3MUOA

Appep_pepclose+pp closed state
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
684
structure length
684
Chain Sequence
LHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFWWGRYHYFFKNDGLQNQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDQRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATARVEQFDYEGKRVREVALPGLGSVSGFNGYWWDPALYFGFENYAQPPTLYRFEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl endopeptidase
publication title Route of Substrate Entry in Prolyl Endopeptidase
rcsb
source organism Aeromonas punctata
molecule tags Hydrolase/hydrolase inhibitor
total genus 215
structure length 684
sequence length 684
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 3muoA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3muoA01
5I8PA 1CUCA 2XMCA 2X76A 4LIPD 5ISMA 4UBNA 4TVKA 2G5PA 3WA7A 3I28A 3ILSA 3NWOA 1O6FA 1JU4A 1H2XA 2I3DA 3K6KA 3R3VA 5CT9A 1CUAA 5SYNA 1HL7A 2QKYA 1CUUA 3I2HA 2GBCA 1Y37A 3EQ7A 1RYYA 1BCRA 4G8DA 1Q84A 1QIKA 1LZKA 2AJLI 1QIGA 4Q82A 4EBBA 4QLOA 3WWCA 3IUNA 2QJWA 1W6RA 1BRTA 2BJHA 3BIXA 3AZQA 5AOCA 1A8SA 4J0KA 3WK5A 1VA4A 5LKRA 3H1AA 1AC5A 1DU4A 2CMFA 1MJ5A 2RIPA 4KEAA 1OILA 5JZSA 4WY8A 3TEJA 3DOIA 5CBKA 1F6WA 2ACKA 1PV1A 5ALWA 5AKEA 3ZLVA 2B61A 3V48A 3D2AA 1JJFA 2XUQA 4I19A 1J2EA 4CCYA 2PSDA 3VVLA 1TKRA 3H2HA 5DYTA 2XQJA 1E66A 2DHCA 5LLSA 2CKMA 5ALVA 5E4TA 4M0MA 2WUEA 4UHEA 2EEPA 1YAHA 3BDIA 3A2MA 5ALOA 2WHPA 6YASA 1XRLA 5BWCA 2WU3A 1ZD2P 4W9RA 2XUIA 4MWSA 2O2IA 3FOBA 2XUFA 2QJRA 1DQYA 2BUBA 2HA2A 4KAAA 2PU7A 2J3DA 3O9VA 4Q05A 1R9NA 1G66A 5FKJA 1LBSA 1FSSA 2J3QA 5LP1A 4KE9A 4B7ZA 3M82A 4FBLA 1A8UA 2GYVA 4H77A 3O0DA 2DHEA 3KWFA 2DCMA 2VT7A 1IZ8A 4JEIA 4RE5A 3VKFA 3HI4A 3I2FA 1E5TA 4BCDA 5DYYA 3KD2A 3C8DA 3V1NA 3IUMA 1QONA 3KDAA 2WIDA 4GHWA 1R50A 2UZ0A 1X2EA 3I2GA 4IH9A 4AB1A 2WFMA 5FLKA 5JADA 4EY5A 3DKRA 1WB6A 4ZV7A 1WHSA 1MN6A 3ZWQA 5AK4A 1FFAA 2E3JA 1LZLA 4H35A 4D9JA 2OGSA 5EHXA 4K6KA 1AMNA 3QH4A 5AM1A 1XZJA 2PX6A 5HQ3A 1UKBA 2HM7A 4BAUA 1DWPA 1Q83A 4J03A 3IUQA 4Q34A 3SX4A 4Y2PA 5KREA 1ISPA 4QDZA 4KRYA 1XLVA 3PI6A 5CH5A 1U8EA 1MO2A 1XZCA 3DEAA 3FBWA 4QA9A 1YS2X 3QPAA 2DFPA 2Z8ZA 3WKAA 2HIHA 4BTVA 4W63A 5AKIA 3WQHA 1OCEA 4TGLA 1D07A 3QYJA 4B85A 3H2KA 2C5GA 2WG2A 5K3BA 3T4UA 5E4JA 3WKBA 2QT9A 3FVTA 5CTAA 1EDDA 1EX9A 2O2GA 1CUVA 4MWTA 3R41A 1AKNA 1QTIA 5H3HA 5SYMA 3DYIA 4AN0A 2JGFA 4G5XA 2ZYRA 4Z49A 2ZVDA 3N2ZB 2HU8A 1JMKC 2J4CA 1QFSA 1H2WA 4Y2XA 5HF6A 4UUQA 3E0XA 4G8CA 5EIEA 5JAPA 4LHEA 1ZI8A 5HKBA 1JFRA 5T4EA 1EDEA 1NX9A 5A62A 4HTAA 4DMCA 5CW2A 4QWWA 4BBZA 3C87A 3GUUA 2QVBA 2WUGA 2XB6A 2OQIA 4K6HA 3I6YA 1HLGA 5HF5A 4BTLA 2H7CA 1EI9A 2QUAA 3WA6A 1F0NA 3HACA 1SC9A 5CXUA 1JU3A 2WLSA 5A2GA 2ZSHA 3ZPXA 2V98A 5ALGA 1SCKA 3O4JA 1MU0A 2XUAA 5HK9A 4EY8A 2JF0A 5DYWA 4FBMA 3W2TA 5AM3A 3AUKA 3FSGA 4ZRDA 1YASA 2Z3ZA 3FAKA 5K5EA 1DINA 1W52X 4J7AA 2IIVA 4XWGA 4GI1A 5AK3A 4YX9A 1WB4A 2ZSIA 2JGMA 2XUKA 5EHQA 4G9GA 1F8UA 1P0PA 1YA8A 2HA7A 2ES4A 1CUWA 1LPSA 3WMRA 3STTA 3VJKA 5CT6A 2VSQA 3G02A 4U2DA 1VE7A 2HRQA 4BRSA 2QOEA 4UBOA 2X5XA 4EY7A 4TPKA 3G8YA 4N5IX 4JUIA 2OCGA 4AMZA 3G0CA 4RGYA 4B80A 1YB7A 3WLAA 4XJVA 1DX4A 2OQVA 4DMHA 3V1KA 5K3CA 3QMWA 3E1GA 4BCBA 5EHZA 2HA4A 1QIDA 1K5PA 2WJ4A 5DWDA 1EVEA 1UKAA 4KE8A 1N5MA 5CRIA 3OOSA 2OGTA 5DJ5A 4INZA 3C5WP 3H19A 3AIOA 3WZLA 4LYEA 1GQRA 2CEKA 1VJ5A 3AZOA 4N8SA 2OCIA 1ACLA 4X3CA 2X8BA 2WIKA 3AZPA 2BKLA 5ALXA 1QIHA 1ZGBA 4MQLA 3HXKA 1IUNA 3JWEA 4ZXFA 4BZZA 1KU6A 4W1RA 4K5QA 5I7UA 4J0IA 1G5FA 4M0FA 1EB9A 2BFNA 5JAHA 2NW6A 3O9MA 3FYUA 2W22A 3ESAA 1CUDA 4DMFA 4HXFB 4BDTA 4RE6A 3A2LA 5ALSA 1UOPA 2Y6UA 2JEZA 3GFFA 3H2IA 1EVQA 4AO8A 3P2MA 1CUGA 4HRYA 5JALA 1VLQA 1P0QA 4ZI5A 2WTMA 4UHHA 3G7NA 4DSZA 3WL6A 4BP8A 4F0JA 1DX6A 1SFRA 4BCCA 3BL8A 3STYA 2B4KA 2Y2UA 2WHQA 4WFKA 3H2JA 3FLEA 1X2BA 2Y6VA 5D7BA 1A8QA 4BE9A 4YK7A 1BCSA 3IULA 2GBGA 4QDUA 4F21A 4UBMA 4OD0A 1IUPA 5FRDA 4EY6A 2RGUA 2HA0A 1UWCA 2BGRA 5E2IA 3W9BA 1CUZA 1QIIA 4MEAA 1LPPA 1DT3A 3T52A 1WOMA 1XZFA 2EDAA 3GZJA 4X94A 1DTEA 5FP0A 5JYCA 1L7QA 5EFZA 3O4IA 4Y7DA 1XZAA 1VOTA 3MVEA 3PF9A 1QIMA 1LPNA 4W1SA 5HFNA 4F60A 3HEAA 3G9TA 5LZ4A 2I3ZA 1QO7A 4PSUA 2JGKA 4AMYA 4AN1A 1FFBA 2HDWA 3RM3A 3H17A 4Y2JA 1W75A 4ARBA 4IH4A 3VVMA 1LNSA 1CUFA 3IUJA 4QLAA 2PSHA 5YASA 1IVYA 4BYMA 3WK7A 5D3ZA 2WUFA 5ESRA 5HCUA 3R3UA 4BE4A 1C7IA 3ZLTA 5A71A 4AXBA 1WHTA 4UBJA 1YR2A 4AO6A 3A2NA 4X95A 3WK9A 2J4FA 2AJDA 2XQIA 4HRXA 2WILA 2C0QA 2W6CX 3PUIA 1XRNA 2HA5A 3IIIA 3EIOA 4CFSA 3QITA 4FLFA 4E15A 5AI5A 3GROA 5ALNA 4FDMA 4OUKX 2I78A 3L1IA 5AOBA 3N0TA 3E3AA 1XKLA 1EB8A 4P93A 4U2BA 1VZ3A 5C8VA 5DNVA 1ODCA 2JGIA 1W4LA 4OPMA 3IB3A 1IMJA 4G4JA 1B6GA 1ZD3A 2VAXA 1U4NA 3WJ2A 1QFMA 5JARA 3R3YA 2XMGA 4QDOA 5A7FA 3IBTA 4GW3A 3IDAA 2ZYHA 1P0MA 3DNMA 5AKJA 2ZJ7A 4C4XA 4PO3X 4GEGA 3KXPA 2QM0A 5FDFA 3I2JA 2FX5A 2WIGA 2G63A 2WM2A 3UUFA 4G1FA 3AIMA 2D5LA 2WFLB 1MAAA 2QXUA 3F96A 3FLBA 4IQ4A 1T2NA 1RP1A 4AZ0A 5ALYA 1CUHA 4MXDA 4NMWA 1GPNA 2WHPB 2VATA 3WWEA 1T4MA 3ZI7A 1BE0A 5CH3A 5E4YA 4B6GA 4N8DA 1JI3A 2OGZA 4X6YA 2O2HA 3C5VA 3VISA 1QLWA 1NU8A 2XDWA 4ETWA 4J3JA 2QMQA 3G9ZA 5AOAA 1HQDA 3C8HA 2VJCA 4BC0A 2BUAA 3CN7A 3VJLA 4N5HX 4B9EA 2V97A 1JJBA 2WG0A 5FXMA 4P08A 2XMZA 5HFAA 2RHTA 4H7DA 1LPBB 1HKHA 2JGEA 4EHBA 3DLTA 2HFKA 1UK6A 3H18A 4MYSA 2XUPA 4EZIA 3ZLUA 5ALHA 2XUJA 5T4BA 3QBJA 2HFJA 2RONA 1UFOA 1TCAA 5AM5A 4BVJA 3F67A 5FUMA 1ZD5A 2O7VA 5JATA 5C8ZA 1GT6A 4KE6A 1XRMA 2WUDA 3V1MA 5CT5A 4FTWA 1G42A 1WM1A 3B12A 2QUBA 4O08A 1R4ZA 5CT8A 3BE8A 4BZWA 3D4LA 2P8SA 2YH2A 4UHCA 2OG1A 1ODTC 4EUSA 3W04A 5CXXA 5HZGA 5DTJA 1TCCA 1XZIA 3BF8A 4J0DA 5AKKA 4X7BA 3BIWA 4G8BA 2DQYA 1TQHA 3HZOA 3R3XA 5AHXA 3AJAA 1CQWA 1E3QA 3BDVA 4QZVA 4H7KA 1TIBA 2Y2VA 1MNQA 2OAGA 4JYPA 3ZV7A 5AI0A 3S8YA 3MUOA 4UFPA 1XRRA 5IVHA 4Q3LA 3PF8A 1A7UA 4X85A 4FHZA 5BOVA 3DQZA 4L3WA 4FFWA 1QIFA 4B0OA 1XRQA 2C0PA 1LBTA 3WIOA 1SOMA 4QNNA 2GZRA 3ED1A 1ZGCA 1ZIXA 1R1DA 5JZBA 1MNAA 1EK2A 1MX9A 4X90A 1DWQA 1CUJA 1WPXA 3LCRA 2R11A 5T4FA 3R3WA 1I6WA 5AM0A 4DIUA 3D2CA 5AKHA 4ZWNA 4GWLA 3W05A 4HXGA 3QZUA 4X92A 1EA5A 1CUXA 4UPDA 2VJDA 3RARA 1CVLA 3FCXA 2WKWA 1MPXA 1E8NA 1WB5A 4QEKA 4PSCA 1MX5A 2HADA 3HRHA 4B81A 4ITVA 1VKHA 4NS4A 5JZ9A 2XLBA 4MEBA 2ORYA 5C81A 1N5RA 2PM8A 4LXGA 5K3EA 3O4HA 2DHDA 3WKEA 4FLEA 4Q1VA 4DNQA 3C70A 5AKZA 2HU5A 3NUZA 1DQZA 2ONCA 4G4GA 4OSEA 4QE3A 3MUNA 1SCQA 3YASA 1XZEA 1B41A 3FNBA 2HU7A 5DNUA 2QRUA 1S8OA 4I3FA 1H23A 2OXEA 5ALKA 4X00A 1GQSA 3DL4A 4WJLA 3BJMA 1QE3A 2FJ0A 4J0CA 1YS1X 3WWOA 3DKKA 1QGED 3D5EA 4OB6A 3M83A 3FWHA 2H1IA 4WY5A 4WDRA 1CFJA 2WU4A 4PQEA 3QPCA 5AIAA 1J06A 1QTRA 3OURA 2CB9A 3PFCA 5AP9A 1XQWA 4Q3KA 4B84A 4P92A 5AKYA 4DNFA 1WPRA 1XQXA 2V96A 4C01A 4KR0A 3WK4A 1GPLA 4Y2QA 1QO9A 3CCCA 3D3NA 1O6GA 4ZREA 1XQYA 3FCYA 3DYVA 4K6GA 3FSGD 5EI5A 2Z5GA 1YA4A 4S0XA 3G0DA 3WK6A 2WIJA 4C4ZA 3I1IA 2B9VA 5AKGA 1L7RA 1H22A 3SWWA 5KWJA 1L7AA 1MAHA 4Y2UA 4JH0A 3OC0A 3WL8A 3W9UA 1MTZA 2H7XA 3PICA 4CIAA 1ZIYA 2JGLA 2XQFA 1CPYA 5AH0A 4FWBA 1GKKA 3BJRA 3DDUA 1MX1A 3F98A 2JBWA 3Q0TA 5JD4A 3I1YA 1PJAA 3E4DA 5AIBA 5IH7A 1SCIA 3LIPA 3WIBA 1CUEA 3WYNA 2GYUA 4DLNA 4H18A 5I9IA 3STXA 4LXIA 2PL5A 3FYTA 5FPPA 4LXHA 4K2AA 5A7HA 3L1HA 4WFJA 2WSLA 1THTA 2HL6A 2HHAA 3WYDA 1TAHA 3QVMA 3WJ1A 3EQ8A 1VZ2A 4JNCA 3CN9A 4AQDA 1IZ7A 2XUHA 1WCYA 3A6ZA 2OAEA 3ICVA 2GYWA 1THGA 1FFCA 2FJPA 1M33A 4UBLA 1ZI9A 3HABA 4DMKA 3EF3A 5AK5A 2HRRA 3OG9A 3QM1A 5AKLA 1JJIA 1GPKA 3G0BA 5ALUA 1LGYA 2ZYSA 1XZDA 2QS9A 2C58A 1XLUA 5LIPA 4U2EA 4BDSA 3LP5A 3CCBA 4CIBA 2PSFA 1UT6A 1TK3A 1UZAA 2ECFA 3STWA 1LPMA 3H2GA 4A23A 1PFQA 1TRHA 4ROTA 5ALIA 3U1TA 4GECA 5ALLA 5K3FB 1VXRA 2AXEA 1Q0RA 4MJ3A 1CUBA 5J3JA 2H7YA 2OCLA 1EINA 3KOOA 4WFIA 1K6EA 4BP9A 3H1BA 3EQ9A 3D59A 5LZ9A 3R0VA 5KWIA 1AQLA 1H2YA 5LYYA 4C87A 4HXEB 4CI9A 4B83A 2XQKA 4AO7A 2ROQA 3H0CA 4Y2YA 2C7BA 4EA6A 1ZICA 5KBYA 1YAJA 1ZD4A 2HA3A 1XFDA 5ALDA 3RLIA 1CRLA 2ZYIA 2PBLA 4XIIA 5K3AA 1GZ7A 1KEZA 5T4HA 4DM7A 5FOQA 4A5SA 2WTNA 2VJAA 5IVDA 4IO0A 3K2IA 3M3DA 1J1IA 4RPCA 4KRXA 1Y7HA 4Y2RA 4H7HA 3WK8A 3IVMA 1A88A 4Y2VA 3LS2A 3B3QA 4KE7A 2OCKA 3OM8A 2XE4A 5CT4A 4BB0A 5IVKA 3TJMA 3DL7A 5AICA 2YASA 3D2BA 5AI8A 5ALPA 2BGNA 2WFZA 2QR5A 1XZBA 1JKMA 5JD5A 2YXPX 4BRZA 2XUOA 3MGAA 2XMSA 5ALMA 4OCZA 5C8XA 1ACJA 2GBIA 1W76A 3UMJA 3HYSA 4EB0A 3G0GA 3DS8A 3PFBA 4U2GA 4F5ZA 3I6MA 5BV7A 3NGMA 1CIJA 5A6VA 4X71A 4DSAA 2CJPA 3SK0A 2XQGA 1UOOA 5AK6A 2WFLA 4XVCA 4H0CA 4UBKA 1N1MA 2QXTA 4U2FA 2XLCA 4CCWA 1XZGA 3C43A 5FPQA 4CCYB 4OYYA 3BWXA 2XUGA 1ORWA 1GKLA 5AM4A 4NZZA 4BVKA 5CURA 2CZQA 3D7RA 5AO9A 2GBFA 4RNCA 2BAGA 2YYSA 1ODSA 3I2KA 3Q8WA 4GLBA 5A7GA 3BXPA 1GGVA 3B5EA 4DGQA 1XZMA 4YASA 5LKAA 3ESCA 5ALZA 3OTQA 1KU0A 2IX9A 3VXKA 4FFVA 1H2ZA 4OU5A 1BEEA 5F4ZA 3M81A 4MQMA 4CG1A 3GA7A 2K2QB 4X91A 3DD5A 3IA2A 3PUHA 4W1PA 2RAUA 3JW8A 1BS9A 2JIDA 5LZ8A 3ESDA 2D0DA 4OU4A 2QZPA 1HDEA 1BEZA 2JGJA 3O4GA 4DYHA 3G9XA 1Z68A 4GDMA 3VDXA 4E11A 4ZGBA 4AX4A 3WKCA 4DTCA 3GBSA 3GELA 4X6UA 4C88A 1QZ3A 4LYDA 3AINA 1VE6A 4UFNA 4OB8A 3UUEA 5HF8A 5JAUA 1X70A 1HPLA 3ANTA 3G0IA 1BROA 3TRDA 3WI7A 3WWDA 2XT0A 3WL7A 4OB7A 3V9AA 1ZJ4A 3X3HA 2VJBA 5AI6A 2XMQA 2XI4A 2ZJ6A 2EDCA 1YB6A 2VQ6A 7YASA 2VA9A 3C6XA 3DOHA 4U2CA 3VJMA 4C4YA 2Q0XA 1AX9A 3C6YA 1E8DA 4HAIA 4B0PA 1ZOIA 3AFIA 1K8QA 4W1QA 2VTVA 1XROA 4KYVA 4C89A 5HQ3B 1ZJ5A 4WCVA 1XZHA 3HJUA 4G4IA 5LZ2A 3I6ZA 1G4HA 1J07A 3WL5A 4KAFA 4NVRA 1U65A 2VT6A 4CG2A 1GXSA 4IHAA 5JAOA 1CUYA 3F97A 5JANA 2H9YA 3LLCA 2VEOA 2ACEA 4G9EA 3R40A 1XKTA 5C7YA 4FKBA 4QDXA 4DNOA 1JMYA 1OXMA 3SC2A 2AJBA 3ANSA 4Y2TA 5IVIA 5ALTA 3L1JA 1AGYA 4E46A 4X93A 1UXOA 1EHYA 2WQZA 4BVLA 2G5TA 4FNGA 4N8EA 3FYUC 2WG1A 4H7IA 3BF7A 2VAVA 1UKCA 3C6BA 1YSCA 1P0IA 2HA6A 5AI9A 1E89A 2ZJFA 3DCNA 4B82A 4I4CA 4UHFA 3AILA 3C45A 3U0VA 4UHDA 4L72A 4X6XA 5AJHA 4HS9A 4HVTA 1FJ2A 4OYLA 4V2IA 1AURA 3RK4A 3FLAA 3HC7A 2RHWA 2C4HA 5BWBA 5DTIA 1QOZA 3H04A 5ALEA 2PU5A 4Q3OA 4BAGA 1BN7A 5CMLA 4L9AA 1UOQA 2V9ZA 1JT2A 5LZ5A 2I03A 4L0CA 2OLEA 1EH5A 2WIFA 5IKXA 4WDQA 1QJ4A 1CLEA 2XMRA 3STVA 4FLMA 1YCDA 4HZGA 4XX1A 1UK9A 3PE6A 3IURA 3HLKA 2Z3WA 1LLFA 4PNZA 4Y2SA 2AJ8A 4KACA 5FV4A 3F8SA 3JYHA 3PDCA 1E8MA 1CUIA 1BU8A 4IH1A 2AJCA 2PKYX 1QIEA 4H7EA 4EY4A 4BAZA 4UHBA 3WKDA 1XLWA 4QDTA 5DNWA 2Z8XA 1DT5A 3K9BA 5DLPA 4PV7A 4AZ3A 1ZI6A 5AKXA 2O7RA 5AI4A 5ALQA 3LIIA 5JD6A 4MYDA 2DR0A 1ETHA 5LZ7A 3ESBA 3O95A 3V1LA 4J0JA 5D6OA 4KJXA 2PSJA 2RI6A 3WZMA 2G4LA 3W06A 4UFOA 5K3DA 1LPOA 2IITA 1CUSA 3F9CA 1Y7IA 1C4XA 4X97A 4FNMA 3WWPA 5D3KA 2BUCA 3EBLA 1VA5A 2C5FA 1IUOA 3QMMA 1VXOA 2R8BA 3QPDA 5EHNA 3DJYA 5EIHA 4M0EA 1R3DA 1CR6A 1MT3A 4CG3A 4BC1A 4J0HA 1K63A 1XZKA 3CXUA 1FFDA 2XMDA 1XQVA 1AUOA 1W1IA 1DWOA 5HKAA 2Y1KA 1FFEA 5JIBA 3A70A 2WJ3A 1N8SA 2DQZA 3C6ZA 4GXNA 2FUKA 3S2ZA 4FOLA 4ZV9A 4PSDA 1F0PA 1CEXA 5EGNA 2JEYA 4JYMA 2XMBA 4H7JA 2PUJA 1UK7A 1EK1A 1C7JA 5CH8A 4QWMA 4J0GA 1U2EA 3HSSA 5ALJA 4GBGA 5ALRA 4E14A 2WHRA 3FYUB 2DSNA 1EDBA 2PUHA 5ALFA 1AZWA 2CBGA 1CV2A 2QTBA 3FVRA 3STUA 1CQZA 4B9AA 2XUDA 4BATA 4YPVA 2GZSA 4A16A 2PVSA 2PPLA 1XZLA 1NU6A 4ARAA 1R9MA 5K3FA 3I2IA 1USWA 2VF2A 4Y9SA 5HF9A 1TCBA 4PW0A 2BCEA 5AM2A 1BN6A 1Q0ZA 1QIJA 4LKOA 4DNPA 1RWQA 1K4YA 2OPHA 3KWJA 2WJ6A 3G9UA 3TGLA 2B20A 3KSRA 1EXWA 4H7FA 1XRPA 1ORVA 1UK8A 3D0KA 3OPMA 2PSEA 4C6HA 5JASA 3ICWA 5EIAA 3QMVA 4PF1A 4UBIA 2LIPA 1LPAB 5HK8A 1HBJA 3RKSA 2CUTA 3AIKA 3R3ZA 4FMPA 3NOXA 1R88A 4P9NA 4KAJA
chains in the Genus database with same CATH superfamily
3AR5A 3E0QA 3RC8A 1Z15A 5KYNA 3INTA 4B8YA 4MWZA 5JNWA 1UJ6A 1QVZA 1HE1C 5DU2A 2ZB7A 4M0PA 3VR6A 1CDEA 4Q3DA 3SYKA 5A3QA 5CYKA 3A28A 1Y37A 2LCQA 5T41A 4LRSB 3AVUA 5B30A 4N6GA 5EWMA 1W30A 5LL6P 1XMQB 5C7IO 4I9GA 3N0XA 1ZGHA 3IMGA 3ZZ0A 3UH0A 1I30A 5KJEA 4QQRA 2BMVA 2ZBGA 1X92A 3UJAA 3LRPA 1ZISA 4YGYA 4W8OA 4GX2A 4O1HA 1L7MA 4NHEA 3OL2B 3QF4A 2JJ1A 2VAPA 2XUQA 4Q4HA 3SBDA 1HNWB 2QLTA 1KP3A 1UEXC 3D6UA 5E4TA 1N0WA 4I50A 4KX3A 1Z5VA 2IH4A 3KAQA 3BULA 4XIFA 5K6TA 4NC9A 3BX1A 1Y4SA 4WCFB 2QD1A 2WU3A 1RKXA 1I01A 2XUIA 3NAQA 4ZVNA 4JLBA 1E32A 5EWJA 4R6XA 4EG3A 4BMOB 2H65A 3PZRA 2P6PA 2CO0A 1W35A 3O8QA 3AFHA 5KNDA 2IXGA 1XCPA 4DILA 3ZNOA 3Q9UA 3GC3B 1NURA 3WNCA 1VHJA 1K97A 1AQNA 2D3TA 1QONA 1OBCA 2UZ0A 4AF8A 3ZGYA 1ESDA 3R6GA 4INOA 2Q8NA 2V54A 4ROSA 3O75A 1DC5A 3HDVA 3T7IA 3UHJA 5ICCA 4C29A 1PEKE 1LS6A 5HILA 3OQVA 2XT6A 5G0TA 3G2NA 5IEJA 2QLNA 3IUQA 3N28A 4MICA 1A1SA 1S01A 2J59A 3AFCA 1DX9A 3V8RA 3RFUA 3G88A 4YCMA 4GQ2P 4GOLD 1NASA 3N75A 4FIZA 3QLTA 1T1IA 5M04A 3JYQA 5B6PA 3BK7A 1RKQA 1W4CA 4EB6B 1CY4A 1L4UA 3IKOA 4KQEA 2DFPA 3JQBC 4TLMB 3ZDFA 5LU9A 4EHAA 1JQAA 1UFRA 3D3WA 1C7RA 1CBUA 1MDBA 4GVLA 1MEJA 5TVGA 1YZUA 1FDVA 1ML3A 4B48A 1FU8A 3WLFA 1ZIOA 2W2OA 2QT9A 3TBFA 3L0BA 3E1SA 2X19A 3R41A 1N0HA 2ZVJA 1WDWB 1EUCA 3G2JA 4RZ2A 5EWLB 4CR7A 4FFNA 4RA6B 4JVSB 4KH1A 4Q1AA 2UYQA 3UCFA 4R8VA 4RTQA 3KUDA 2JFVA 5HP4A 3E0XA 2OVPB 1QHFA 1EDEA 2PLNA 3NIDB 1FYDA 3GUUA 2FSSA 2VOEA 5HF5A 4WZAE 5JD3A 3UA4A 1QS0A 3FMGA 1AN9A 1IRIA 4C22A 4DJTA 5ALGA 2PCLA 4O45A 3DBIA 2IYSA 3UPUA 1K75A 3VA7A 2PWBA 1YASA 2O19A 3K5PA 3L18A 5H83A 2P78A 4UM5A 1E5VA 2PLFA 1GUBA 3BILA 3FMOB 3ZDXA 3RUPA 2REXB 3K4QA 2D13A 2O07A 4OBXA 4IDQA 1I4DD 1KERA 3WMRA 3L7YA 3SE7A 1MPTA 3NKFA 4JB2A 4CY3A 2WRZA 1PR2A 1SPXA 3I4FA 4N5IX 2JI7A 4EHKA 3RADC 2IIBA 3IOBA 3LQKA 2IIQA 1Z5GA 1DX4A 3O38A 3T5TA 4HH4A 1NF9A 4U9UA 3IJPA 1PBTA 3OTIA 3G68A 1VDZA 2FW8A 5AESA 5HNKA 3WDMA 3SI7A 5C8YF 2Y66A 5DJ5A 3RRXA 4ZJPA 3VZCA 1Z7EA 3MWKA 3PKIA 3X1DA 4IDCA 4P34A 2DKNA 1HE3A 1PL8A 3PRYA 1ZGBA 2I2DA 3IBYA 4K0RA 4W1RA 3COPA 1XTUA 4CTNA 4M0FA 3OY7A 2NW6A 3O9MA 2W22A 1A95A 5A0TA 1V5WA 1XTPA 4D4LA 5B3AA 2JEZA 3UCEA 5LJIA 4BGVA 2WHYA 4H7PA 2VWPA 4O25A 4XB1A 2WTXA 1RI1A 4CKYA 2BM0A 1IXRC 4PBZA 1F1JA 4F06A 3S1SA 3BHIA 2Z2OA 4X1YB 2EBWA 2HBYA 1WD5A 2QTNA 1Y5LA 4F04A 2ZI7A 5G40A 2QW0X 2Q4DA 1JLKA 5L45A 5IWAB 4P6VF 2GD0A 3FOZA 4N3AA 4BP1A 2JLUA 1A8QA 4BE9A 1BCSA 4F4IA 4XYIA 2GOYA 4G1VA 4BO3A 3HBLA 1VKZA 1UBOS 2CJWB 5J1TB 4UEOA 3M49A 3PDHA 1LDNA 4GOXA 3IXQA 2HQBA 1R37A 3F8WA 4GGAA 3H13A 4ZALA 1FP4B 2WQ8A 1C1XB 4A6XA 5TPZD 5CGQB 3BXFA 3EQ6A 2AEJA 3M6XA 4WLVA 1NJSA 4J82A 3THYA 3MTAA 4OAOA 3DNFA 4EPRA 3ZV5A 1QB8A 3LO8A 1JS1X 3WK7A 1T6NA 2Q4EA 3AHGA 4YDHB 1NYQA 3NFRA 3ASUA 4MLCA 1OWMA 4K9OA 4BFXA 1ZJYA 2X9QA 1GKIA 1PJTA 1P73A 4AIRA 1ZIPA 1FDRA 1SWVA 3JQ7A 2V3WA 4C6TB 1KS9A 2JVKA 3DNPA 5CBPA 4HUTA 3GUHA 2HA5A 3A05A 3VDMA 4CFSA 1ODLA 3TH5A 3DFIA 1ZR4A 2WA1A 5DP2A 3GO4A 1ZFNA 2HAEA 4GG1A 4IDGA 4U2BA 3AEUA 3JD4A 3ZWBA 3AR4A 1C80A 1ZD3A 1SB9A 3WJ2A 3NV9A 1I1HA 1LI4A 5KIAA 4JLAA 1BW9B 3DQQA 2R48A 3RS3A 1Z2NX 4A8HA 1P0MA 1CYEA 1ODKA 4PO3X 2QM0A 3RI3A 3I2JA 3DBLB 3V4PA 3RQSA 2PWYA 3LQQA 1QXSA 1MAAA 5IGOA 3F96A 2PX4A 2CL7X 5JSZB 5TSDA 3GIWA 3HKBA 3Q40A 5AW6A 1YF3A 4LQLA 2GEFA 3V4RA 3U7QB 4YUVA 2ZJBA 1DEKA 3CVYA 4LA4A 2QMUA 3MSCA 3D7NA 4B9EA 1VBKA 2JJYA 1SZCA 2WG0A 4DSTA 4NFLA 4N82A 2CNDA 1AK2A 1EFPA 4TWIA 3RSFA 3QSYA 3WR5A 2IY9A 5LMNB 3IDOA 4WRRA 2XCTB 3VKUA 4OH1A 3A58B 2IC5A 2IUEA 5KOJB 2XUJA 1NY5A 1UH5A 4H60A 1YUNA 2GESA 1RXSA 3FHJA 1PJSA 4XX0A 1CY2A 2I2CA 5JATA 1X42A 3QBVA 1C3OB 3EOAI 3UTCA 2QUBA 2E1PA 1NXSA 1YVPA 1RPAA 1A69A 3UK2A 1QGUA 4GMXA 1RKUA 3HI6A 3IPCA 4BKMA 3GDGA 3HO6A 4HC4A 1N4AA 4J16A 4XEHA 5F3DA 2OGWA 4FFRA 2DETA 5K99A 3C3JA 1XTQA 4WXYB 3FRHA 1Y7PA 3QLVA 4GGOA 1ZL2A 1D6NA 2NPIA 1SOMA 1JN0A 1MNAA 1U1GA 4CM3A 5JUWA 2RGXA 4RGBA 1LD3A 4PPNA 4X92A 1ZMRA 1UXKA 3FCXA 3N2KB 4CKBB 1ZH2A 3L05A 3DL0A 1EFCA 4H1UA 5A1JA 1EJBA 5L9AA 3HNOA 2Y1OA 2UYCA 1A12A 4S05A 3WKEA 4QFBA 2ZAOA 4K3JB 1MD9A 1OZHA 3U3KA 5DHUA 2FNAA 5L4SA 4RY9A 2NUPB 1VM6A 3I23A 4I3FA 2HRBA 2Q6OA 3R7DA 1GQYA 2QE7D 3OZVA 3KQVA 4GNRA 1B26A 3UKJA 4KQKA 4D9BA 1MORA 5COBA 3DZJA 2D54A 1YB2A 3PFCA 5G0SA 1Z47A 1XQWA 3PRHA 1R0CA 3L4SO 5TF0A 1M2VB 4XYBA 5JFOA 4Q7LA 4C01A 4QOEA 3GQBB 2A14A 1F4PA 5IDYA 3LA6A 3CCCA 3FCYA 3M33A 4AZ3B 4TYWA 4RF5A 3M8KA 3U4CA 3FHLA 3CW9A 3HYNA 1UXHA 4KGZA 4MV4A 3LUKA 4BO7A 4C4ZA 3UGTA 4YWJA 4J87A 2DFLA 4YR9A 3KQQA 4OHBA 2CKDA 1Z8DA 4M1KA 1EJ0A 4LI3X 3H05A 1OH7A 3I1FA 4CIAA 4QOFA 4NARA 4XQEA 1M9NA 1CPYA 4LYAA 3D8HA 3Q9LA 5KNBH 1MX1A 3KR1A 5AYVA 1WX1A 1GOTA 1IOLA 5IH7A 3DHWC 4TYMA 3WIBA 3D0OA 1V1RB 1XEWY 3CPJB 4CW7A 3PD1A 1DP4A 3FDZA 3OSZA 1IHPA 2WSLA 2BEWA 2XNDD 1EFHA 1WKCA 3EQ8A 1KRXA 1SBYA 5GJCA 4TTVA 3SYTA 3FPHA 1OLXB 1KO8A 4MV5A 1CD5A 2JAUA 4RNDB 3MBOA 5CAEA 4PBRA 1SKQA 3AX6A 4N5MA 4PANA 5JNRA 2GYWA 1YZHA 1M33A 3W4KA 3HABA 1C30B 3BQNB 4BLUA 3UGQA 4PICA 4PPQA 2QU7A 2Z09A 1Z4QA 5ALUA 2E1RA 2AC7A 4B74A 1E59A 1NUHA 4BDSA 3GAAA 4OH7A 2MYUA 3WP1B 1L7VC 4W5WA 5I7AA 5A4FS 3E2PA 3P9YA 1T8WA 4P31A 4A0GA 3A9VA 2V7GA 4F72A 1H1TA 3HZHA 3AVWA 5C46F 1HYGA 5DW3A 3JQPA 5LYYA 5F1YA 4LJLA 5DCUA 4JJAA 1N7IA 1RQ7A 3BMOB 1E1LA 1H6DA 3GPLA 5ALDA 2ZYIA 4MVYA 1M72A 4PGGA 1GZ7A 4FWTA 3DT6A 4AF7A 5CJPA 2JKZA 2NXJA 4DV7B 5FQDA 3HCRA 1UKZA 2VP2A 4HWOA 1FX1A 4RY0A 4YAEA 2FETA 3OC6A 2AGXA 1GTG1 4YMVA 1BMQA 5AJTA 4HDSB 4IM7A 5HHTA 3QXGA 1TZMA 1OA1A 2RCYA 1F8YA 4YO7A 3L5KA 2QD5A 4F5ZA 2PR2A 3KQLA 1JHUA 3TIVA 4NDZA 4I1SA 3GK3A 2A5JA 2XLCA 4NJOA 1LEHA 4AJNA 4LJ6A 3KJNA 3TIFA 2A67A 2HMAA 2CY0A 3P0FA 3UIEA 3LDGA 3KAJA 4RNCA 3VU0A 3LA8A 3VR3A 3SOZA 2VHEA 3NUQA 3NYIA 1EWYA 5B2ZA 4MGEA 5DT9A 4LY6A 2F90A 1IHXA 4ILEA 3RO7A 4GYJA 3TE6A 4BKRA 4IS3A 3FVQA 4JI1B 1P4SA 4A08A 5JMOA 1L3IA 4US2R 3M6AA 4H9GA 4WNCA 3F49S 3W15A 4X6UA 3MWGA 4I81A 5EE0A 3DL2A 3UWOA 2DULA 5GPBA 3HB4X 2P6UA 4ZAWA 5TE9A 5JAUA 4ZOCA 1JU9A 3Q88A 2XT0A 3F71A 3MZKA 3ZEIA 2M9MA 1YNSA 4S0ZA 4F5DA 2YWJA 1PTJA 4Z0TA 2Q3HA 3GOQA 4B47A 1E8DA 3Q5DA 1ZOIA 3E7DA 4BX0A 3AUJB 2BFFA 5HQ3B 3ZDBA 3LXXA 4G85A 3QXCA 3UR4A 4PINA 4A09B 2HGZA 1TAGA 1EQ2A 3WRVA 3AI1A 1P60A 4J3FA 2VT6A 5JCOC 3OZBA 1VMIA 4TMXA 2XOEA 5DHPA 5JAOA 3ZQUA 2VEOA 4FYYA 2V3CC 5TMPA 4EVSA 1XKTA 4QREA 1NQ5A 1RHJA 3WADA 1MOPA 5B37A 4MX8A 5ALTA 1VL0A 5PGMA 3VNUA 2Y9MB 3B89A 3VR4H 4IO1A 4CYMA 4QJ5A 2ZYWX 4BEBA 3FHCB 5HCIA 5G53C 4A0AA 1ITZA 3LSTA 4JJGA 5TARA 5C2WB 1X8JA 5F9HA 2VKQA 3W3ZB 1LY1A 4A2WA 3WNVA 3A37A 4GF5A 3BD6A 4JASB 4Y67A 1N1GA 2PMCA 2YMPA 4ACBA 5LDDC 5DLEA 2YOGA 1LTHR 1ZCAA 4X6XA 2WF5A 2PBIB 3D1LA 1TEHA 5J5CA 3BFPA 3IP7A 1T34A 3HC7A 2AGWA 2Q8QA 4TV8B 4CL8A 4BB5A 3K1YA 3WSTA 5BN5B 2A78A 5IKXA 3DVAA 3FA2A 2VF7A 4MJXA 1BOFA 2HXSA 4HZGA 5ITWA 5DN6D 4PXSA 2W83A 1WSBA 3L1KA 5C37A 3ED5A 3F8SA 3MCTA 2WT8A 1Z6ZA 3ZI0A 5BWOA 4ZHQF 3IJCA 3WKDA 1MAUA 1SIOA 4F97A 4IOKA 5J4HA 1E6WA 3JTMA 3RVJA 2IQIA 1RWOA 3LIIA 3E0CA 1RLOA 3ZZNA 2F3SA 3GLHB 2RGDA 1XZNA 2VSYA 2PSJA 2A9FA 3C3XA 3KBOA 4J1TC 2V9PA 1HV8A 1ULHA 2ERYA 4BYGA 2PUDA 5TQ0A 3C5MA 1EFAA 5DTEA 3JWJA 3IMKA 2WI8A 2PRYA 1V39A 3HPRA 3O83A 1UBKS 3CY6A 5FTJA 2ZBQA 2HGSA 1I5EA 1XEAA 3UVOA 4ZYZA 1GZ4A 5J4LA 2GTHA 4YO8A 4M0EA 4DBLE 2ZI9A 3MM4A 4CG3A 3P97A 2PRJA 3H1GA 4PQGA 4FOPA 1XQVA 4N0MA 4AP9A 1FMFA 3QLUA 1CB0A 4CI1A 3FMPB 4O4LF 3GL9A 1WTCA 3HHPA 1QHYA 1IEXA 2DFTA 4L15A 5ECGC 2FUKA 1Y6RA 4YH1A 4E5YA 4D0GA 2XMBA 4I3GA 1QX4A 3ZDDA 3DB1A 2ADFA 1Z35A 5JR3A 2C7PA 4LDPA 1KR2A 1GU1A 5BV2P 4ZQGA 4DPMA 1OH5A 2CBGA 3ZQJA 4PG5A 1R8YA 2GHQA 1L5GB 5IUNC 4BP3A 3W3AD 3LY5A 2PVSA 1NU6A 5JSUA 1CZLA 1WLYA 3KSBC 2IUVA 4PO1A 4Y9SA 4YGXB 1BN6A 4KMRA 2L69A 4INAA 1V37A 4GIBA 4CETA 3V8PA 2H4XA 1SXJE 1U5BA 3G9UA 3ND9A 5LQAA 1GOHA 1GNLA 1ZUNA 2ZRAA 1PFWA 1QH1A 1TYBE 5JASA 4NRDA 4LMRA 3VZPA 4BQFA 3QW4B 4P0TA 4Q4AB 2NQTA 1D2NA 5HJ2A 1GSHA 2AOUB 2PUGA 1JU4A 2I4MA 1EFVB 3RS0A 4MK0B 3K5WA 1EK5A 1U3DA 2QKYA 1XXHE 3ZX4A 2XGOA 3VTFA 1QIKA 3OT1B 3D0QA 4XGQA 5EXDA 1T36A 3IUNA 3ZE0B 1HDXA 1E5DA 3EZLA 5KYXB 4Q7MB 4QTYA 4IMMA 2KI5A 1SCUA 3UVEA 1KZ1A 1JHAA 1ZVKA 4LQ4A 2FKNA 1Q3HA 1Q44A 4G0UA 4DLPA 2P9NC 3O31A 1TBGA 1C9JA 1YZGA 4WXRA 1SGWA 2OVBA 5J2TF 2XRMA 3S29A 4A6PA 4MITA 3C0KA 3JZIA 3U5ZB 3O3OB 1OFGA 4L5IA 2JIBA 2O5RA 2IF0A 5HSGA 4JJ4A 2ONYA 4FP9A 1T5HX 1BMFD 3VVCA 1BFDA 1T2UA 5M5TA 2JZNA 4V0MA 1OSNA 2EYUA 2CN2A 3ZJYA 2WUEA 3FF4A 4LSZA 2IBSA 6PFKA 1YAHA 2BFAA 4CJXA 4LOKA 2Z9DA 4XA8A 2QN6A 1USUA 2NSLA 3BTVA 3TQFA 3NC1C 1T91A 1NDQA 2BUBA 3THRA 3DDSA 4OJYA 2TRSB 5HYNB 3FKSD 5DX1A 4MKGA 3K0FB 4Z2AA 1N6PA 2H06A 2YVUA 2PMFA 1SXPA 4HZUA 5FFNA 4PX5A 5FL7D 5DM0A 3UHOA 1SVUA 4FBLA 1TM7E 4NU5A 1IULA 4Z4IA 3PNOA 4QULA 2PGNA 4EI9A 4CMJA 5GZ3A 3V1NA 4MMYA 2PZEA 2P2NA 1T6BY 1Y3BE 2HCFA 2A0FA 5H3LA 2WD9A 2AF4C 5U9CA 2JGRA 1G8HA 4UNSA 1E58A 1AVTA 3QH4A 5JZOA 4X3OA 1JNXX 3DGEC 3GJ4A 2I87A 4Q9NA 5J4KA 5KYTA 3DWIA 4BNMA 4WBNF 4B09A 4II7A 4IIDA 3W5SA 1E9EA 1U8XX 4EYEA 2J5QA 5HKOA 1U8EA 1JEEA 5G41A 5BUSA 2JLZA 2Z8ZA 2XVMA 4GPAA 1WZUA 2RK3A 1FDTA 2B3TA 4K40A 4PLFA 4PPGA 1VP9A 3RSEC 1L8AA 3WQHA 3OJLA 4N4AA 4XPIB 1XLTC 1YHNA 4FFSA 1EDDA 1JQEA 3L4BC 1V35A 4B3HA 4UI9R 5JVDF 2XZPA 3H8VA 1N3LA 1XE3A 4G5XA 5JJKA 1L3CA 2LP4Y 4UM7A 2G09A 3G5TA 3BRCA 2RDMA 4Y2XA 2GWHA 1L8XA 3LT2A 2B36A 5A62A 1KZ7B 4R4JA 2GBPA 4NU8X 5CW2A 3RAPR 5CIWA 1GUAA 5CIYA 3SXUA 2IAAA 2NWQA 2GX6A 2QVCA 5AW5A 3UYLA 4GU5A 2QL9A 4RS4A 1QZTA 1U3GA 1OXUA 3OKPA 4YJ3B 2FN3A 4V38A 4RZ3A 1IZ9A 1RJDA 2AGVA 1GITA 4C4SA 4EY8A 1GTZA 2BSXA 2BI4A 3TZHA 2B35A 3U4GA 4DR7B 3H7IA 2IDZA 3N8IA 3SQNA 1YL6A 3QE3A 3AL2A 3MBKA 3NTVA 5J43A 1WMSA 3QVLA 4G5SA 4GOJA 2VK2A 3URKA 4JJ6A 4IHJB 3EXEA 5LOVF 1KJ9A 3KXLA 2YR0A 3OIFA 3RWBA 3ASYA 2PUFA 5C80A 1J8FA 2G6TA 2VDMB 5KYUB 1NR5A 4DG5A 1PG5A 2DR2A 1GFZA 2QDKA 2JFGA 4BX9A 2IV3A 3V1KA 5BRNA 3LG2A 4NYJQ 3ESQA 4CT4B 3CUTA 2OO7A 4BMSA 4E0BA 5EHZA 2JKVA 1JMVA 4R9NA 2JI6A 3M6FA 3ONVA 4PX9A 1E4EA 3JAWB 1OBHA 4KXYA 3RJ5A 5H7XA 2VH1A 1RJFA 1RLTA 3T3NA 3AZPA 5ALXA 3VU9A 1WETA 3QSGA 2E21A 2J3IA 3LC0A 3ADBA 2XNHA 1P5RA 3A10A 3W2IA 1U3TA 5JAHA 4UTXA 3F5MA 4DMFA 3WFJA 1XVAA 2WJVA 4S1OA 4CEIA 2ZIEA 4QYTA 3OIDA 2DHQA 5ALSA 1EM8B 4MINA 3IT0A 4YJHA 2O7SA 2O8EA 8LDHA 3PUKA 5ITZB 2EBSA 4PQFA 1A4RA 1JJUB 2G1AA 4ZAVA 2GHIA 1UDXA 4ZAFA 2UYOA 3RJZA 1WXXA 1C2YA 3A14A 5F5LA 4ZD6A 3QELA 3PJDA 4F3NA 2F1JA 4C4OA 3TLJA 2WHQA 3HUUA 1E3JA 1RE1A 2EG5A 2DE0X 2HH9A 2KBEA 3X0DA 3AR2A 4O02A 4XOIA 2ZSFA 2YNMA 2R1VA 2O1XA 3RK1A 3SHTA 1HL3A 4FT4A 5LQMA 3HUTA 3URMA 5FFOA 1WOMA 4QBTA 1DJQA 1SHZA 2H2GA 2RG1A 1JNYA 5JYCA 4JFAA 5JTUA 4PZDA 4AZSA 5HUQA 1A5BB 3MVEA 3TW6A 1X7YA 4F91B 3WGLA 5HFNA 5ESWA 3QWBA 4FEGA 3PUJA 1QO7A 3NM5A 2HDWA 2PH1A 4U3JB 5AVRA 3DZFA 3IUJA 4MDHA 4MROA 2DGDA 4RMJA 3D7KA 4PGHA 1AT1A 2ALJA 1QU2A 1G1AA 1DMRA 1N78A 4X95A 1O96A 2VHVA 1D03A 3GRYA 5IT0A 1V4VA 1KY5A 1PZHA 2BI8A 2PEZA 1ZSVA 4B3MB 4TS9A 3EFHA 4XD7D 4LXTA 2QAGA 3I8EA 5ALNA 4UCQA 5JWHA 1DQPA 1Y1PA 3L7MA 2YZ2A 4E7PA 3UAXA 3V7NA 2XMPA 3DCIA 1BH2A 1Q1GA 2VSXA 4GM1A 3EXFA 1Q0QA 4RLHA 3NORA 4J78A 2XU7A 3IDAA 3RIXA 4ABYA 4YAKA 1YK1A 2J09A 2AMYA 4NQRA 1MDFA 2R6AA 3CRZA 1RKBA 4WESA 4IEEA 3UUFA 4OBEA 1YFLA 3BH6A 5EZSA 1XVUA 5CVTA 4KSCA 3VYWA 5C51B 1T4MA 3EWIA 5C5IA 3BD9A 1ZAKA 4RHFA 4V0OA 5G4KA 4MQEA 3CVVA 3CVUA 1KZHA 2EERA 3QJGA 5BYAA 5A4JA 1BFUA 3ZNQA 3IP6A 4QXQA 5KTKA 3E48A 5HE1B 1LPBB 4EPXA 4B3XA 4B8WA 4PVDA 5GAJA 2ODWA 2DPHA 4W6ZA 3FPFA 3G5LA 1SD1A 5FR2A 3DAOA 4E51A 1RRCA 5BUCA 2ZU0C 2RONA 2C4KA 5JO0A 2YY5A 4AM8A 1IB6A 4KQIA 5TY0A 3ELYA 1WZIA 4FCWA 4FMDB 2ZREA 3ZE2A 4J0FA 2I0TA 3BM5A 4DLXA 2O4CA 1G42A 2UXBB 5E9AA 2ZRNA 1CJSA 1FDWA 3REFA 2BHNA 3GFQA 1O58A 5FWDA 1CY1A 2BR5A 1ZEJA 4KAXA 4B5KA 1ODTC 3W04A 2UUBB 4EVIA 5CXXA 5LP6B 1GQ2A 1JR2A 1I94B 2EYQA 3BIWA 4QNMA 4G6ZA 2DQYA 1YVUA 3CLTD 1IEQA 1WMDA 3H5TA 1SXJD 3AEYA 1Q2UA 5KTOA 1HM5A 5KHOC 2F43B 5BOVA 4XR4A 3NP9A 2GZRA 1QJCA 4KPYA 4HNQA 3ZTWA 3CIKB 4ZCTA 1NPYA 1T6YA 1ZK0A 2FEPA 3OVMA 3JR7A 2AA3A 4WPGA 1FFXA 3RVQA 2FG5A 2AEEA 1ZW6A 4LY9A 1E8NA 1ZK4A 4BLWA 1TTPB 4J79A 2QN9A 4UEWA 2G99A 3PQFA 3NC0C 1DE0A 1OTXA 3JU3A 1DPGA 1ZJ6A 3RGGA 4HEHA 4X8HA 4GXTA 2Q1SA 4HAOA 4CY2A 3V7WA 1UDAA 2C99A 4YR7A 3K9WA 4JI5B 4RJJA 1AUVA 3S8MA 2JH8A 2O7NA 3PTLA 3EGOA 4X00A 3U26A 4BQEA 2C5AA 1YS1X 3ADOA 3I34X 1RQXA 3DKKA 5EFOA 1UMCA 4OB6A 3G5MA 4PIMA 4GC5A 4HDKA 1A50B 4WDRA 2GNOA 3TOXA 4M8KA 5AP9A 1MO6A 4FBGA 3WNDA 1PNQA 2QI9F 4ES0A 3LWZA 1KXJA 4EMSA 1R5JA 3ZH9B 1WXIA 3FSGD 3ZDCA 3OKTA 4CQMD 1HNNA 4XLLA 4AJJA 1KMQA 4NOMA 1MAHA 2F55A 3ETCA 1MO5A 2HN9A 2R97A 1JQKA 4MS4B 4FWBA 5EG5A 1U8CA 1X7WA 1U02A 1ZVVA 1S3GA 3TGPA 3Q9NA 2XAAA 3HWX1 2FCRA 4EO4A 4LXIA 2PL5A 1U11A 2OSBA 1YR9A 3FYTA 4EJ0A 2PR7A 3U19A 5L4LA 5EMJB 4FPXA 3A1SA 4ZJUA 3U7EB 1V3TA 3UUWA 4RS3A 2H92A 3F6SA 3B7GA 1Z34A 2FXIA 2O59A 4AMVA 5G0UA 2FRDA 4Z3OA 3K8ZA 1Z4MA 3GJ7A 1N9GA 3HBNA 3OP1A 4QX6A 1VMAA 2PANA 4KLRA 3ONFA 4Z0NA 2JJ8A 3SIWA 4B4OA 4L8VA 3M6LA 1C3XA 3STWA 4NFHA 4A23A 3UFXA 2HHHB 2RBGA 3W5AA 3HCNA 4M1SA 2Z83A 3PUWA 3T5MA 1Y8CA 5JSYA 5BT8A 2H7YA 1PG2A 5C35A 1M2HA 3D59A 3GJ5A 3ICEA 4TZKA 3CB4A 2ZJ8A 4YJ2B 3UATA 1AZLA 2ZYDA 4Z9FA 5KU1A 4BVHA 4WTOA 3ORRA 3QOWA 4XRGA 3RLIA 3HN6A 5IYZB 5JH7A 5T4HA 2IYQA 1U0NA 5FOQA 1W93A 1IWPB 4ZCPA 2G9VA 3LOPA 1LK7A 1SC6A 3MZ0A 2XDYA 3CURA 3KUUA 5JTTA 5BQPA 1I3OA 2ZSAA 4K46A 3HU5A 4BB0A 5BNZA 3L0DA 3R7SA 4WNIA 1E3SA 1JKMA 1HK7A 1TE2A 1QGAA 2PZGA 3C3KA 3TINA 3AM1A 3OX2A 1J5EB 4XGKA 3PFBA 3VH4A 1IPHA 2BZGA 5ES4B 1IIBA 3F7MA 4GX1A 4O2BA 2OTCA 3QUCA 3CH7A 2GTIA 1V11A 1N1MA 2GJ9A 5FPQA 3WIDA 1XNRB 4MAAA 5GSAA 2YYSA 1ODSA 2MSWA 4K9LA 1M2OB 3TQTA 3EZ2A 1PS9A 2W2KB 2AFHA 4MS3B 2J6HA 4ND5A 1U2QA 2AK3A 4QU8A 1MHPA 3E2IA 3Q3HA 2F1OA 5SZJA 3LUPA 4CF4A 1J9GA 2P3OA 4MVXA 2ILTA 2PT6A 3BORA 3HWWA 1J7JA 1ND6A 4PCUA 3FCEA 2QZPA 5CLJA 1Z68A 3T0FA 3MLBA 1IM2A 4RDIA 3MWEA 5LQDA 2W48A 1BDMA 1PNRA 1PEAA 3CSUA 1RKVA 2OV6A 2E5FA 5KTRA 2PQ0A 4X1KA 3I8SA 1YQTA 4OQQA 4KSBA 3LBIA 5KNDD 2HNBA 1C7QA 3KQWA 1RABA 4C05A 2B2NA 2XI4A 3I2NA 5IAOA 1YB6A 4CMBA 5E38A 1QV9A 4EFNA 2XZTA 4GM3A 2BMDA 4QPZA 1U7XA 5KWEA 3INNA 5JZMA 1ISFA 4F6LA 3DZIA 4TM7A 4NQZA 1R5OA 1QRAA 1RI4A 4YUXA 1GRQA 4JQSA 2BWJA 1USIA 4AYXA 4FJ1A 1E2NA 3WL5A 3L0ZA 3MMYA 1COWD 4LJKA 1GXSA 5BPFA 5IT9g 1CY6A 5JANA 3HDYA 4DKJA 4J76A 1VBNA 3RJ9A 3RH0A 3ER9A 4EQ6A 1BA3A 4EK9A 5HKKD 3GYBA 1SU6A 4BASA 4FYPA 4E46A 1TVCA 1Z9BA 4FB4A 5BRAA 2CCGA 4N8EA 4EMUA 3L0OA 1NNSA 2FSGA 1GJRA 5EHIA 4QTUB 3BF7A 4B3DA 2J9GA 2P9GA 1NKSA 3JYNA 3LPCA 4KWCA 4CV1A 1TUEA 4URYR 3U6BA 1ZH4A 2RGGA 2QA5A 4R3WA 1WCIA 2CE8A 1GO2A 3I04A 4I4CA 3TTTA 1GGHA 3U0VA 4LW8A 5HE8A 1Y82A 2EARA 2PJRA 1AXEA 5D1NA 2C1EA 4LOHA 5CMLA 2H2WA 2ZR9A 4MI1A 3K6RA 4MZXA 1QLJA 3ACCA 4FIDA 4NH4A 2JJ2A 3P96A 1P8JA 3H6HA 4D4HA 3HLKA 5BQOA 4O8CA 5KVAA 1Y3FE 2P41A 3P94A 2F1RA 2ZXFA 4P32A 1AZTA 4RMNA 1K2VN 4UHBA 2I0RA 1EX1A 1RLUA 1YR8A 5FOXA 2NG1A 2ZT8A 4ENTA 5DO9A 4FHEA 3QYPA 1GG2B 3EVNA 4S1PA 5D6OA 4KDFA 3ANYB 4AS2A 5FYDA 1G8PA 4DEYA 5DYNA 3W06A 1N5DA 2H4FA 2WBLC 4MDYA 3UJ9A 4UREA 3SP1A 4M4SA 2BP7B 5D3KA 1RCFA 2WD7B 3DMPA 4UNRA 4IS2A 1AXGA 2R8BA 1UF9A 4YBRA 3EVAA 5EHNA 4AX8A 4W5QA 1K0UA 4IIJA 3WRYA 2R8ZA 1BNCA 3A1TA 1N5KA 2IXTA 1RMQA 1FFDA 1FQJA 1GZDA 3ZHOA 3PFHA 1U4OA 3EEYA 2C04A 4ISCA 1NXWA 3QXSA 1N8SA 1I3MA 4WCFC 2Q62A 2WDZA 2V6MA 3HY3A 4R9UC 3AKZA 3Q8LA 1C7JA 5CH8A 4C0JA 4J1QA 1ZGZA 1U2EA 3V9PA 3W8NA 5KYGA 2DPYA 4RF4A 5IHPA 5IJ7E 1YQUA 1VE9A 1PR1A 3IQZA 2WSMA 3EG5A 4DDUA 1GRVA 3D3QA 3OQ1A 1O9GA 3I8OA 4D6YA 1DJPA 3C1TA 4IFIA 2R2AA 4W82A 1T5TA 1ZXBA 1YR1A 1SQSA 1TCBA 5MF6A 1Q14A 4O0MA 2ZANA 4BQPA 5I8ZA 3BGIA 1K4YA 3KWJA 3OMLA 3W8DA 5F21A 3NFYA 1ORHA 4C6HA 3JQ8B 3T4PA 4PF1A 1E9CA 1P2BA 3AY6A 3WGGA 1N7JA 1SPBS 1I5RA 3DUFA 3IMEA 3NM6B 5I8PA 4AVYA 4DJFC 3HVRA 1IN1A 3ILSA 3O2SB 4UOZA 1VPDA 4QU5A 1FXWA 3C85A 1WDTA 4ESEA 1TDJA 1C4KA 3GT7A 3K4HA 2R4TA 3DW3X 3E22B 3EA4A 4I0WB 4MR9B 5HIMA 3C5CA 5TF4A 4E07A 4CM5A 4ZT7A 2BHTA 2ORWA 4FD3A 2GN4A 1QYRA 3U80A 3OZXA 3VHXA 5JZSA 2JAQA 1GDHA 2DUWA 2YCLA 2JVJA 2GZDA 1YCFA 3ZIUA 1JJFA 1TLFA 3GZTB 5ERGB 2PSDA 4CFYA 3K2QA 4JBYA 2A7XA 3EN0A 1MQAA 3CF4A 4FOSA 3TTWA 4DB4A 2A9OA 4CM8A 4D43A 2QLLA 4MRNA 5IRCD 2O2IA 4X9XA 1Z4LA 3D64A 1PJRA 1O5TA 2VYCA 3CPSA 4GKKB 3DE7X 4ND6A 4WLEA 1AQUA 2I1VB 4CLHA 5FUWA 3F74A 4UE3S 1I7DA 1B3BA 2P9UC 4XM1A 2UZXB 3DR3A 4FVTA 1WNTA 1VCMA 4KLNA 2DHEA 2VT7A 4KRGA 4F4FA 2FU5C 3UMVA 1L6IA 4E2YA 3SJZA 1JQBA 4NLLA 3RANA 4AB1A 5FLKA 2AK2A 3EJWA 2WYIA 3HS3A 3IPRA 5CXCB 2JCGA 1ESZA 5JY1A 4LRXA 2FWAA 2J9XB 4BQSA 1O0SA 3QEMA 3E7PA 4WX2B 4XARA 3BHNA 1XZJA 3M5WA 3TKYA 3Q72A 4B3CA 2H4WA 4PC1A 2RGEA 3NGXA 4Q34A 3TIIA 2HCTA 2QRPA 2V4UA 4II3A 1KSHA 2DOKA 2WKQA 4UASA 4HYTA 3AO0B 4HEA6 4MQ4A 3DV0B 4F5WA 1US8B 1XQ1A 5FPSA 4HSEA 2Y76A 3BZWA 5HIAA 4MCJA 5IT5A 4ND8A 1OI4A 1P44A 2W6IA 2EVWX 4JAVC 3B6EA 4LV5B 4YAGA 2J56H 5CTAA 4MQUA 1IB0A 1CUVA 4PG4A 4Y6LA 2C7QA 3BXGA 4DZTA 2W5UA 2GPTA 2IUYA 4AN0A 2AFIB 1SQGA 3RBXA 3BIFA 1AE1A 5CB0A 4UMFA 3H1PA 4ZEVA 3OCXA 5EIEA 5ANRB 5JAPA 2XD9A 5CHEA 1U2VC 3CS3A 3O3NB 3N8HA 5EARA 2QVBA 2HPZA 3W4JA 5IJ9B 1FBTA 1EKXA 1UEIA 4GOMD 4JBLA 1RRPA 1F06A 2PIDA 4Z7QA 2ZSHA 1GPBA 3ZPXA 3LNTA 1X1DA 4ZI7B 3KB6A 4PYKA 2WVAA 1LJ8A 1DQSA 2PMEA 3FAKA 2AI2A 1KJWA 1W52X 2HSJA 1IL0A 4RCVA 2X6TA 1QFYA 2IHJA 1J5XA 3UM9A 1P0PA 3TZKA 1CUWA 1F3LA 2WHEA 3L84A 2JCBA 4FC6A 2FFHA 4A1FA 1VE7A 1S4MA 2X2FA 1B8UA 4BRSA 2X5XA 1JYFA 3GT4A 1RQPA 1DBPA 3W7VA 4BL5A 4DLWA 5D86A 4HAWA 1EUDB 3NWEA 2OCGA 3L7KA 4B80A 4W5TA 2VDPB 1NVAA 4YB8A 3CJTA 5DI3A 2CVQA 2C9DA 2E4YA 2B4AA 1DAHA 3D31A 2GQ0A 2NN3C 1ZH8A 1GQRA 3QVGA 2G1KA 4AK9A 1AGPA 4WSOA 1SVIA 4K26A 4WOKA 1K8KC 3OW8A 4KYUA 1M54A 4BUJA 3F6PA 3RF7A 3MRTA 4EWRA 2OC4A 3OWHA 3AFGA 3FUWA 4FSHA 2VDQA 2FHSA 4BDTA 2H7VA 1D2MA 4F2GA 5CITA 4Y1FA 2ABWA 4CLRB 3WNQA 3I3SR 2BFMA 4D4KA 3UAZA 1BKYA 1BA2A 1U2GC 3WL6A 4F0JA 4IIGA 4FT2A 5HYVA 4G89A 4TKMA 1W1WA 4YMHA 2RJ3A 3C8MA 1KC1A 3STYA 4POAA 2VUIB 3MT8A 2B4TO 1KFBB 4ZOQI 1SXIA 3O2JA 1JJ7A 4U7DA 2FZLA 2GBGA 2E9SA 2EFCB 2NZWA 4YUYA 4EHJA 5E2IA 1NVTA 3W9BA 1L7PA 2IYYA 5E7IA 4YAWA 4LQDA 2YWCA 1Y5NA 3GNSA 2R96A 1P9WA 4DRXA 1IY1A 1GFSA 4GPTA 3O4IA 4ZYUA 4NESA 3GLRA 2GI4A 4F60A 1DB3A 3WYEA 3GEGA 5J59A 3G8DA 1XN1A 5F3RA 4C2TA 5KAPA 3W2GA 4ZQIA 1MABA 3JAMA 3CEAA 4EJ2A 1VYUA 5EE9A 2R87A 1IVYA 3KFXA 5CUQA 1TMGE 3A4YA 5FPHA 4DMLA 2FWPA 2NO1A 5LN1A 1OX4B 5FNZA 1NI4A 2Q3BA 4LUCA 1Q0SA 3A2NA 1W34A 1T4GA 2E4AA 4YT4A 4UC0A 3NDIA 1K66A 3ZG6A 1Z4IA 5FLXg 1KH1A 1NNLA 2AN9A 2ZRJA 2PS3A 5K8UA 5IMBA 3EIOA 4K9MA 4Z7NA 1WXGA 3EPJA 2A88A 1D6JA 3I7HA 3CX3A 4B6PA 3IHTA 1KI4A 1NWHA 4LRUA 4UQLA 2AKEA 1U1FA 1K1EA 2RH5A 5CB4A 2QWXA 1SUFA 4R8RA 3RU2A 1PUJA 3GDHA 2FA9A 2YUTA 1I8TA 4XJXA 5BNWA 2WIGA 2Z8YM 3TRIA 2WM2A 3FI9A 5A4DA 1K06A 1ILWA 3KX2A 4ZCRA 1Z39A 4XYMA 3T54A 4KO1S 4BU1A 2VZ3A 3UN1A 3KC2A 3JAKB 3SMVA 1JI3A 2N1MA 3Q6IA 4BMDA 2PUEA 1G59A 1PW7A 1D9XA 2GJSA 2H07A 5EEHA 4FNAA 5G3YA 1YQEA 4P08A 3VR3D 1M6HA 2OZLA 3PSCB 2Y93A 4EEXA 4YVDA 2HFKA 4BLPA 2RBKA 2WM9B 3FVVA 2JLCA 4B2YA 3P9PA 3UWKA 3IJEA 4HB0A 3UMRA 2AZXA 3QU7A 3ZV4A 4J29A 2VBCA 3NXSA 4HLQB 4A0FA 1N9ZA 2QQ0A 1N8KA 2R2GA 4NK4A 1WEHA 2HMYB 3N76A 3OOJA 2BGIA 1Y3HA 5BOSB 1XN4A 3JZGA 1UKVY 3BWVA 1J8YF 1WZNA 4EP1A 5JAQA 1TQHA 5H14A 2OK4A 9GPBA 1G19A 3NMUF 3LWDA 4JI3B 4PFKA 3ZW7A 4I55A 3F46A 1GIAA 1XRRA 2BMJA 3E81A 4B6JA 4LNAA 1PFKA 1W88A 3RT7A 3CNHA 2CT8A 3RC9A 4UU0A 2OVRB 2DPLA 3QVXA 1DEOA 3UGKA 2NOAA 3RSHA 1UJ4A 2G7MC 1GPJA 2Z57A 1SBTA 3OCUA 2OVFA 1F7VA 1Y8AA 1U7UA 3T9AA 5E8JA 1L5NA 5IM4F 2JJMA 3VR5D 2MMCA 3QEBZ 2F3RA 3Q11A 1U9YA 2BDEA 3P4UA 3WE7A 1TAQA 1YZYA 1V9LA 3O4HA 4WA8A 4UU8A 2HU5A 1ENYA 1JXMA 4DPLA 1HLPA 4NBUA 3SHWA 1ZNWA 4PBYA 3EFBA 4BWVA 5K8CA 1A27A 5BN4A 2QRUA 2OXEA 1GQSA 3EMBA 1GU0A 3T3DA 2WTAA 4O4HA 2BZ0A 2IHBA 2Z95A 3JQGB 5ER9A 4LMPA 3MJEA 4AI6A 1WDLA 1QTRA 3OURA 1XTBA 2GF0A 3MGCA 3L0IB 3OEED 1W36B 3K9CA 2WPNA 1GSOA 4X1OA 2SKEA 4V3BA 5BMVF 3AR8A 4EF4A 4CCSA 3JQBA 4RPGA 3EEFA 3I12A 5EI5A 3I39X 4P84A 4FEYA 1Q21A 5BXQC 3MTIA 1TF5A 1NP6A 3K1JA 4XWWA 4UTZA 3O8OA 1ZUHA 3WLNA 4HDRB 2B9VA 3C98A 1Y6ZA 4N7MA 5B4TA 4PZ9A 5K1CC 1QK3A 4FEEA 4JH0A 4LS3A 2PUWA 4D9HA 5HE9A 3W9UA 3IE1A 2LKDA 4IQ8A 3HA5A 1PJ2A 3LBFA 4CTMA 1GLNA 1GKKA 4OAQA 2EKQA 2G0NA 3F98A 3NHUA 4RTNA 2DWQA 5JD4A 3I1YA 4PHFA 4L3GD 4MOWA 5JXJA 1UBCA 5A7HA 3D6MA 1NGSA 4Y1RB 2HL6A 4PONA 3WYDA 1VSBA 1H8ED 1Y1SA 2G07A 2W6PA 4UZEA 2RK6A 4DA0A 4OXYA 2IPAB 4D9KA 1FDUA 4WKNA 1E6CA 1H3NA 4BMXA 2GN8A 3E27A 3WHKA 4X7PA 1PYDA 3ROGA 1NQVA 4XXHA 4MCIA 3REGA 4QDKA 4FQ8A 4ZT6A 5LFAA 2YJ6A 3GVXA 3HQ4O 3B1JA 3WTCA 4NMXB 3WFIA 3HUDA 1UODA 3DHEA 1UBGA 3I76A 5DM60 2MINB 1LJUA 2QZJA 4EEZA 1UANA 1G20B 1MTOA 5KQMA 3DFUA 5JMWA 5AJYA 1VSTA 4O3MA 1IN7A 2FWIA 1LRJA 1C8KA 3AVVA 4BP9A 1X1QA 1ECJA 3N39C 2IUFA 3DBRB 1JQ3A 3RAJA 3WGVA 3LUBA 2XQKA 2GVNA 1E96A 1EXVA 5KBYA 5IHXA 1YAJA 1OVGA 2G1JA 3WLSA 4FE7A 2VJQA 3UYKA 4HJXA 4BBAA 4MJ7A 5I9SA 4ZA2A 4DMUB 4XIIA 3T7CA 3B7WA 1BC5A 4Y3UA 4HDMB 3OL2A 4WXEA 2VJAA 1C1YA 3EIWA 3MD9A 4BZPA 1QLHA 2CYAA 3M9XA 4OYHA 1E6MA 1GTJ1 3TSZA 4ERNA 2OCKA 4ZOZA 3DDWA 5KVSA 3G89A 3V1UA 4KQCA 1MC8A 4MV9A 2VH5R 1PJ3A 1DC7A 1E2HA 2J1LA 1PQWA 3T5PA 1HFWA 2FK7A 8MHTA 3ZTYA 1OWLA 4GBED 3Q8XB 3EE6A 2XB4A 3CG0A 4JA0A 2P79A 5JYDA 1DAMA 2XNCA 2HJSA 1GEGA 5CURA 2LR0A 2ZWPA 1NVBA 1JW9B 4DAEA 2I9KA 2J0SA 5G02A 3A9WA 3T7DA 5DYGA 3CNNA 1HDRA 1VSUA 2Q4OA 2IYNA 3DD5A 3L0YA 4CMEC 5DSTA 2BFEA 3OIVA 1BMTA 3P0RA 4PZYA 1TUBB 3G9XA 2MSNA 4E11A 1V6CA 4G0ZA 4ZGBA 4EGAA 3TS1A 4DTCA 4LVUA 4B31A 1WNFA 4JYBA 4LYDA 4ZCQA 2BJWA 4ICIA 1SJ9A 3AKYA 1KJNA 3IUEA 1NBAA 4QGGA 4B3BA 1QNFA 4Z0HO 1F4VA 3BD7A 4N03A 2FW9A 4BO9A 1PUIA 2IOFK 1EP1B 1AX9A 1YS6A 5TVKA 1C9LA 4E6EA 3R77A 2ZPUA 1VB5A 3IT1A 1QBKC 2YYZA 3RVNA 1M6NA 1Y9ZA 3CT6A 4C2BA 4PN3A 4NBMA 4RLQA 5EJFA 5FQNA 2F3UA 1TUGA 3CKYA 1A9QA 4LFAB 3CM0A 1RI3A 2I2AA 5AHKA 3C3DA 5HBRA 5C7YA 2I0SA 1GPDG 4CODB 3NIDA 4NE2A 2VF5X 2WSSD 5AT1A 3VR1A 4IV0A 2YW2A 1E77A 2MYNA 4G1MB 2JAWA 4H16A 5FBLB 1XG5A 1R0ZA 1TFUA 1M10A 2DUJA 5DMHA 1ICEA 3TLYA 3BXOA 1GV0A 1W85B 3GGCA 3RS8A 1IONA 4W5HA 2HA6A 1NE2A 1LV7A 4HNAA 2VWHA 3PPWA 4Q19A 3OPYB 3DFKA 4UMEA 2ECOA 2XL3A 3RHZA 3GVCA 4R7AB 5BWBA 1CDZA 1ZC3A 1QOZA 4AZVA 4DQKA 1LDMA 3OZGA 5LZ5A 3EA0A 3IOEA 3OZWA 4WDQA 2OFFA 1TU3A 2PXCA 2XMRA 3KUKA 4Y1GA 4HDCA 1FIUA 4QOHA 3V7FA 1JIXA 2NU9B 3FR8A 2RSLA 1SVLA 2R4UA 3K9BA 4W9MC 1ZI6A 3OJ0A 1AS3A 4KFRA 2O7RA 4LC0A 4AJ9A 4AY6A 4C7XA 3S1AB 4L0MA 1MO4A 2QX7A 2PBFA 4C4PA 4QSHA 2XIQA 3C24A 1BS1A 3MAGA 4GM0A 3F9CA 1YONA 2PS9A 1SIBE 3R9WA 1SXHA 1GQFA 1X1AA 2VTKA 2OCYC 4HZIA 2VCYA 5F1OA 2GFIA 3DV9A 1VA5A 5AW2A 1XZ8A 3AF5A 3J7TA 3DAYA 4H5IA 1RI6A 5BSVA 1DRWA 3ROFA 2D1TA 4NPAA 1V8BA 2OEPA 1Q20A 2Y1EA 3KWMA 3I6IA 3CLUC 4PCLA 4BC1A 1NUUA 5FT9A 3V4VB 4R3NA 4OQLA 3NIGA 2FPMA 3GJZA 1P45A 3B7FA 1TM4E 4RPHA 5C3MA 1YRQA 2BEKA 4BN0A 3S2ZA 3DA8A 1BE8A 4ZC8A 5I9TA 2AFHE 3B1FA 1CEXA 4A5OA 4H7JA 2PUJA 3UJPA 3ZCVA 2WWFA 1NRXA 3WNBA 2CL0X 1OUMA 3K8OE 2RHCA 4GMDA 2RAPA 3PYLA 5TDHB 1CV2A 1L0QA 2CJWA 1IOWA 4YT8A 5KS2A 1M6VB 1EEXB 4G1EA 5FWYA 5K19A 4BFUA 1XZLA 2Q8PA 1ID1A 2P4EA 2Q1YA 4ARAA 5AVTA 1IOZA 1USWA 4FDLA 3QQ5A 4XTRA 3A9CA 5KNCD 3DBHA 1EXWA 5A6SB 1YGYA 1UK8A 3AF1A 2PSEA 3OWXA 2FX3A 2VH2A 3FOWA 5A0VA 3KLPX 3EDMA 2CUTA 2HMVA 2EX0A 1EYZA 4LCBA 1A5ZA 1Z6XA 1OGYA 4G81A 1NJ1A 3ZYZA 3VUEA 3ZZUA 3EFEA 3PUZA 5SYNA 3W5BA 5H9WA 5KOHB 2Q0HA 4YA6A 4EB3A 1JXQA 1QHGA 1BCRA 4B79A 2OHFA 3ZWOA 3U16A 3PXCX 3AW8A 4MV6A 3I1JA 3C2QA 1EBFA 3A3NA 1HFJA 4QLOA 1D2GA 4RD1A 3ZDQA 3PPXA 2RB4A 4MKFA 3W6PA 3OZUA 3NHAA 4XH9B 4INJA 5JE8A 2AB0A 1L9KA 2HLDD 2IEIA 2CMFA 4QSMA 1UKYA 4C78A 3G23A 3RTBA 4KVZA 4WY8A 4KH0A 8ABPA 2NVUA 3VZBA 1H93A 2VP0A 2XVYA 4HQNA 2I6TA 3HJTA 4XYLA 4YP6A 4XWTA 1GAQA 5ALVA 1L4YA 4EFMA 3QJ5A 2PM9B 5JSZA 2DY1A 4I1VA 4RZQA 2O8BB 3UMFA 1G17A 4O4IF 2KJQA 5AUPB 1TF7A 1INLA 2IV7A 1DKQA 2H6QA 3LY8A 3QRWA 2RE8A 2QJRA 4CCAA 3H9QA 3L8EA 2EG9A 4RFSB 4IDAA 2AR7A 4IBOA 4MTCA 5K1ZA 4P80A 4ZEXA 5I45A 1MB9A 3P1JA 1V8FA 5THQA 1Y8QB 1T8TA 4DWJA 3C1OA 3VKFA 3I32A 3EVDA 3HI4A 4MGKR 4FW9A 3A25A 3UW1A 5EJ2A 4OKIA 2NU6B 2OLJA 2FZVA 5JDCC 1FRFS 3L02A 3GLVA 1GNPA 5JADA 4EY5A 3L4KA 3J81A 2CHFA 3GWZA 4G3XA 1L5OA 4YRTA 4Z4HA 5HRAA 4S3MA 1OR8A 1T0BA 2X13A 2COKA 2PX6A 2HPHA 4V1CB 5FNVF 5B5SA 1I51A 2W58A 4ZOAA 2ZXEA 2BF7A 1H2HA 1RQRA 4Y7RA 4G1UC 1K3IA 1Q5PA 2GBLC 3R5TA 4YIHA 4HGRA 4HOYA 4WY2A 1W1UA 5CH5A 2AVDA 4UATA 4D8TA 5F52A 1GAJA 4JI8B 2HXGA 2FWMX 2HIHA 1U28C 3VOBA 3BMNB 5KOIA 5LXTF 1D07A 3SXTD 3RVSA 4WKOA 2V8OA 5FPYA 4KFUA 3DTYA 3QXXA 2ARKA 1A3CA 2XVXA 4EKGA 4MWTA 1KPIA 5FA5A 4KWTA 3CG4A 3JQQA 3N2KA 4CKBA 2X4GA 4WXPA 4CIXA 4AJ1A 1H2WA 4JODA 2YV2A 3F73A 2YHIB 4QHSA 5T4EA 1RWBA 1A98A 3NVXA 4UW9A 1ZNXA 2G36A 4RIIA 2QROA 4D74A 1H2AS 1FB5A 4MCHA 4K6HA 3ZTTA 1G9XA 1F0NA 3V55A 2J9YB 3I8CA 4ZVSA 8AT1A 1RYMA 3UFBA 1SC1A 3ZK8A 3IKTA 4I4NA 3T0GA 3EOZA 1XNGA 1Q77A 4L8WB 3ZVNA 3ZHQA 2FQXA 5LM3A 2EZ8A 4FYVA 1IUKA 4DKXA 1OIVA 3NWJA 4DLSA 4Z4EA 1M2VA 2XUKA 3W2HA 3C8UA 2CLLB 2YS6A 5H68A 1U31A 4GZ3A 1W0JA 4ZU3A 5BN3B 2X8JA 2HRQA 2IYXA 3ZWVA 1JIIA 1U0LA 5ED0A 5MN4A 1T9HA 3G0CA 1W7AA 1YB7A 3QW2A 2AUTA 4XJVA 2HKRA 1GAWA 1J8DA 4DIKA 3KRXB 3BSYA 4BECA 1K5PA 1XB2A 5C92A 1SQFA 2VDRB 5A02A 4WD3A 1JBEA 2D2XA 5CRIA 4DRYA 1Y1QA 3HYTA 5JCOA 1WRBA 3A4TA 4N8SA 3VYRB 2EHDA 3MWLA 4IMJB 4DCTA 4JC8A 4G1BA 5TS2A 3DZCA 1JH9A 3CT4A 1EWVA 1HQKA 1R5BA 1QK4A 4Y5RD 3SG0A 4LTMA 4FR5A 3A2LA 1I7PA 5BW5A 4W7HA 4ED9A 2O1SA 1QO0A 2GCNA 5AWFC 4UDXX 2Z4RA 2PTHA 3BXHA 2WKRA 2PGAA 3VZRA 2CVFA 4IQ0A 4DSZA 3GPIA 1GPWB 4BP8A 3TB6A 3AHCA 1CWUA 1W9HA 1L7BA 1J23A 4AJOA 1V95A 2NO4A 1V16B 4PIPA 3TZLA 4LJ5A 3MQFA 2XKKA 2J6BA 3A6HA 1KDYA 1X2BA 3ROMA 3OH8A 4MRMB 2PM6B 5B6IA 4OQFA 1I7QB 1C3VA 5HQTA 5JYEA 1OD6A 1C3JA 1UWCA 2PQ6A 4J91A 9ABPA 1VL5A 2ZI6A 2ZVQX 3RSQA 4MV7A 3BMOA 4DLAA 3I0MA 5HDBB 3TTUA 1L1FA 4LTNA 3WGNA 1WCV1 3QTTA 2UU9B 4CKCB 4KPUB 4AMYA 1JUDA 3C3AA 4J1TA 2ZIFA 3LUDA 3TXXA 4RH3A 1SVWA 1IAQA 3S7TA 2JDID 1IBRA 5E8RA 1SKUA 1XTKA 3DZDA 1N5LA 5D3ZA 2C07A 4UDOA 3KDSE 3RAEC 2X14A 1J25A 5LP6C 2DLNA 3EW9A 5CEEA 1GD1O 4AO6A 3CKLA 4H6WA 3UWPA 4HRXA 1OREA 1TZCA 3EIEA 2R6ZA 2N46A 3SICE 3QITA 2IYEA 1U7HA 3GROA 2H2AA 3VR6D 3P19A 1P8AA 1VZ3A 2AG8A 3NIFA 4ZAZA 4OHKA 2NZVG 4G4JA 3IRVA 4Z9YA 4WW0A 2C4MA 4QDOA 1IJKA 4G97A 1IQPA 2XA9A 2IE8A 2ZJ7A 1YQXA 4C4XA 2IHTA 5CU7A 3EFOA 4YRJA 2AG1A 2Z30A 1S3IA 3HL0A 2X1HA 4GVXA 2G63A 4HVLA 4U8HA 3KLBA 3LC1O 4HB4A 4TWRA 2QQ5A 3ZCQA 4U7GA 821PA 1RP1A 8OHMA 3FY4A 5F2NA 3PKZA 1L5RA 2JJ1D 1RJ9A 2PN1A 2DM6A 3NHSA 1OYWA 2HB6A 1M1YB 4BMNA 5E4YA 4I9UA 1M0EA 3ZVLA 1FFGA 2ID9A 3JVEA 3JZNA 5GXHA 1DRVA 3G9ZA 2VJCA 3W1VA 3GD7A 1EVJA 2V97A 3ESZA 1BZYA 4HFRA 3ZWCA 4D3FA 4L8LA 4AWBA 4GSYA 2IEYA 1D7OA 1U7ZA 2I4NA 3TNDA 1VL2A 2XTAA 1QDLB 3RVBA 4PNPA 4BNXA 2ORIA 4LOLA 1M7BA 2JVIA 3OEHA 1ZNYA 5MGNA 4QARA 2O8FA 4GT1A 3DLBA 3K53A 1QQAA 1V5GA 4MW9A 3LQRA 1GUDA 3A31A 1EXDA 5CT8A 4KREA 4G24A 4LZAA 2YH2A 4RF3A 5HZGA 1TCCA 1GYPA 1CCWA 3R3XA 3GJ0A 1HE8B 2EHJA 2X0NA 1TECE 1L6RA 1YKSA 5EP1A 2XB2A 4ZYYA 1CR2A 5CG1A 1JLRA 1FOEB 3H8JA 5I5EA 1BSVA 2NXEA 2BFBA 1LWNA 3TW8B 1AKYA 4X90A 3PGMA 4RW0A 5CFRA 3LT4A 1XQ6A 4M83A 3SQMA 4UPDA 3RN0D 4FK8A 4M1YA 1JRLA 5TIIA 2CLKB 5EXPA 2V0GA 4NE9A 1MRZA 4Z86A 4JLWA 2HADA 3N58A 1NSFA 1NSYA 5EJ9A 2FYTA 5JMPA 1V7CA 1TT5B 4C0KA 3C97A 3N0VA 1RTTA 4N9WA 2YRWA 4GAEA 2PMDA 1RXCA 4QOJA 2O8VA 4YALA 4O59O 6Q21A 1ECCA 4NC4A 3I4LA 4PWYA 2P35A 3EMKA 5FJIA 1UWKA 1UC9A 1RI5A 5F7JA 4P36A 2IXDA 4CY1A 3RHFA 1GG9A 3DO8A 1KTVA 1M8FA 1ST3A 4IY1A 1SKYB 1VC2A 3R0XA 4KN9S 1LQUA 4IFEA 5CA0F 1JLMA 2QYOA 3UOAB 2H08A 3QU5A 3KU1A 3SXJA 2CUZA 3E15A 3CLSD 2OXTA 3F3MA 3EVTA 1OYVA 1KJYA 1S8AA 1KSGA 2H8GA 5KQSA 3SZRA 1XLTA 1SEVA 1AHPA 4E30A 3K26A 2HYIC 1EFDN 1W5AA 2XGSA 1KQNA 3L4BA 5K0ZA 3LQFA 2R3SA 2KQUA 1KO4A 5A2Qg 1A2KC 1SA0B 4EQZA 3VFDA 5GGYA 5JS2A 3BWYA 4ZOLF 1D1PA 1SZPA 1C0KA 5EKTA 4GFDA 3CZ5A 4FU0A 4YTEA 5ABPA 4KXLA 3EAGA 2IUUA 3WYNA 1QKJA 5EKSA 3OJEA 1ECPA 4EYGA 3NT4A 1K6JA 1WBJB 5KQLA 1DVRA 2YJTD 4YPOA 5HG0A 3EEIA 4K87A 2VP5A 4Q6WA 4YQEA 1KYIA 3KTOA 3UY4A 4R1LA 1H6AA 1LK5A 3KPWA 3NGLA 3D5QA 4OMUA 3IVRA 5JXHA 1WW2A 4NZMA 2GO1A 2XXAA 1G5QA 4BLTA 5JSHA 2GRAA 1Z5PA 4MI3A 2HJWA 3AJEA 3N2LA 5CVVA 4U2EA 1JIKA 3CCBA 3OKAA 4NH0A 5K6RA 1TU4A 1FLAA 4NOKA 3K0KA 2CXRA 2NUBA 1HEIA 4CM4B 4Y7CA 2ZI4A 1VXRA 2MR6A 5LYJF 5GIOE 4R05A 4HP8A 4HNVA 4FYWA 3FZQA 4OI4A 1A77A 3KOOA 4BKQA 4CKWB 3EG9B 4D4GA 3PXXA 3C14C 1GP2B 5IW8A 1AQLA 1IBLB 4F3CA 4C87A 2ET6A 2FZEA 5ER6A 4CI9A 3CONA 4AO7A 4C1BA 1VHTA 1TEXA 4IEIA 1WQ3A 2AFVA 2ZM6B 2ENUA 4TYYA 2PGXA 1ESCA 1ECBA 3CEHA 4IEFB 5B4UA 1TO1E 1P5HA 3E7FA 5TB5A 3O2QB 4TSKA 1EUQA 2EAUA 2GERA 2C61A 1A88A 2FPPB 5TGDA 1QCZA 3I92A 2DFDA 3G2QA 3I9MA 1RHKA 5AI8A 3PGA1 4MGYR 4FXOA 1RE0A 5K6AC 2EJBA 4DCNA 4I4TF 3P2IA 2XEXA 3UMJA 4BQIA 1XAGA 4EUNA 1PW5A 5LUBA 3OJOA 5KYWA 4FGLA 1E5QA 2MSCB 4CCWA 4FHLA 1IWOA 3F7NA 3BWXA 1SUEA 2R8OA 4EPTA 1U1DA 3U62A 5HUJA 4IXWA 2VLBA 4YASA 2YFYA 3F78A 1CQJB 2IX9A 2IU3A 4XWYA 1TW2A 1J1ZA 1YOBA 4KGXA 4YS6A 1EZZA 3NWPA 4YT5A 3IA2A 2VXBA 1MEEA 2ZIGA 2QRVB 3T38A 3H9CA 2ZWOA 3UG6A 2H17A 5KTMA 1LLCA 1GA1A 2YX1A 1T4CA 3H42B 4ES6A 1IK6A 5ICFA 2NV0A 5D6NA 3GJTA 2K7ZA 1UP4A 4IA9A 2YQZA 1O77A 2V58A 5GV7A 4EOGA 3KKNA 1QZXA 1OKKA 1J90A 4X20A 4TMFA 4DR4B 2R6HA 2ZRFA 5AI6A 1GXRA 4GZ6A 3U7FB 2O05A 3DSMA 3SZGA 4B7XA 3ROZA 3EARA 1XMXA 3DCJA 4C7JA 4M0DA 1FFSA 2Q0XA 4B0PA 3LC2O 4FFLA 1PX0A 1W5FA 3F47A 1GG8A 1QSGA 3E70C 1GCUA 3SC3A 3VKGA 3DEKA 2F8LA 3MA0A 3LUAA 5G3ZA 4PAOA 4I1PA 3DP7A 3Q1KA 1ZKMA 3LLCA 3K2BA 3LWBA 1GV1A 2OA0A 1Q50A 4F4DA 2VL7A 2D4AA 4B4UA 4Y2TA 1MJGM 1UJNA 1RWPA 1RDFA 1OWPA 3T5BA 4OOFA 1NYLA 4FNGA 4PO8A 2KSQA 4H7IA 1X1CA 3WMWA 1UKCA 1NR0A 3R0ZA 4HLUC 3VYSB 2DR3A 3BEDA 3C6BA 2OYRA 5KZMB 1NUTA 3B9QA 3ETEA