAUA 3K1JA 3IMCA 4C2AA 2FNAA 4PFSA 3WQBA 3UT6A 1KZ6A 3WLLA 1XDZA 4M1TA 2AOXA 3AQIA 1X2EA 3KEGA 1L1EA 2GS9A 1OWMA 5IF3A 1TM1E 5EG5A 4KO1S 2J9XB 1LNZA 2G4LA 3CTMA 4LMAA 2VLBA 3EVZA 1UJ4A 2P5TB 2IYWA 5TQ0B 2NUTA 1YZFA 1H2YA 1P6XA 3Q0TA 4FN4A 1FUUA 3COSA 4ZVUA 5LB2A 3ROGA 2ZYTX 4M21A 3LF2A 2I6UA 3KJZA 1TZJA 4D57A 1TYZA 4XSVA 2AI1A 5CCEA 3D0OA 3JAKA 2YYYA 1HR0B 1ISRA 4TTAA 3RVPA 1EU1A 3ITKA 1NX6A 3FMPB 2G9VA 2Y05A 1CVRA 4JX8A 4QAJA 1NXVA 1PL7A 2A9OA 5T6MA 3H7AA 5AUOB 3NU1A 3P9IA 2JVKA 3P2IA 2IXFA 2IEAA 3IUPA 2A8YA 1CKEA 1F7VA 5BMVB 1KYZA 2OCYC 1N8NA 5TR9A 3IXQA 3L1HA 3M7IA 3I0ZA 5HF6A 4DKXA 3GARA 3I04M 4PBTA 2JJQA 2QGFA 1U94A 3VNAA 3LBAA 4EY4A 4ITUA 2WIKA 5K8IA 2R7KA 3U1VA 3A4MA 2LD4A 5JWHA 3NBMA 3HB5X 4JH0A 3C3DA 3W2HA 4IUYA 2PSJA 4MWOA 2HT6A 4ZVMA 1GZ6A 2I8LA 4N41A 4AZ0B 3HYSA 4DV1B 2Z6QA 3VPAA 2ZWIA 2GNOA 4BFYA 3WA7A 4ITRC 3UJHA 3SX0A 3MIZA 1O4VA 1T0BA 4GZMA 4TMXA 5FPTA 1CUWA 3SCZA 3JYLA 5A4JA 5J63A 1RPJA 4JBNA 4N0MA 4JJ4A 4HUTA 4IBOA 4JYCA 3TOVA 4K6MA 5ALEA 3H11A 3KD2A 3L8MA 5D3MA 3DE1X 1TQHA 4YRFA 4FWTA 2ZETA 1AJEA 5FT9A 1OJLA 3GFOA 1RYEA 3ZY3A 2CNNA 5SZIA 4NNJA 1YA4A 2A94A 3ORYA 2CHVA 4AL4A 1RXUA 1QU3A 4XQ9A 1TYEB 2PQ0A 1MOZA 3QEMA 3WWOA 3FTDA 4K9SA 5CB4B 2WIAA 4JCOA 2BKUA 2FETA 3IMEA 4J0DA 2E4YA 4F3RA 2YV2A 1SY7A 3K6RA 4MI1A 2REXB 1PZXA 4B8YA 1LY1A 2VH1A 4Y6RA 3H9UA 2G82A 5C8YF 1JR6A 2QMOA 4X95A 3UH1A 3V4OA 3OQVA 4FA1D 1LSJA 4RA6B 1KEVA 1YC5A 4MNTA 3H6GA 3NJ4A 1EDEA 2C8KA 1JDTA 3G2MA 4KLNA 4LG1A 1MQSA 1P18A 1G2PA 3DUFB 2IEDA 1EWRA 4INAA 5LKAA 3P97A 4RTRA 3LFTA 4G24A 4HBGA 5IJXA 4MKGA 2VQ6A 4F3YA 1FUYB 3X1DA 3PXXA 3MK31 4GM3A 5BVGA 4L3OA 3ORQA 1ACJA 5KWSA 2Z5LA 4DSOA 3FUXA 4Z7OB 4DF3A 5MFZA 2ZUBA 3KB6A 2P2DA 2HNBA 3O1JC 1EVJA 2D1SA 1YQQA 1RTTA 2IXAA 2V0NA 1T2VA 3HWWA 1DXOA 2I5PO 1PK9A 2BEJA 3IUQA 5A7GA 3OIWA 4AX8A 4ESEA 5T4FA 4NS4A 5BXQC 2NU6A 2I2FA 3G59A 1KYIA 2J5RA 4K9OA 1UK6A 3VYVA 5DNYB 4CDGA 2J87A 1AZTA 3V34A 1YC2A 2XL3A 1LSOA 1V9CA 3EGEA 5AR1A 4N40A 2HESX 1T9BA 1BDHA 3H83A 2EKZA 4JJ6A 3TEFA 2YQZA 1TEXA 2VJKA 3Q3JB 2IW1A 5LLTA 4BO5A 1JFFB 3JYHA 2W5UA 1C2YA 3GZNB 1KKMA 3DG9A 2JPDA 3EXHB 1E2DA 5H3LA 4RY2A 4L5AA 1NLMA 3KUXA 1X87A 4LCEA 4S05A 4NU8X 2YRFA 3WFIA 2CNWA 4E32A 1XEAA 2BEUA 3OZVA 3ILXA 2GBLA 3TXAA 3RIHA 1GPYA 5L45A 2OXIA 4H7PA 1WP9A 5JI3E 1N2JA 4AY4A 3ZY2A 4V0RA 3ZLJA 1YB2A 2H92A 4PSKA 3C24A 3DSMA 5FV4A 2JD0A 4J7CA 3KELA 3WWYA 3R0VA 4HAIA 3EF0A 3LK7A 5IAJA 1P45A 4K2HA 4G89A 1K4MA 1P9WA 1Q0UA 3H8VA 2X2EA 2EW8A 4NNOA 3QX3A 4LIPD 3FWHA 2WSYB 3VC2A 3GRAA 4A09B 1E6KA 4MS4A 4XLTA 2HK9A 1RS0A 4O4LF 3SC6A 1VCMA 1NMZA 2IKQA 2GVZC 1K4YA 4K26A 3WL4A 4LOLA 3AESA 4F4DA 1XZJA 2RI0A 2I6SA 5E4TA 3T3DA 3RFFA 5E0KB 3FOAA 4AD8A 5A05A 1Q1QA 1UBRS 2C42A 4DIFA 4QXMA 3FYUC 4O4JF 4NENB 1UZUA 5DN9A 1EQUA 2GYUA 2OAEA 4JLAA 1XRJA 1F3OA 1S2LA 3IIJA 2ZCVA 3HGMA 1VCIA 2EVWX 4XW2A 1KKUA 3NCHA 5AM4A 1Z3IX 4FDTA 1DB3A 1IHYA 2CLFB 5DOVA 5IDXA 5C9ZB 2GJAA 3L0IB 3PV0A 3D64A 3IHKA 4PCAA 2C7PA 1TU4A 1KWKA 1CUEA 4KQCA 1G18A 3IKLA 2VF5X 4OJMX 1T29A 3R5TA 1NFRA 3ZCTA 5TF0A 1T5IA 4UCWA 1QK4A 5LOVB 4I99A 4EHDA 1ZDMA 2P4SA 4ZGBA 2NO6A 5BOVA 1TUIA 1Y7LA 3PJFA 2WSSA 1ZZGA 3L3BA 1VE5A 3Q5GA 2DETA 1ZH6A 2HF9A 3QVSA 2TRSB 1DTSA 1SUBA 2XAAA 5FXMA 3LRPA 1L2TA 1ZHFA 5KNBA 5K3CA 1D5CA 1X3SA 1NUPA 1XTVA 4US2R 3A31A 3K9QO 2PRSA 3EGVA 3O75A 4K1LA 4ZKEA 5TEEA 2FK8A 2VP0A 3HXOA 4AOWA 3PXWD 3GGJA 4JP5A 2Y3IA 3L0CA 4F60A 1YBMA 4REOA 4B4WA 3K73O 3EWAA 1YOVA 3VA7A 3IUYA 2O1EA 2IY7A 2E55A 2ZSEA 4GRIA 4G1MA 2R4UA 4A5OA 3OX4A 3L0YA 4EX7A 4JB2A 1Z83A 3IQHX 1JG1A 3DHYA 1T9CA 4ZJZA 3KPYA 2A0YA 4N3CA 3H2SA 1YTUA 2BCEA 3C6BA 1LNQA 3EVNA 3QOXA 5HWSA 1LLFA 2I4TA 2VFAA 1HE5A 4BOYA 1ES9A 2VJMA 3FPCA 1B3RA 1F4LA 4P4GA 3KUKA 1LK5A 1FTYA 3GAZA 1RYMA 1X7YA 1JECA 4FFNA 5ALWA 2BFDA 1JZSA 1YZKA 2ZJ7A 4ZTZB 3ANNA 3NIDA 1U31A 3LCJA 4WZAB 2BKAA 4MRNA 1LQ2A 3LP6A 4ZC1A 5T67A 3OOYA 2F1KA 4Z1MD 2MYPA 4PPYA 1P1IA 5IC4A 4Y6SA 1KP9A 1NG1A 4IAOA 1O87A 2F9LA 1Y0BA 3HNRA 4M0FA 4DLPA 4ZT3A 1A8HA 1TO1E 1G19A 3N9IA 1ZONA 2D0PB 2V6BA 2KJQA 3NZEA 3SFVA 4IEEA 4AI6A 2MU1A 3WGHA 3DAHA 1ZX1A 1M10A 3G2OA 3D7KA 2B94A 1FIUA 4UVGA 4K6OA 4HWTA 3SIRA 3VNVA 3R7WA 4PAMA 5JDCA 5BUSA 3D0QA 1WSBA 4PLCA 4PTZA 2DVMA 3BB1A 3L7LA 3TSOA 2VWHA 4PZAA 5KNBH 2GLUA 5E9WA 3EPHA 3E8XA 4HEJA 1QIHA 1YHNA 5CNJA 1IONA 4J82A 3ZS8A 3O8CA 2CYAA 5EL0A 2F3TA 4PPQA 4F4IA 4BFTA 3OJWA 1SZDA 2WVAA 1FQKA 2QI9F 2RDMA 1I9CA 2Q3FA 1TLLA 2CJWA 5JRZA 1XZPA 2XD9A 1YJXA 2VPXA 2QRVB 4AK9A 3JZAA 1WDKA 4BO9A 1OASA 2FQ1A 4BB0A 3I2IA 4OXXA 3CVUA 3T4PA 2YNOA 2YMUA 3NM4A 2WAAA 1DAMA 4EL0A 1KDRA 4KYIB 1E5TA 4UUBA 4EQ6A 4TL9A 1XWWA 5ALDA 3CIOA 2RJOA 3MJEA 1C3JA 3F8SA 4RXUA 1MOSA 221PA 3HUFA 2D13A 1U02A 4LQCA 5L7TA 1V1RA 5EMLA 3HJNA 3IE0A 5HUQA 2K6GA 4OQYA 4FP9A 3HJFA 1XWIA 2J0SA 3UUEA 1DQSA 3RBZA 4XD7D 1AT1A 2VRBA 1Y8CA 2VHQA 4XPIB 4PZUA 1W2WB 3FCUA 1KJWA 1I0LA 4RVNA 3MOIA 2AYYA 5H8WA 3AJ9A 4KL8S 3OCZA 5H1MA 4HWKA 4LSGA 1W46A 2BTOA 3C15C 3B12A 1JDZA 2G5CA 4A11B 4G1CA 3NR2A 2IZ5A 2JHPA 5KVSA 5TMBA 5JQGF 2ILTA 3LM8A 3F78A 2QTAA 4HWOA 5FUXA 2WG1A 4ID3A 4DSAA 3BJMA 3RFTA 2R62A 4FNMA 3SC2B 2WTNA 5J2TF 3DOFA 3DTTA 4X44A 2AQKA 5G40A 1DAPA 1E2QA 3ZI0A 2RJ3A 2DHDA 1LDGA 4QBGB 4QRDA 3A2MA 3HJCA 4MV3A 5MN4A 1R6XA 2QTTA 1XDGA 2HRCA 1IN1A 2FPIB 3HUDA 4RXMA 1JP7A 1WRBA 2X5XA 2IBSA 4JJIA 3C6MA 3HZOA 4Y3UA 2DPLA 2C58A 4Q37A 3JWPA 3X1ZA 3RLIA 4CIWA 1W85B 2P9LC 5HRUA 2J45A 2PLFA 1Z25A 1PGNA 1P0PA 1J1IA 4ZOZA 3LLVA 4OXQA 3RYTC 1QTIA 3GW8A 3ZCRA 2HJVA 3N2IA 4NAUA 1CLUA 2PRKA 3WGMA 3QENA 2REOA 2VHVA 4D4KA 5EJ2A 4ZVLA 2I1VB 3PTZA 1UC9A 1E79A 1ZYUA 1IY8A 4WGFA 1SIBE 1CXZA 4FPXA 3BORA 1RI4A 3K92A 1L1FA 2Z43A 4PY2A 3PCTA 3ZDQA 4HCJA 4LV6A 4JOBA 3U37A 4DRXA 1OBCA 1LBEA 5FWAA 1QNFA 2XD4A 4GC9A 2I1QA 2F62A 3UOAB 5IKEA 1FC0A 1PX2A 1N1DA 1RMQA 4OHFA 3X0DA 1E4YA 2ONZA 1XOIA 3GJ5A 2YINC 4UOZA 1SQSA 3AB8A 3GYGA 4I8IA 3IS3A 5JBNA 3QVLA 2WAMA 4JX9A 3HU5A 3A7DA 2IYLD 3D3WA 1UXJA 1RBZA 1P19A 3NRCA 3ZV4A 2ZZKA 3ML1A 1AGNA 4UPDA 1XA4A 3A3PA 3RIMA 1RKUA 4RL4A 2FRDC 3QEAZ 4FK8A 2WYIA 4NSXA 2FUEA 4NECA 5DP1A 5EZQA 1V7CA 2V7BA 4DMCA 4UAUA 4JHNA 4LZJA 2IYOA 5E4JA 4H6XA 3PUWA 4KX3A 1IIRA 2XCUA 3AR3A 1A8PA 2JLUA 3ZDCA 1Q7RA 3ADBA 4PZPA 4LXTA 1R6AA 3CO5A 1Z8DA 4URZR 1ARZA 1K2VN 2I9PA 4DPKA 4EPVA 3QELA 1SBNE 4I50F 5AMXA 3WLHA 1H4SA 2PX3A 4NJMB 1J21A 4PIMA 5HKKA 2P9KC 3STVA 3KBBA 4DSNA 2FWIA 5KMGB 3RUCA 4J4HA 3UBMA 4JAVC 5DW3A 2EW2A 5L3VA 1MZPA 3JR7A 1SM4A 3FF1A 4M6WB 2E3JA 4RIHA 3FDZA 3HXPA 3LJKA 4LI3X 1GILA 4FEGA 2X41A 1JTVA 1E1KA 1CQIB 2UKDA 4DWVA 4RDCA 3EF1A 1L7BA 3WLEA 1VPWA 4BRWA 2AG0A 4O02A 4Y9UA 1RWQA 2OXEA 5DV9A 3HM9A 1JBKA 4FR2A 4KU4A 4QQKA 3W7AA 4ZYLA 3U7JA 3U4AA 2G25A 3IULA 1XRPA 1NURA 4JITA 2WNHA 1NNEA 4GQ1A 1SVSA 1FS6A 4UZSA 3S81A 3PUYA 3PFCA 1SUIA 3ZHXA 1QV6A 3JQCA 1UPXA 2JGAA 1NYQA 1DV2A 1HTBA 3HFSA 3PL1A 4AO7A 3MB8A 4M0PA 4QFMA 4Q3AA 1DTWB 1PLLA 2GBIA 6Q21A 5IJ0A 1G8HA 3ZE9A 1WF3A 2GEVA 3CRZA 2HH9A 3EDYA 4ZDKA 2QJOA 2HBRA 4HV4A 3BTSA 4JR2A 2ZUVA 3G5UA 3UAXA 1O1YA 3HGTA 1Q17A 4I6EA 3Q8LA 2A59A 1NT2A 2XB8A 3L6RA 3S70A 1FDIA 4XD2A 1JIUA 1MC8A 5U9CA 4MYHA 4BKMA 4P54A 1X8LA 3WK8A 4PNZA 1YCGA 2V7UA 4YK7A 1T25A 3H6KA 4ZAGA 3VR4D 2R5NA 4CU5A 5F98A 3UMMA 2NUAA 4L57A 4TMKA 4B4OA 3W4JA 4LXYA 4CL2A 2PSHA 3HBFA 2O52A 4NV3A 4IIUA 3LUAA 4PYJA 2YW9A 5JPCA 1PFWA 2FKNA 2IUSA 1P29A 2AW5A 3K6KA 4MUBA 4A6XA 3S0JA 1NJ1A 4GQAA 4IJVA 4O4IB 1NVTA 3LPDA 2VR1A 1RBYA 4O1MA 1BQEA 3RRNA 2H1FA 2C9MA 2YJ6A 3CWZA 4GMFA 1FE8A 4KMSA 2HLPA 2ZIXB 1NNLA 2O8VA 2WY2D 4BS9A 2YC2C 1JDNA 4HNVA 3MTJA 4LF6B 4O08A 4AKIA 2QMYA 3A06A 4IFTA 2ZI3A 3MLBA 4NTZA 2AG8A 1XZDA 1GTRA 4ER3A 4H7IA 3QBJA 4BX0A 4QJ5A 4NHEA 1RLTA 4W9NA 1N9GA 3PPIA 4YQYA 3T7TA 5M5BA 3ONNA 2YBAA 2V8BA 4TKUB 3RJ9A 3EGDA 4HQKA 5EPOA 3AH8B 3SEZA 1M2WA 5H4GA 3IPLA 3OTOB 2YVKA 1CUBA 5JU6A 4MZXA 1H1LB 5FKQA 4AZ3B 5K6AC 2X8AA 3MSCA 3ZQUA 4R1QA 4HQNA 4P3OA 2AI3A 4MQFB 3A3NA 4EUFA 1Y3BE 4CNBA 1E66A 1M7GA 3KR0A 1GYRA 1XLUA 1AZWA 1N0VC 4IFBA 2C1EA 4TV9B 3RARA 1GUZA 1OYVA 1SU4A 2AS0A 5C86A 2Q6OA 3KV1A 3V8NA 5EKUA 2H29A 3DHEA 4BFUA 3H2HA 4CM9D 3D4NA 1XDWA 2XQVA 1ELOA 2ID8A 1G8GA 3DLHA 4EHBA 5JNRA 2R47A 2A35A 1RRGA 4IG9A 5D84A 1IBRA 5ALVA 5JAPA 1GLVA 3MOGA 2FW9A 4O4HA 3S2ZA 2BM0A 3C6QA 3F9CA 4R0VA 2GM4A 2DF8A 1AUPA 4TLAA 8ABPA 4MDYA 4FSXA 5KOHB 1NU6A 3Q6IA 3HNOA 1WOMA 5CXUA 2K7FA 1CZUA 1XFAA 4PCVA 4FYMA 1X7ZB 4Y1EA 1Q1AA 2HK8A 2FCAA 1NEXB 1XZAA 2ZSFA 2H4WA 4E0BA 2B99A 4HH3C 2JAUA 4H1UA 3FM0A 4M89A 1CRZA 1GSHA 3E3AA 3EG9A 3PA6A 5KX5A 3CNLA 3O8QB 2ZIZA 3V1MA 3SVZA 4MKIA 1IEQA 2C0QA 5CFRA 2VTDA 1I80A 4JJKA 2ZYDA 1GTJ1 1VJTA 5BQPA 3NVNA 4RTNA 3W5JA 3N8DA 1NV9A 1G5RA 4N5MA 2FSFA 1QPBA 1TUGA 3PNQA 4Y6GB 2AWNA 3O8RA 1Q0ZA 4TQAA 1T2XA 5IKXA 3N70A 2C2XA 4KNWA 4RWEA 5AK6A 3I28A 1G7SA 1UFVA 4KN6A 3MINB 3SI7A 2W6CX 2Y1XA 2Z04A 3WNDA 4AT1A 1FP6A 2EYUA 3AU8A 3GRZA 1ZGZA 1PL8A 3L2OB 1AO0A 4ISCA 2W4MA 3NKLA 4AW9A 2AXQA 3T1YB 3I52A 2NZ2A 2BJVA 4CW7A 2QTBA 3L4JA 4IJUA 4F6RA 2IV7A 2E4UA 1C3OB 4HAVA 4I5FA 2Q3JA 3Q2KA 2QU7A 4NC4A 1UM8A 2QM7A 2XVZA 4HWRA 5TS3A 3BFKA 4GNRA 5DNCA 4EG7A 3ZY4A 3IR5A 1Q6ZA 1XL0A 3PDWA 5A62A 3A4TA 5EP4A 3BIFA 1RJ9A 4ZO7A 3C8HA 1GL7A 3ZV3A 3I05A 5JO9A 2K2WA 2RE8A 1CDOA 1B8VA 5A6SA 1U0NA 5HTKA 4Y5RD 3TD6A 3T0IA 4HLUA 4MQEA 5L7YA 1SD2A 3JVDA 2JGDB 4LYYA 3AEKB 3U4MA 4NYMR 4Q24A 3SK0A 4KXXA 1ENOA 2JANA 4NE2A 5KPJA 2R7MA 2BYTA 3F2IA 1IBSA 1K8RA 1W94A 3PX2A 1LS1A 1EFVA 3ZCPA 3D6NB 3ETJA 4X90A 1DRUA 1Q1NA 1VHJA 1H9BA 3W6UA 4C4AA 1EWTA 3VPFA 3D8UA 2XPCA 1KJYA 1T43A 1M6VA 4JOSA 2AH5A 3PRJA 2GZ3A 4YHHB 3R8CA 2NQTA 3AIOA 3RRJA 3WGQA 1TPYA 4B7ZA 4J2OA 2BEVA 2HUPA 4CDNA 2VAVA 5AWFC 2I65A 1EJ2A 3EEBA 4YEDA 4CKEA 4YAJA 1PDVA 2DFNA 2O0JA 3WKCA 4L8YA 1R0LA 2Y67A 3ABQB 3C5CA 1MENA 5JARA 4BIMA 1O0BA 2NU8A 1YFJA 2ZRMA 3TRFA 2FA9A 4GI7A 2PSDA 3FLEA 5CVDA 3V3KA 5C8ZA 3H17A 4MR9B 5CW2A 1IZ7A 2H5JA 4R2WA 4HVLA 2OHGA 1J2YA 2IHTA 1YS7A 1QYWA 3I7HA 4NBNA 4D3DA 4AEZA 4MYUA 3OTIA 3JWIA 2LP4Y 3ZR4B 1PQUA 1R0WA 5JFGA 1ZICA 3IQFA 2CV0A 2GEUA 3GWGA 2EDCA 1V9SA 5FUQA 4YV7A 1G4HA 2OB1A 2GNPA 4DG9A 4PCUA 2AQ5A 3EIQA 4D7AA 2YDXA 1IH8A 4L8VA 3GLFA 3CA8A 1S5PA 2H4ZA 4YMUA 1W1UA 3SQOA 1PW7A 2ZS7A 2CJFA 1K3IA 1T9AA 2XUIA 1IVYA 4D8VA 3AVXA 4ZK6A 1PSWA 1PEVA 5H81A 2IXTA 3CFSB 1S02A 4ZYVA 2QMZA 3GQVA 1TYCA 3UXHA 3TNFA 1NXSA 1W5TA 1NA5A 4IA9A 3OJFA 1GFZA 5KSZA 5DO9A 5HQ3A 2MINA 5BV8A 2EGGA 4JGGA 1OIWA 3H5OA 1CUYA 4IMIB 2YYZA 4LNUB 4UNNA 1RRMA 1L6IA 4FFBA 1UP4A 2X8LA 3LPNA 1XBTA 2PL3A 2I55A 4WXMA 3PDIB 2UUBB 2YXPX 3TXYA 1Z6YA 1PHPA 4N82A 4XVQA 5AVTA 2LZ0A 1OFHA 5BV1A 4PO1A 2IYRA 4LK2A 7REQB 3FNHA 2GBPA 3GFRA 3FFXA 2UVDA 1I3MA 3N2GB 1GL3A 1SC9A 4DMKA 2FMHA 4BVKA 5KAPA 5EE5B 1THTA 4ZV9A 4GPZA 4C4OA 4PX2A 4N6NA 4PNKB 2QRMA 3L4SO 1E7SA 4MGZR 3UM9A 4AKTA 1K7YA 1BO6A 4A16A 3QBVA 3DEKA 3ZHUA 1WE2A 1JKXA 1SQGA 2Z2XA 1XA3A 2GJ8A 3E8SA 3JR3A 1XCGB 4L1MA 1D5WA 2HHHB 3F90A 2H63A 3K6SB 2ZUTA 3K35A 2R8EA 2XCSB 1NM5A 2ZSBA 4YRGA 1SHJA 3FZQA 2P69A 5JRJA 3B1KA 2G6BA 4M0KA 1MX1A 1XQWA 2E4WA 3ZLBA 1DIHA 5AW7A 4XYBA 2YW2A 3GNLA 3QVXA 2WF7A 1O95D 4XFKA 4EO9A 3RI3A 1GEEA 3F3MA 2PLAA 4CKWA 3A05A 3KQSA 3QPUA 3C3EA 1X0XA 1QIJA 2XYVA 5CDGA 1E61A 4EF5A 2VDUE 4LQ4A 3TLCA 5CLJA 2TRCB 1DBSA 2PN1A 4ZVQA 5BV0A 4PPGA 2WUDA 3VTAA 4L4SA 1DQRA 1MB2A 2ZB7A 4DBLE 3FVRA 3C85A 1QRTA 4I55F 2FG7C 3GRRA 2PZBA 3Q9SA 5FNZA 4XYLA 3CJRA 4WI1A 3M1IA 1K8YB 1D09A 5ABPA 1ZD1A 1E3EA 1YK0A 2C3OA 3KE8A 2DFKB 2FW8A 2ON6A 2PJZA 1US8A 2X7HA 4IEFB 2P41A 1XRSB 3SVTA 3KYIB 1BS1A 3BGOS 3KZVA 4MIEA 5IDYA 3FSGA 3K1AB 4OGLA 2BLLA 5I5GA 3SSMA 1NVEA 3LT0A 3RC7A 4RH0A 4AJIA 4OBWA 3U7HB 3K9CA 1P1FA 1Y3FE 1HFEL 4PLPA 4QPZA 1D2GA 2WFAA 4FEYA 3EUFA 3HRKA 4TOIA 3V9AA 2DPHA 3UMCA 5FNVA 4GKBA 3ZJ4A 4MUYA 1E1DA 4ZT7A 2QV0A 3IQWA 3N3BC 5EWJB 3X43A 1YD7A 1Z5ZA 4KQ9A 5AUPB 2CD7A 4R2XA 4J73A 3BTVA 4OD0A 4N39A 4TTJA 4NBMA 1NZJA 2QN3A 4FYIA 3FPEA 2FWPA 4M7RA 4MKFA 1UBEA 3CEJA 3ME5A 2ADOA 2BH9A 3G2NA 4HLNA 1D1SA 2RIRA 3RRMC 1V9LA 3E1GA 1ZD3A 2YY5A 5DLQC 5FBQB 3L7BA 4IIJB 3HABA 1Y81A 3A1VA 1QANA 4W7HA 2JEYA 3RLFA 3BXEA 3BGIA 4PLWA 4OEHA 4U8GA 2QW0X 4LBWA 5AI6A 4MJ7A 1LA2A 2C92A 2B2CA 3MC1A 3SHFA 4MPJA 3OPNA 5CH5A 621PA 3K8OE 4BP9A 2Y2UA 2QTVB 3TB6A 4MKRA 4HXEB 2MR5A 3O4FA 4F3NA 5HQGA 4JASB 1PTJA 1HUQA 1T4BA 3JD3A 4HUQA 2FZEA 2ZE8A 5SICE 3ND9A 3AC0A 2PPLA 3OKCA 1CG6A 4NLLA 4HFMA 3UWOA 1VG8A 1JQLB 1EXWA 3L8HA 4JB8A 3WMGA 3PE4A 1MPTA 1NVVQ 3OT1A 3DDSA 4ER0A 3BXOA 4QHTA 4WFIA 2WYWA 1M34E 3PBKA 4N3GA 4UCQA 5TGDA 2I78A 5EERA 1PT5A 3GFPA 4F0JA 4KZPA 4YX9A 3H2ZA 2V5VA 4NOLA 4PPNA 5H14A 1GN8A 3WTBA 4OGWA 3NFRA 2BGRA 1RR6A 4XARA 1GQFA 2SKCA 2O6HA 3OIVA 4LNAA 5L4SA 4PZZA 3O1IC 3HA7A 4WLUA 2RGNA 2G0TA 4K6KA 1CK4A 5CHEA 2FSVA 1VTKA 4GGCA 4PX5A 4G0YA 2ZPTX 1V1JA 4FB4A 1TPZA 3ZE1B 1ATIA 2A9KA 1MPXA 2B69A 1JLMA 3WYGA 3DMPA 4WASA 3THWB 1YHZA 1QP0A 2FLWA 3D59A 4LXXA 3WSVA 1P7WA 4DJTA 4J8GA 3LD9A 3LS2A 4MIYA 4OP2A 1RQPA 2XUZA 4IMRA 2XEDA 2DP4E 3ZIUA 3L5KA 3C6YA 4YJFB 3GK3A 5LQAA 2PWPA 4BC1A 2VOJA 3BXZA 4V39A 3TUZC 1DXYA 3CONA 4KXQA 4AN0A 2J1LA 5D2CA 1OPXA 4BNGA 1CZRA 1JBEA 4WY2A 5FWYA 4H0NA 1NBEA 4M83A 2W42A 3DMHA 4QXAA 4PGFA 2C4UA 3P5BA 3W9SA 3DMDA 2WTBA 2WUFA 3KLBA 1XU9A 2P27A 1MFPA 3UV7A 1OILA 4BE4A 1EBBA 2X5OA 2GTPA 1TJ4A 4A0FA 3Q72A 4LFCB 1IEVA 3JRNA 2XYQA 5HILA 4ZOLB 3FN4A 3R44A 3WBBA 2UU9B 4ZCIA 3OCVA 3FH0A 1NVBA 4IFIA 1Z0ZA 3OKTA 3FNEA 3RCBA 1KEPA 1YZLA 2D2XA 5KNDH 1I7DA 3T99A 1BTOA 4S1WA 4MB2A 3N0DA 4B6GA 4HB3A 4QGAA 4JKYA 1DAIA 5FR2A 2BKLA 2XQJA 4Z4IA 5EPUA 4N3BA 4DNUA 4BMZA 1ULZA 4B73A 4PZCA 4RV9A 3T4XA 3L0OA 2XH8A 3U7EB 4LF9B 3M82A 4IO0A 1JAIA 3Q5EA 5KKNB 3NUGA 3HZZA 3GJ3A 4P7KA 1HT1E 1D7OA 1CE8B 1E94E 4RELA 4YBRA 3RWBA 2P6OA 2C9OA 2J3DA 5C81A 2X3YA 3DM5A 3C4VA 3VR2A 3P0FA 2I62A 4GM0A 5KDDA 5LBIA 1LPPA 3TH5A 5G02A 4DCSA 4PAOA 1ONPA 1VE6A 4V24A 4FHCA 4O45A 1AQUA 4JYMA 1I36A 3EPPA 3ZWWA 4C5CA 1FFXB 4FCCA 2CBZA 2QMUA 4DNFA 4RKQA 2NV6A 2OB2A 2RGGA 3B9QA 3JQRA 2JGNA 2OLJA 2AEJA 3N6VA 3RUFA 2ZS9A 1G9XA 3WIVA 1R50A 3S1AB 1EWVA 2GHRA 1W49A 4JP8A 4M53A 1MVLA 3QE2A 3OZTA 1OA0A 4E33A 4GP6A 1GZ3A 4M4SA 1XD8A 4KSYA 4F5WA 2VDMB 2SECE 5JNUA 2GERA 1BS2A 4RSGA 1EK0A 2O3QA 3NETA 4UHHA 3U19A 2YHBA 2XT0A 2FFQA 3B82A 1MKYA 2CSXA 2XMQA 3QX8A 1QDLB 5ALKA 4AZSA 4KHPB 5KSOA 2VPZA 4NEQA 4X60B 2A0UA 3CEPB 3M89A 4PO8A 3CLSC 4H08A 1WDLA 2CK3A 3DYIA 5LZ9A 3G2JA 1E9CA 1SU8A 5DWDA 1JXMA 2XITA 1KERA 3C3MA 1W36D 1RQGA 2AQIA 1OWNA 2HTEA 2AFIA 4DV3B 5LIRA 2IWKA 1YRQA 3A6PC 2GD1O 1TO2E 4H9GA 5JTTA 4RJJA 4G07A 2XY4A 1J2RA 2VTBB 1OH8A 2A9JA 4DV7B 4F11A 3OEWA 3A8TA 4DNWA 3I73A 1DKPA 2HFJA 3FGOA 3AVYA 3FXAA 4WESB 2QJRA 1G59A 2VDOB 5JEEA 2QF7A 1NSFA 3JQGB 4UHKA 2F3RA 3QUTA 1KO7A 5LYJF 1EFUA 2WSSD 3FVVA 2J55H 3GHHA 1DGQA 1EK1A 2ZI7A 3D1LA 2OC4A 3HG7A 4XIFA 4N48A 4Z8XA 5JFTA 4IJWA 1HK7A 4A82A 3F0TA 3GRVA 1KQOA 1Y9AA 1G8MA 2FSIA 3NDRA 3MTIA 4R83A 5J58A 4HDMA 4A6EA 1IUKA 1LLQA 1ZGBA 1UQRA 1X80A 2Y1GA 1Q1ZA 3H1BA 1WMFA 1OTXA 1QK3A 4MKZA 1T9GR 1NWHA 1SG0A 4X1OA 4AJOA 4D3SA 3D4LA 5IEJA 2VT2A 4Q1VA 1B6TA 5DHFA 4NABA 2A9QA 1LGYA 1ZGJA 2W48A 4FSDA 2H59A 1I2MA 4BGUA 4ZIRA 4EJSC 4G0ZA 3GEDA 5HIIA 3DEHA 5EM2A 1HEUA 2WHYA 1HMPA 3GC3B 4B71A 4E22A 1VMIA 4WV3A 2CFCA 2OKGA 1KHHA 1TUBB 4CCSA 1BFUA 1C1DA 5B3AA 4CT5A 2VAMA 5FL3A 5ALQA 4OZUA 2EWWA 3DLIA 4OIFA 4KSBA 4E2FA 2DMRA 2PRZA 2NGRA 2Z1DA 1M5RA 2BUAA 2DB3A 2PD3A 2UYGA 1NDUA 3KTAA 4M8IA 4RGQA 3FFTA 3GLFE 2XZDA 3C9CA 2J7PA 1CQXA 4X5OA 1OFUX 3ORFA 1SC3A 1J1ZA 2VTKA 2HSDA 3TB4A 1N6LA 1E9AA 3M4ZA 1A95A 1EESA 1FDTA 1UUFA 1U9CA 1ESZA 2IPAB 1L8LA 2A0FA 4LHYA 1TD9A 1R74A 2HXYA 2FUG1 3VV2A 3AB7A 4IWNA 1NRJB 1R0RE 3B2EA 3GLTA 4FYXA 1SHTX 1KJJA 1XXHA 1QCCA 2E18A 3COWA 3MWDA 5A5VA 2WUGA 1EE1A 1KYQA 4JFRA 3VDQA 2VT6A 4BCBA 4EB6A 1CJVC 5KVAA 4Y6PA 5AJUA 3B7PA 3TNJA 4PVCA 2AC2A 3FPFA 3RUPA 5FO1A 3V2IA 3FPBA 1NUAA 1XSEA 1JR4A 2CB0A 4NARA 5KYWA 4WWHA 1X1DA 3N2YA 4QGGA 4X93A 2EJUA 5FLXA 1NULA 2AGWA 3DZBA 5I9TA 2RH4A 1ZMXA 1ZH0A 4QOSA 3A2KA 4FBGA 5REQA 2I8AA 2YV5A 4U7FA 4BO7A 1E6UA 1AO3A 4MV1A 3EQ8A 1TO6A 5IMSA 1PSDA 4B43A 3G9ZA 5IKPA 3VZCA 5GXHA 3FBGA 4NZZA 4W7IA 2PA3A 3FOWA 1GA1A 1XAHA 1DQNA 4HYTA 2B1RA 4CTNA 1SHLA 3HN6A 5TGTA 2FW6A 1SBQA 4L4XA 5A6VA 2DUJA 1L5GB 2G9QA 1CERA 1C2TA 3F7NA 3EFEA 4AUNA 4KACA 4P0PB 1VYVA 4Y18A 4BUJA 3WKBA 2CMKA 4OLHA 4WFJA 1DU4A 1KAEA 3S8YA 2BTQA 3LX8A 2XE8A 3GPLA 2JGFA 2DSTA 2ROQA 2EBHX 2H7VA 3TRHA 5IDWA 2JVJA 3DKRA 3HL4A 1VKZA 3V7NA 5AJHA 2BGGA 2R3SA 3AVPA 2HAEA 4O2AF 4IIDA 2VRNA 1I3NA 2ZG6A 3EZXA 3Q7QA 1JSXA 1DFHA 1W9MA 2D5AA 4CN8A 3IEUA 3TSAA 4FGJA 3DWIA 5HF5A 1CS0B 1YE3A 1P2FA 4K9DA 4P92A 3TAXA 1TT7A 2DT8A 2DPYA 2QXYA 1QFSA 4ALKA 2AI2A 2C4KA 4JI0B 4D74A 2J59A 3C98A 2C4VA 1PYOA 4EEKA 4Z4CA 5FPHA 2Y0DA 1PBTA 5HTOA 4PYIA 5JVDB 3SQLA 4MIOA 1QC5B 4QD3A 4YRRA 3S44A 1BXRA 3SR0A 3LOUA 2PJRA 1PG2A 4DLRA 3IUNA 1WHTB 3LY5A 4R1SA 4PN7A 1CY7A 1VLZA 2PXAA 4YAWA 3P1JA 2TYSB 1MVNA 3PUIA 2EQAA 4KAJA 5B6PA 4K0KB 1JMXB 1XZMA 1H2FA 2KWIA 3MN1A 4J78A 2X3FA 4E5MA 3EIWA 1CFZA 2PWBA 1ORTA 3ELDA 1OMWB 1KMNA 1E6MA 5EA2A 3C5EA 2LGJA 5CK5A 4B34A 1JDVA 3GJXC 1QRRA 4AG5A 4UU8A 1ZM3A 4CMEA 5AVZA 1JR3A 4JIGA 1MH9A 3SM9A 4YCDA 1WEHA 2I3BA 4DZZA 1ADFA 4O0MA 5ADWA 1X0VA 3E9RA 3QY9A 2EW1A 4UFPA 5EUCA 5HDBB 3MA0A 3G9UA 3KTDA 1KK1A 1F8UA 3GJYA 1QNIA 4YUVA 1GRQA 1QQBA 3DCYA 4EYEA 3JAKB 4DQKA 3FNBA 3V7UA 3FHCB 2AYZA 1E2LA 2QUZA 2UZ3A 5EJ5A 4HDSA 4XJXA 1H0HA 3HXTA 4P3XA 1RPNA 3WOVA 2UXDB 3QKRB 2BHTA 4ZYXA 2VWGA 4BO2A 4C1NA 3OVMA 4FE7A 3U3ZA 3H04A 1UDXA 2EERA 4NF2A 1M8PA 1UXKA 3LT4A 2JCGA 3ZWCA 1JA0A 1QH9A 5EC8A 3PNSA 3RFXA 1VIDA 1RVDA 3JQ9A 1HQYE 4JLMA 3AF5A 4RK6A 1B00A 3LIPA 5B1SA 3TBHA 2PIDA 2B5OA 4QA9A 1OAOA 2HA6A 3EEIA 3KYCA 2L17A 4UM7A 5E2IA 1DPFA 4KVAA 3GGOA 3ZNNA 3MQFA 2NVWA 3DT8A 3GDFA 3P4FA 1ITZA 1JFLA 3CT6A 3UCXA 4W8OA 3F96A 1SXJC 4ZYYA 1N4DA 1G291 5HZKA 1M2FA 5SY9A 1EFPA 2V96A 1M5TA 3KVVA 1AX9A 3SBDA 1KMHB 3UFXB 5DGTA 1D8AA 4UXIA 2HBYA 1JHVA 1QHEA 2I03A 1VXRA 2OCXA 3TRDA 1DKMA 5TEWA 4EB3A 2P9TA 3BZUA 2RKOA 3UT5B 4WMLA 2H2IA 3UENA 1PUIA 2ASVA 2O5VA 5HBRA 1UEJA 4RPGA 3W78A 3ER9A 1L4YA 3H11B 2V4MA 3WYBA 5D3MB 3CV3A 2RAUA 1XYVA 5LP6F 4M9UA 4ZZIA 3I62A 1VLVA 2WU1A 4UHCA 2ZI4A 4FEEA 1ILWA 3FOCA 1GOFA 2Y0CA 4W7SA 2Z4SA 1RYZA 3PD7A 5C31A 1N0HA 1GG2A 4FGKA 3EZ2A 3DBRB 1PBNA 4FYHA 1YKFA 4RJTA 4ZVSA 1BWPA 2Q21A 1TIPA 3L4EA 2Y1OA 1QG2A 2EFEB 3JAMg 3DLTA 4DDHA 2Q4OA 1OBHA 1DZIA 1Y7TA 3OEED 4EJFA 2I7VA 4QDUA 4RESA 3DXKC 4X9XA 2QX9A 3KUUA 4C0SA 3PEVA 2OWDA 4WOCA 3SE7A 1C0KA 4YV2A 4LHXA 1BHJA 1UWCA 5H70A 4KFRA 2I2BA 2WJZB 1ODTC 3ZG6A 3OJOA 1KMQA 1C9EA 2C4MA 3AK4A 2YNMD 3JX9A 1NL3A 4KIJA 4QHYA 2SICE 3S40A 3QFTA 1R10A 1YDEA 5C8YA 5ENDA 2V3VA 4P2BA 3IJRA 2CC2A 4KXMA 3PEWA 1AN9A 1KI1A 1RKQA 5U4QA 5DASA 4TT3A 1A2OA 4IDDA 1QGZA 2AZ4A 3SMVA 3ND6A 4RCYA 2C9YA 3KSBC 2IK8A 2JJ2D 3IBGA 2GD6A 1WVMA 2XYRA 3WKDA 1M0SA 3RPEA 1HFJA 4HS9A 4QU0A 5EIBC 4RD2A 5I9MA 2JLWA 1XQ9A 1T13A 4QPPA 3JASA 3CSUA 3U7GA 2PYZA 4OPMA 1Q92A 1FP1D 2HR1A 5EP2A 2GN8A 5EZSA 4MVYA 4PSCA 3AHIA 1Z36A 3IUEA 3OJXA 1JHXA 16PKA 4MR7B 2W6JA 1BMQA 1EG7A 2FE4A 2Z0MA 1B14A 3PFNA 3PIDA 4JP2A 5BSEA 5HRAA 4OHMA 4CLOA 4TVBA 4XX0B 3W5AA 5FTMA 3B6MA 2I67A 1Q0RA 1L4EA 2C84A 3IMFA 4U2KA 3BRWA 2XR1A 6PFKA 1LJUA 1YF3A 4M9XA 4YBZA 4FCVA 4ZHQA 2V3WA 2J46A 2RHOA 3K09A 4KEAA 2ANCA 4Q3OA 2BEUB 3QLJA 5BN1A 2VDLA 3QTTA 4II7A 2V58A 4YRDA 3QI0A 1NE2A 5DNUA 4KREA 1ZUHA 4MQ4A 4GSKA 3KJQA 4DRZA 3BG1A 2CHGA 5EZYB 2IWRA 4JXXA 2XWBF 1WLSA 5J4VA 1H8HA 4D8XA 4KIGA 3NONA 3BMCB 2OVFA 4UATA 3WDSA 3K26A 1NFFA 3D0RA 1R0KA 5JSHA 5C35A 1Z37A 5EMJB 1YR7A 3AM4A 3SXTD 4MWBA 2ATIA 4LI0A 1V37A 5JH7F 3HUUA 4A0BB 3AESB 5LZ8A 5C34B 4EKYA 1QORA 1ISPA 1QWSA 4L07A 4Y2GA 2R6CA 2D5BA 1TVMA 2X0KA 2ZAIA 3LUCA 1W29A 2D5LA 3CU5A 3ACDA 1GTSA 5JD6A 4KI0A 4ZOAA 2ILVA 4LZWA 4X8LA 2P8SA 4O4LA 2AF4C 1QH8A 4B9EA 2ZK7A 1VZ2A 4ZRMA 5BWMA 4XGKA 3N7AA 1A4UA 3E3NA 3H4TA 3IOYA 4W4TA 2Q28A 3QKWA 3GUZA 5BSRA 3F6PA 1W2HA 1ZI8A 1LZLA 4OH7A 2HWXA 3BQMB 3D8NA 5TQ2A 4AX4A 4P4TA 4DCVA 1W36B 2ZT8A 2WT9A 1OX5A 2RH9B 2VF2A 4EHAA 3ROZA 5A4MS 2AFIE 1TW3A 3VRHA 1QTRA 1RI1A 2HIAA 4WN9A 3R9XA 1THZA 1NDHA 3BFVA 4FWWA 5EHQA 3RYCB 2VQSA 3FNRA 3LVBA 2CUKA 1J7JA 5JZBA 5DHUA 1KARA 2VDQA 5LQDA 5AW2A 2B30A 4IRMA 4YFYA 3QV2A 5FQDA 5BN5A 3DCNA 3IPCA 4Z5XA 4OATA 4UEJA 2FJPA 3DR5A 3LXRA 5JZ9A 4MEJA 1DBWA 3PVWB 4GZ3A 4ILKA 4B6FA 1ZKMA 3QEKA 2IFTA 3KD3A 1OVMA 1A04A 1JYSA 3HNPA 1SNYA 5IZCA 2CL0X 3D2AA 3IP3A 1PJ8A 1RIFA 4BVEA 1AUQA 3ZNOA 4BY9E 4XWKA 2PM6B 1DDGA 3H75A 1D04A 1L3IA 3ZXSA 2YCLA 2Z8XA 3TTUA 2E21A 4Z7NB 4HVAA 3EXFA 1YOVB 5AXDA 3NO4A 3JAMA 3P26A 2XE6A 2F43A 5IP5A 4G1MB 5EESA 4YQFA 1JPJA 3FA2A 4KHZA 1C0IA 3TLGA 4H6PA 5NULA 4YY3B 2ZWMA 1GQSA 2PL5A 4YC7A 4XGRA 5H80A 4H7DA 2ERYA 3PJGA 1U63A 3F98A 2BFEA 3AUUA 4EYKA 1K5PA 3A1UA 1CRWG 4LWOA 1E5XA 4FMCB 5I3CA 3MZ0A 1ZCZA 3HWSA 3LHKA 1AURA 2M1ZA 1IDOA 4ODIA 2BFDB 4CM8A 4AWXA 3PHJA 4KFCA 5KTYA 3G0IA 2HA5A 4F9FA 2GEBA 3KB1A 3MMNA 3IB6A 3VKHA 1JFRA 2FSPA 5BRNA 2AWOA 1JIJA 5IT4A 4WEQA 1E1CA 5CAEB 5K3EA 3NHFA 1ZWKA 2PS3A 1BNCA 2V0GA 1I01A 4D0KA 2AUTA 1NXWA 3K8YA 1PFVA 4IHJA 4FMDF 4RMNA 4RVUA 2VTVA 1C9YA 1UANA 3DD5A 2PD6A 4RMIA 2EIXA 1RHJA 8GPBA 4EGJA 4ZO6A 2OORC 5B2ZA 2R6ZA 3MGCA 3LPMA 5HJEA 3HDVA 2HPAA 5IBQA 3FPGA 4LSMA 3IIYA 3KQPA 5KKCA 1XXHE 1SK9A 2GC4A 4ANFA 4S2UA 1H6CA 5TNXA 4WJKA 2Q50A 4G5FA 1WAMA 4JK3A 4JJZA 1T6NA 3INNA 3K6JA 5FOQA 1TZ2A 3L0BA 4WFQA 4HJRA 4DDMA 2ZUCA 5HK9A 4ZODA 1JVBA 3T95A 1SUCA 2X15A 2QE6A 4EZEA 1ZHOA 3KYJB 2JIBA 4OK5A 1X3LA 3IELA 1R6BX 3T5BA 3CZCA 2C3YA 2O19A 1BH2A 3CPEA 1N25A 2WSMA 4C3OB 4Y1RA 3KC2A 2MWMA 5JJLA 2AHRA 2YWBA 2XNJA 3VTFA 1K9VF 4DIOA 1C30B 1TI7A 4FDUA 1GNRA 2VHUA 4V1CA 1P9OA 2I4LA 1QV9A 3MGKA 1GSAA 3ZTYA 3M6IA 1AKEA 5EQJB 4IX9A 1MG3A 2VCEA 3X44A 3L49A 4BNDB 2ODNA 5JANA 1JKJA 2WIJA 4CEIB 4NYIQ 4K1XA 5EMLB 1E2JA 1ZNXA 5JZOA 4L1KA 4J6FA 1PWEA 2ECPA 2QSJA 1DHRA 4GEKA 3IVXA 5GXIA 2AHOA 2BIFA 2ZJ6A 4Q7JB 3EVAA 4Q4DA 3DV9A 2O0MA 3IT3A 4YAOA 3NHBA 1Q44A 1JDBB 2YYSA 1JSRA 1W30A 5EHGA 3T3MA 3BIWA 1NXPA 4HPWA 3WGVA 5J5CA 1W25A 4NCXA 3EWNA 2P2LA 4OQQA 1M7HA 2GUGA 4IHKA 1IUPA 2PXCA 5IYZF 5EJIA 3GPIA