5FXYA

Structure of the human rbbp4:mta1(464-546) complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
402
structure length
381
Chain Sequence
DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPNLSGHLLSASDDHTICLWDISAVPGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the core NuRD repression complex provides insights into its interaction with chromatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords HISTONE-BINDING PROTEIN RBBP4
total genus 80
structure length 381
sequence length 402
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fxyA00
2AGYA 3V7DB 2H9LA 3VH0A 3SBRA 1XKSA 4JXMA 3SCYA 3I7OA 3UVKA 3OKYB 3IIWA 3I89A 1L0QA 2OVPB 2XL3A 5C2WB 2OVRB 1MG2A 1PBYB 3EI4A 3UVNA 4CZXA 3RRMC 3EI2A 3I2NA 2OK6A 4AEZA 2P9SC 2H14A 4ES0A 4ZOYA 2I3SA 1GXRA 2B5LA 2Z2NA 3RFGA 3F3GA 4A08B 5JWZA 5IC7A 2AGZA 2CO0A 1SHYB 4J87A 1NEXB 4R7AB 3ULEC 3NVNA 4JSPC 4PSXB 4BH6A 3F3PA 4E5ZB 3SBQA 4FA9D 4JSNC 2W18A 3AFCA 5GMKn 3AL8A 2AGXA 2OK4A 3PVWB 5CXBB 3EI3A 3VGZA 4LGNA 2I0TA 2P9PC 3PXTD 5CYKA 4GZ8A 3J81g 4J84A 2H3XA 2MTAH 2HXCA 4A11B 1XIPA 3MZLA 2Q7QA 2P9UC 3NVXA 3GREA 4EWRA 2TRCB 5I5MA 3SBPA 4H5IA 5FA5B 4A0AB 3EU7A 4J0WA 4Z8LA 3IJCA 3UVOA 2G9AA 3DWLC 3BWSA 4LG9A 4J86A 1JMZB 4X63B 3F3FA 4PSWB 4GQBB 3JZGA 1B9XA 2H9MA 3J80g 4ESGA 1PI6A 4A08A 3JPXA 3JZHA 3I8CA 2YNNA 5EM2A 3PXSD 2YNPA 2AGLA 3RMZD 3C99A 2IUVA 4BL0A 2I3TA 4J8BA 1OMWB 4QQEA 4U7AA 5CXCA 2CN2A 3C9CA 2H9NA 5EAPA 3I7KA 4JSXC 2CO0C 3MXXA 1U2VC 3FRXA 2HESX 3AL9A 3JRPA 5I5JA 5I5IA 4ERZA 4ZN4A 4D0KA 4ERYA 3AH8B 3RSEC 3VA6A 3EWEA 3A0FA 4FA4D 5TEFA 2AGWA 4AOWA 4K3ID 4BUJC 5IT9g 2PM9B 4X3EA 2I0SA 2J57G 5IJ7E 3C75H 3UR4A 2HKMA 4FAVD 4IA9A 2QC5A 5FQDA 2H6KA 3EG6A 3DXKC 1OLZA 4O3UB 1SQ9A 3OL2A 4QT8A 3SLED 3PVUB 4ZOXA 1VYHC 3OKWA 4PBYA 2P9KC 2YBAA 2PM6B 4UI9R 1N6DA 3K26A 3MMYA 3C5MA 5FKQA 5GXIA 3GFCA 4CY3A 3CFVA 5H1MA 4CZVA 4LG8A 1XHMA 3K27A 4O3TB 3UVMA 3SWSD 5KDOB 2CNXA 5IJ8E 1GOTB 1NR0A 2XU7A 4FAND 2XL2A 4CZYA 3JAMg 4QRJA 5K19A 4IMMA 1JOFA 3SVWD 4A2MA 4GQ2P 2P9IC 5EMKB 5HE2B 4ZOVA 1P22A 5THAA 3I8EA 4O9DA 3AL8B 4XEIC 4X60B 3EMHA 3PXWD 2GNQA 4E54B 4JD2C 4NSXA 2CE8A 5A2Qg 2H68A 4KFMB 4GM8A 3EI1B 3BG1A 4XYHA 3KRWB 2AH1A 2BCJB 3SJLD 3W15A 1Q47A 4G56B 5EALA 1QNIA 2YNOA 4J82A 3N0EA 2G99A 4ERQA 4A09B 5CXCB 3B7FA 3ORVD 2PM7B 3MKSB 3I7PA 2EBSA 2HYEA 4QL1A 3IKOA 4E5ZA 5EARA 5FKSA 4PBZA 1MDAH 2J56H 4CI2A 2YB8B 5IGQA 4FB1D 3EI3B 3RFHA 1PEVA 2B4EA 3JZNA 4CY5A 4GQ1A 4PNKB 2YMUA 2CE9A 2PM9A 5GXHA 3ZWLB 2Z2OA 4GMBA 4JSVC 5K1CC 4FHLA 4CC9A 4CI8A 3CFSB 3N0DA 2OIZA 5C9ZB 4GGAA 1GP2B 1JMXB 5B4WA 2AQ5A 5EMLB 5TDHB 2PBIB 4CY2A 4J77A 4J79A 5H17A 5TF2A 4A0BB 3RLMD 5CXBA 2HKRA 4CI1A 3MZKA 4Y5RD 3FM0A 4OWRA 5H14A 3I7LA 1R5MA 3SHFA 3I7NA 1TYQC 2HJ4A 2IWFA 3NVQA 4PC0A 5HYNB 3U4YA 4A09A 3IJ0A 3UVLA 4L9OA 5EMMB 4L3GD 1A0RB 3DXMC 5EAMA 2I0RA 3I7HA 4J73A 1PGUA 3V9FA 5AJAA 5FKTA 4ZOZA 3E0CA 5EM2B 4MK0B 3PE7A 4GM3A 3OL2B 3JB9L 4GGCA 2HJBA 2H9PA 3IIYA 1U4CA 2P9NC 2O9KA 4J81A 1SQJA 4A0AA 1N6FA 2B5NA 1TBGA 4PXWA 1ERJA 3L4OD 2OVQB 2H6QA 3OKTA 3EI4B 4JT5C 5FKRA 3KRXB 5HE0B 3UKUC 2IUQA 5C2VB 5HQGA 4CI3A 2IURA 4GM9A 5HE3B 3SFZA 4I79A 5IGOA 5CYKB 2GC4A 3SMRA 3SN6B 3JROA 4X61B 2OJYA 4FA1D 3DM0A 3OTTA 5SXMA 3HFQA 4L3HD 2IAAA 4Y7RA 5GSAA 2J55H 3V5WB 4OZUA 3L4MD 4O1QD 5FXYA 3MKQA 3PSLA 5AMSA 2BBKH 3ODTA 4HDJA 4D6VA 1RI6A 4H5JA 1K32A 1K8KC 4K3JB 2H13A 2Z2PA 2CN3A 4J78A 2B5MA 4L1QD 3PSCB 3OW8A 2UZYB 4TZ4A 3UKRC 3EI2B 4GGDA 2QXVA 3FGBA 2GC7A 4A7JA 2UZXB 3RN1D 2H6NA 4J0XA 4JT6C 1B9YA 3SXTD 4A0BA 5FLXg 2IUPA 4YVDA 1N6EA 4A11A 2P9LC 2XYIA 2AH0A 5HE1B 3RN0D 2H47A 4XYIA 5EMJB 3OKYA 4N14A 4A2LA 1GG2B 1JJUB 4FA5D 4E54A 4CY1A 3P4FA 5AFU3 1S4UX 3CIKB 1MG3A 1FWXA 2IWKA 4J8GA 3EI1A 1YFQA 3IJ1A 4U1EI 5TEEA 3BG0A 4FWWA 4O45A 3DSMA
chains in the Genus database with same CATH superfamily
2AGYA 3V7DB 2H9LA 3VH0A 2VDNA 1JTDB 3SBRA 1XKSA 4JXMA 3SCYA 3I7OA 4DNUA 3UVKA 4WJKA 3OKYB 3IIWA 3I89A 3ZDXA 1L0QA 4AN1A 2OVPB 4WK4A 2XL3A 1E8NA 5C2WB 2OVRB 1MG2A 1PBYB 3EI4A 3UVNA 4CZXA 3RRMC 3EI2A 1GOGA 4NC4A 3I2NA 2OK6A 3MVDK 1QFMA 4AEZA 2P9SC 2H14A 4ES0A 4ZOYA 4BP8A 2I3SA 1GXRA 2B5LA 2Z2NA 3RFGA 3F3GA 4A08B 5JWZA 4BCBA 5IC7A 2AGZA 2CO0A 3GC3B 1SHYB 3VI4A 4J87A 1NEXB 4R7AB 3ULEC 3IULA 3NVNA 4JSPC 4PSXB 3T3MA 4BH6A 3F3PA 4E5ZB 3SBQA 4FA9D 1I2MB 2W18A 3AFCA 4JSNC 4Z7OA 5GMKn 4G1EA 3O4GA 3AL8A 2AGXA 2OK4A 3PVWB 5CXBB 3EI3A 1C9LA 3VGZA 4LGNA 2I0TA 2P9PC 4O02A 1K3IA 3PXTD 5M5RA 5CYKA 4GZ8A 3J81g 3K6SA 4J84A 2H3XA 2MTAH 2HXCA 5M5UA 4A11B 1XIPA 3MZLA 2Q7QA 2P9UC 3NVXA 3GREA 4EWRA 2TRCB 5I5MA 3SBPA 1E8MA 4L1MA 4QAMA 4H5IA 5FA5B 4G55A 3EU7A 4A0AB 4J0WA 4Z8LA 3IJCA 3UVOA 2G9AA 3DWLC 4WK0A 3BWSA 4LG9A 4J86A 1JMZB 3IUMA 4X63B 5C92A 3F3FA 4GQBB 4PSWB 3JZGA 1B9XA 1H2WA 2H9MA 3J80g 4ESGA 1GOFA 1PI6A 4A08A 3JPXA 3JZHA 3I8CA 2YNNA 2VZ1A 5EM2A 3PXSD 2YNPA 4MMXA 2AGLA 3RMZD 3C99A 2HU8A 2IUVA 2VDMA 4BL0A 1YR2A 3ZE0A 2I3TA 4J8BA 5M5VA 1OMWB 4QQEA 4U7AA 5CXCA 2CN2A 3C9CA 2H9NA 2VDRA 5EAPA 3I7KA 4AMZA 4JSXC 2CO0C 3MXXA 1U2VC 3FRXA 2HESX 3AL9A 3JRPA 5I5JA 4BP9A 5I5IA 2WQ8A 4ERZA 4ZN4A 4D9SA 4D0KA 4ERYA 3AH8B 3RSEC 3VA6A 3EWEA 3A0FA 4FA4D 2QZPA 5TEFA 2AGWA 4AOWA 4K3ID 4BUJC 2EIBA 1GOHA 3K72A 3GD1I 3IUJA 5IT9g 1VE6A 2PM9B 4X3EA 1U8CA 2I0SA 2J57G 5IJ7E 3C75H 3UR4A 2HKMA 4FAVD 4IA9A 1T2XA 2QC5A 5FQDA 2H6KA 3EG6A 3DXKC 3FCSA 4NENA 1OLZA 4O3UB 1H2YA 1SQ9A 3OL2A 4QT8A 3SLED 3NIFA 2XE4A 3PVUB 4ZOXA 1VYHC 3OKWA 4PBYA 3V4VA 2P9KC 3IJEA 3O4JA 2YBAA 2PM6B 4UI9R 1N6DA 3K26A 3MMYA 3C5MA 2VDPA 5FKQA 5GXIA 3GFCA 4CY3A 3CFVA 5H1MA 4CZVA 4LG8A 1XHMA 3K27A 4O3TB 1VE7A 3UVMA 3SWSD 3ZE2A 2JKXA 5KDOB 2CNXA 5IJ8E 1GOTB 1NR0A 2XU7A 1UTCA 4DNVA 4FAND 5E6UA 2XL2A 4CZYA 3IUNA 3JAMg 4QRJA 2XZGA 5K19A 4IMMA 1JOFA 3SVWD 4A2MA 5FFOA 4GQ2P 2P9IC 5EMKB 5HE2B 4ZOVA 1P22A 3FCUA 3V4PA 4O2WA 3QHYB 5THAA 3I8EA 4O9DA 3AL8B 3EMHA 3KCIA 3PXWD 2GNQA 4X60B 4XEIC 4E54B 4JD2C 4DNWA 4NSXA 2CE8A 4WK2A 5A2Qg 1H2ZA 2H68A 4KFMB 4GM8A 3EI1B 3BG1A 4XYHA 3KRWB 2AH1A 2BCJB 3SJLD 3W15A 2VZ3A 1Q47A 4G56B 5EALA 1QNIA 2YNOA 4J82A 3N0EA 2G99A 1UOQA 4ERQA 4A09B 5CXCB 3B7FA 3ORVD 2PM7B 3MKSB 3I7PA 2EBSA 2HYEA 4QL1A 3IKOA 1BPOA 3T3PA 4E5ZA 5EARA 3MUOA 5FKSA 4PBZA 1MDAH 2J56H 4CI2A 1UOPA 2YB8B 5IGQA 4FB1D 3EI3B 3RFHA 4G1MA 1PEVA 2B4EA 3ZE1A 3JZNA 4UM9A 4CY5A 4GQ1A 1E5TA 2YMUA 4PNKB 2CE9A 2PM9A 5GXHA 3ZWLB 3MUNA 2Z2OA 4GMBA 4JSVC 5K1CC 4FHLA 4CC9A 1UOOA 4CI8A 3CFSB 3N0DA 2OIZA 4AX4A 4GGAA 1GP2B 5C9ZB 2QR5A 4NBMA 1JMXB 1H2XA 5B4WA 2AQ5A 5EMLB 5TDHB 2PBIB 4BCCA 1JV2A 4CY2A 4J77A 4J79A 5H17A 5TF2A 3NIDA 1M1XA 2VDLA 4JHPC 4A0BB 1VZ2A 3QI0A 3RLMD 5CXBA 5C86A 2HKRA 4CI1A 3MZKA 4Y5RD 3FM0A 4OWRA 4AN0A 5H14A 3I7LA 1R5MA 1O6FA 3SHFA 3I7NA 4NAAA 1TYQC 2HJ4A 2IWFA 3NVQA 4PC0A 4IRZA 5HYNB 3U4YA 4A09A 3IJ0A 3UVLA 4L9OA 5EMMB 3DDUA 4L3GD 1A0RB 3DXMC 5EAMA 2I0RA 3I7HA 4J73A 1PGUA 2HU7A 5M61A 3V9FA 5AJAA 5FKTA 5E6SA 4ZOZA 3E0CA 5EM2B 4MK0B 4JHNA 3PE7A 4GM3A 3OL2B 3JB9L 3O4HA 2HJBA 4GGCA 3EQ9A 5M5TA 2BKLA 2H9PA 3EQ8A 3OF7A 3IIYA 1U4CA 2P9NC 3ZDZA 2O9KA 4J81A 1SQJA 4A0AA 1N6FA 2VDQA 2B5NA 1TBGA 4PXWA 1ERJA 3L4OD 5FFGA 2EIDA 2H6QA 3EI4B 3OKTA 4JT5C 5FKRA 2OVQB 3KRXB 5HE0B 3UKUC 2IUQA 5C2VB 5HQGA 4CI3A 4Z7NA 2IURA 4GM9A 5HE3B 3SFZA 4I79A 5IGOA 5CYKB 2GC4A 3SMRA 3SN6B 3JROA 1O6GA 4X61B 2OJYA 4FA1D 3DM0A 3OTTA 5SXMA 3HFQA 4Z7QA 4L3HD 2IAAA 3IUQA 4Y7RA 2EICA 3IVMA 1L5GA 5GSAA 2J55H 3V5WB 4OZUA 3L4MD 4O1QD 5FXYA 2HU5A 3MKQA 3PSLA 5AMSA 2BBKH 3ODTA 4HDJA 4D6VA 3IURA 1RI6A 4H5JA 1TYEA 1K32A 1K8KC 3EQ7A 4K3JB 4RE6A 2VDKA 4RE5A 4AMYA 2H13A 3O4IA 3VI3A 4BCDA 2Z2PA 2CN3A 4J78A 2B5MA 4L1QD 3PSCB 3OW8A 3ZDYA 2UZYB 5E6RA 4UM8A 4TZ4A 3UKRC 3EI2B 4GGDA 2QXVA 3FGBA 2GC7A 4A7JA 2UZXB 3RN1D 2H6NA 4J0XA 4JT6C 1B9YA 3SXTD 4A0BA 3K71A 5FLXg 2IUPA 4YVDA 1N6EA 4MMZA 2P9LC 4A11A 2XYIA 2AH0A 5HE1B 2VDOA 2XDWA 3RN0D 2H47A 4XYIA 5EMJB 1C9IA 1VZ3A 3OKYA 4N14A 4A2LA 1GG2B 1JJUB 4FA5D 4E54A 4CY1A 3P4FA 5AFU3 1S4UX 3CIKB 2VC2A 4MMYA 1MG3A 1FWXA 2IWKA 4J8GA 3EI1A 1YFQA 3NIGA 3IJ1A 4U1EI 5TEEA 5M5SA 3BG0A 1QFSA 1A12A 4FWWA 4O45A 2EIEA 3DSMA 5HDBA
chains in the Genus database with same CATH topology
2AGYA 3V7DB 2H9LA 3VH0A 3SBRA 1XKSA 4JXMA 3SCYA 3I7OA 3UVKA 3OKYB 3IIWA 3I89A 1L0QA 2OVPB 2XL3A 5C2WB 2OVRB 1MG2A 1PBYB 3EI4A 3UVNA 4CZXA 3RRMC 3EI2A 3I2NA 2OK6A 4AEZA 2P9SC 2H14A 4ES0A 4ZOYA 2I3SA 1GXRA 2B5LA 2Z2NA 3RFGA 3F3GA 4A08B 5JWZA 5IC7A 2AGZA 2CO0A 1SHYB 4J87A 1NEXB 4R7AB 3ULEC 3NVNA 4JSPC 4PSXB 4BH6A 3F3PA 4E5ZB 3SBQA 4FA9D 4JSNC 2W18A 3AFCA 5GMKn 3AL8A 2AGXA 2OK4A 3PVWB 5CXBB 3EI3A 3VGZA 4LGNA 2I0TA 2P9PC 3PXTD 5CYKA 4GZ8A 3J81g 4J84A 2H3XA 2MTAH 2HXCA 4A11B 1XIPA 3MZLA 2Q7QA 2P9UC 3NVXA 3GREA 4EWRA 2TRCB 5I5MA 3SBPA 4H5IA 5FA5B 4A0AB 3EU7A 4J0WA 4Z8LA 3IJCA 3UVOA 2G9AA 3DWLC 3BWSA 4LG9A 4J86A 1JMZB 4X63B 3F3FA 4PSWB 4GQBB 3JZGA 1B9XA 2H9MA 3J80g 4ESGA 1PI6A 4A08A 3JPXA 3JZHA 3I8CA 2YNNA 5EM2A 3PXSD 2YNPA 2AGLA 3RMZD 3C99A 2IUVA 4BL0A 2I3TA 4J8BA 1OMWB 4QQEA 4U7AA 5CXCA 2CN2A 3C9CA 2H9NA 5EAPA 3I7KA 4JSXC 2CO0C 3MXXA 1U2VC 3FRXA 2HESX 3AL9A 3JRPA 5I5JA 5I5IA 4ERZA 4ZN4A 4D0KA 4ERYA 3AH8B 3RSEC 3VA6A 3EWEA 3A0FA 4FA4D 5TEFA 2AGWA 4AOWA 4K3ID 4BUJC 5IT9g 2PM9B 4X3EA 2I0SA 2J57G 5IJ7E 3C75H 3UR4A 2HKMA 4FAVD 4IA9A 2QC5A 5FQDA 2H6KA 3EG6A 3DXKC 1OLZA 4O3UB 1SQ9A 3OL2A 4QT8A 3SLED 3PVUB 4ZOXA 1VYHC 3OKWA 4PBYA 2P9KC 2YBAA 2PM6B 4UI9R 1N6DA 3K26A 3MMYA 3C5MA 5FKQA 5GXIA 3GFCA 4CY3A 3CFVA 5H1MA 4CZVA 4LG8A 1XHMA 3K27A 4O3TB 3UVMA 3SWSD 5KDOB 2CNXA 5IJ8E 1GOTB 1NR0A 2XU7A 4FAND 2XL2A 4CZYA 3JAMg 4QRJA 5K19A 4IMMA 1JOFA 3SVWD 4A2MA 4GQ2P 2P9IC 5EMKB 5HE2B 4ZOVA 1P22A 5THAA 3I8EA 4O9DA 3AL8B 4XEIC 4X60B 3EMHA 3PXWD 2GNQA 4E54B 4JD2C 4NSXA 2CE8A 5A2Qg 2H68A 4KFMB 4GM8A 3EI1B 3BG1A 4XYHA 3KRWB 2AH1A 2BCJB 3SJLD 3W15A 1Q47A 4G56B 5EALA 1QNIA 2YNOA 4J82A 3N0EA 2G99A 4ERQA 4A09B 5CXCB 3B7FA 3ORVD 2PM7B 3MKSB 3I7PA 2EBSA 2HYEA 4QL1A 3IKOA 4E5ZA 5EARA 5FKSA 4PBZA 1MDAH 2J56H 4CI2A 2YB8B 5IGQA 4FB1D 3EI3B 3RFHA 1PEVA 2B4EA 3JZNA 4CY5A 4GQ1A 4PNKB 2YMUA 2CE9A 2PM9A 5GXHA 3ZWLB 2Z2OA 4GMBA 4JSVC 5K1CC 4FHLA 4CC9A 4CI8A 3CFSB 3N0DA 2OIZA 5C9ZB 4GGAA 1GP2B 1JMXB 5B4WA 2AQ5A 5EMLB 5TDHB 2PBIB 4CY2A 4J77A 4J79A 5H17A 5TF2A 4A0BB 3RLMD 5CXBA 2HKRA 4CI1A 3MZKA 4Y5RD 3FM0A 4OWRA 5H14A 3I7LA 1R5MA 3SHFA 3I7NA 1TYQC 2HJ4A 2IWFA 3NVQA 4PC0A 5HYNB 3U4YA 4A09A 3IJ0A 3UVLA 4L9OA 5EMMB 4L3GD 1A0RB 3DXMC 5EAMA 2I0RA 3I7HA 4J73A 1PGUA 3V9FA 5AJAA 5FKTA 4ZOZA 3E0CA 5EM2B 4MK0B 3PE7A 4GM3A 3OL2B 3JB9L 4GGCA 2HJBA 2H9PA 3IIYA 1U4CA 2P9NC 2O9KA 4J81A 1SQJA 4A0AA 1N6FA 2B5NA 1TBGA 4PXWA 1ERJA 3L4OD 2OVQB 2H6QA 3OKTA 3EI4B 4JT5C 5FKRA 3KRXB 5HE0B 3UKUC 2IUQA 5C2VB 5HQGA 4CI3A 2IURA 4GM9A 5HE3B 3SFZA 4I79A 5IGOA 5CYKB 2GC4A 3SMRA 3SN6B 3JROA 4X61B 2OJYA 4FA1D 3DM0A 3OTTA 5SXMA 3HFQA 4L3HD 2IAAA 4Y7RA 5GSAA 2J55H 3V5WB 4OZUA 3L4MD 4O1QD 5FXYA 3MKQA 3PSLA 5AMSA 2BBKH 3ODTA 4HDJA 4D6VA 1RI6A 4H5JA 1K32A 1K8KC 4K3JB 2H13A 2Z2PA 2CN3A 4J78A 2B5MA 4L1QD 3PSCB 3OW8A 2UZYB 4TZ4A 3UKRC 3EI2B 4GGDA 2QXVA 3FGBA 2GC7A 4A7JA 2UZXB 3RN1D 2H6NA 4J0XA 4JT6C 1B9YA 3SXTD 4A0BA 5FLXg 2IUPA 4YVDA 1N6EA 4A11A 2P9LC 2XYIA 2AH0A 5HE1B 3RN0D 2H47A 4XYIA 5EMJB 3OKYA 4N14A 4A2LA 1GG2B 1JJUB 4FA5D 4E54A 4CY1A 3P4FA 5AFU3 1S4UX 3CIKB 1MG3A 1FWXA 2IWKA 4J8GA 3EI1A 1YFQA 3IJ1A 4U1EI 5TEEA 3BG0A 4FWWA 4O45A 3DSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGY A;  3V7D B;  2H9L A;  3VH0 A;  3SBR A;  1XKS A;  4JXM A;  3SCY A;  3I7O A;  3UVK A;  3OKY B;  3IIW A;  3I89 A;  1L0Q A;  2OVP B;  2XL3 A;  5C2W B;  2OVR B;  1MG2 A;  1PBY B;  3EI4 A;  3UVN A;  4CZX A;  3RRM C;  3EI2 A;  3I2N A;  2OK6 A;  4AEZ A;  2P9S C;  2H14 A;  4ES0 A;  4ZOY A;  2I3S A;  1GXR A;  2B5L A;  2Z2N A;  3RFG A;  3F3G A;  4A08 B;  5JWZ A;  5IC7 A;  2AGZ A;  2CO0 A;  1SHY B;  4J87 A;  1NEX B;  4R7A B;  3ULE C;  3NVN A;  4JSP C;  4PSX B;  4BH6 A;  3F3P A;  4E5Z B;  3SBQ A;  4FA9 D;  4JSN C;  2W18 A;  3AFC A;  5GMK n;  3AL8 A;  2AGX A;  2OK4 A;  3PVW B;  5CXB B;  3EI3 A;  3VGZ A;  4LGN A;  2I0T A;  2P9P C;  3PXT D;  5CYK A;  4GZ8 A;  3J81 g;  4J84 A;  2H3X A;  2MTA H;  2HXC A;  4A11 B;  1XIP A;  3MZL A;  2Q7Q A;  2P9U C;  3NVX A;  3GRE A;  4EWR A;  2TRC B;  5I5M A;  3SBP A;  4H5I A;  5FA5 B;  4A0A B;  3EU7 A;  4J0W A;  4Z8L A;  3IJC A;  3UVO A;  2G9A A;  3DWL C;  3BWS A;  4LG9 A;  4J86 A;  1JMZ B;  4X63 B;  3F3F A;  4PSW B;  4GQB B;  3JZG A;  1B9X A;  2H9M A;  3J80 g;  4ESG A;  1PI6 A;  4A08 A;  3JPX A;  3JZH A;  3I8C A;  2YNN A;  5EM2 A;  3PXS D;  2YNP A;  2AGL A;  3RMZ D;  3C99 A;  2IUV A;  4BL0 A;  2I3T A;  4J8B A;  1OMW B;  4QQE A;  4U7A A;  5CXC A;  2CN2 A;  3C9C A;  2H9N A;  5EAP A;  3I7K A;  4JSX C;  2CO0 C;  3MXX A;  1U2V C;  3FRX A;  2HES X;  3AL9 A;  3JRP A;  5I5J A;  5I5I A;  4ERZ A;  4ZN4 A;  4D0K A;  4ERY A;  3AH8 B;  3RSE C;  3VA6 A;  3EWE A;  3A0F A;  4FA4 D;  5TEF A;  2AGW A;  4AOW A;  4K3I D;  4BUJ C;  5IT9 g;  2PM9 B;  4X3E A;  2I0S A;  2J57 G;  5IJ7 E;  3C75 H;  3UR4 A;  2HKM A;  4FAV D;  4IA9 A;  2QC5 A;  5FQD A;  2H6K A;  3EG6 A;  3DXK C;  1OLZ A;  4O3U B;  1SQ9 A;  3OL2 A;  4QT8 A;  3SLE D;  3PVU B;  4ZOX A;  1VYH C;  3OKW A;  4PBY A;  2P9K C;  2YBA A;  2PM6 B;  4UI9 R;  1N6D A;  3K26 A;  3MMY A;  3C5M A;  5FKQ A;  5GXI A;  3GFC A;  4CY3 A;  3CFV A;  5H1M A;  4CZV A;  4LG8 A;  1XHM A;  3K27 A;  4O3T B;  3UVM A;  3SWS D;  5KDO B;  2CNX A;  5IJ8 E;  1GOT B;  1NR0 A;  2XU7 A;  4FAN D;  2XL2 A;  4CZY A;  3JAM g;  4QRJ A;  5K19 A;  4IMM A;  1JOF A;  3SVW D;  4A2M A;  4GQ2 P;  2P9I C;  5EMK B;  5HE2 B;  4ZOV A;  1P22 A;  5THA A;  3I8E A;  4O9D A;  3AL8 B;  4XEI C;  4X60 B;  3EMH A;  3PXW D;  2GNQ A;  4E54 B;  4JD2 C;  4NSX A;  2CE8 A;  5A2Q g;  2H68 A;  4KFM B;  4GM8 A;  3EI1 B;  3BG1 A;  4XYH A;  3KRW B;  2AH1 A;  2BCJ B;  3SJL D;  3W15 A;  1Q47 A;  4G56 B;  5EAL A;  1QNI A;  2YNO A;  4J82 A;  3N0E A;  2G99 A;  4ERQ A;  4A09 B;  5CXC B;  3B7F A;  3ORV D;  2PM7 B;  3MKS B;  3I7P A;  2EBS A;  2HYE A;  4QL1 A;  3IKO A;  4E5Z A;  5EAR A;  5FKS A;  4PBZ A;  1MDA H;  2J56 H;  4CI2 A;  2YB8 B;  5IGQ A;  4FB1 D;  3EI3 B;  3RFH A;  1PEV A;  2B4E A;  3JZN A;  4CY5 A;  4GQ1 A;  4PNK B;  2YMU A;  2CE9 A;  2PM9 A;  5GXH A;  3ZWL B;  2Z2O A;  4GMB A;  4JSV C;  5K1C C;  4FHL A;  4CC9 A;  4CI8 A;  3CFS B;  3N0D A;  2OIZ A;  5C9Z B;  4GGA A;  1GP2 B;  1JMX B;  5B4W A;  2AQ5 A;  5EML B;  5TDH B;  2PBI B;  4CY2 A;  4J77 A;  4J79 A;  5H17 A;  5TF2 A;  4A0B B;  3RLM D;  5CXB A;  2HKR A;  4CI1 A;  3MZK A;  4Y5R D;  3FM0 A;  4OWR A;  5H14 A;  3I7L A;  1R5M A;  3SHF A;  3I7N A;  1TYQ C;  2HJ4 A;  2IWF A;  3NVQ A;  4PC0 A;  5HYN B;  3U4Y A;  4A09 A;  3IJ0 A;  3UVL A;  4L9O A;  5EMM B;  4L3G D;  1A0R B;  3DXM C;  5EAM A;  2I0R A;  3I7H A;  4J73 A;  1PGU A;  3V9F A;  5AJA A;  5FKT A;  4ZOZ A;  3E0C A;  5EM2 B;  4MK0 B;  3PE7 A;  4GM3 A;  3OL2 B;  3JB9 L;  4GGC A;  2HJB A;  2H9P A;  3IIY A;  1U4C A;  2P9N C;  2O9K A;  4J81 A;  1SQJ A;  4A0A A;  1N6F A;  2B5N A;  1TBG A;  4PXW A;  1ERJ A;  3L4O D;  2OVQ B;  2H6Q A;  3OKT A;  3EI4 B;  4JT5 C;  5FKR A;  3KRX B;  5HE0 B;  3UKU C;  2IUQ A;  5C2V B;  5HQG A;  4CI3 A;  2IUR A;  4GM9 A;  5HE3 B;  3SFZ A;  4I79 A;  5IGO A;  5CYK B;  2GC4 A;  3SMR A;  3SN6 B;  3JRO A;  4X61 B;  2OJY A;  4FA1 D;  3DM0 A;  3OTT A;  5SXM A;  3HFQ A;  4L3H D;  2IAA A;  4Y7R A;  5GSA A;  2J55 H;  3V5W B;  4OZU A;  3L4M D;  4O1Q D;  5FXY A;  3MKQ A;  3PSL A;  5AMS A;  2BBK H;  3ODT A;  4HDJ A;  4D6V A;  1RI6 A;  4H5J A;  1K32 A;  1K8K C;  4K3J B;  2H13 A;  2Z2P A;  2CN3 A;  4J78 A;  2B5M A;  4L1Q D;  3PSC B;  3OW8 A;  2UZY B;  4TZ4 A;  3UKR C;  3EI2 B;  4GGD A;  2QXV A;  3FGB A;  2GC7 A;  4A7J A;  2UZX B;  3RN1 D;  2H6N A;  4J0X A;  4JT6 C;  1B9Y A;  3SXT D;  4A0B A;  5FLX g;  2IUP A;  4YVD A;  1N6E A;  4A11 A;  2P9L C;  2XYI A;  2AH0 A;  5HE1 B;  3RN0 D;  2H47 A;  4XYI A;  5EMJ B;  3OKY A;  4N14 A;  4A2L A;  1GG2 B;  1JJU B;  4FA5 D;  4E54 A;  4CY1 A;  3P4F A;  5AFU 3;  1S4U X;  3CIK B;  1MG3 A;  1FWX A;  2IWK A;  4J8G A;  3EI1 A;  1YFQ A;  3IJ1 A;  4U1E I;  5TEE A;  3BG0 A;  4FWW A;  4O45 A;  3DSM A; 
#chains in the Genus database with same CATH topology
 2AGY A;  3V7D B;  2H9L A;  3VH0 A;  2VDN A;  1JTD B;  3SBR A;  1XKS A;  4JXM A;  3SCY A;  3I7O A;  4DNU A;  3UVK A;  4WJK A;  3OKY B;  3IIW A;  3I89 A;  3ZDX A;  1L0Q A;  4AN1 A;  2OVP B;  4WK4 A;  2XL3 A;  1E8N A;  5C2W B;  2OVR B;  1MG2 A;  1PBY B;  3EI4 A;  3UVN A;  4CZX A;  3RRM C;  3EI2 A;  1GOG A;  4NC4 A;  3I2N A;  2OK6 A;  3MVD K;  1QFM A;  4AEZ A;  2P9S C;  2H14 A;  4ES0 A;  4ZOY A;  4BP8 A;  2I3S A;  1GXR A;  2B5L A;  2Z2N A;  3RFG A;  3F3G A;  4A08 B;  5JWZ A;  4BCB A;  5IC7 A;  2AGZ A;  2CO0 A;  3GC3 B;  1SHY B;  3VI4 A;  4J87 A;  1NEX B;  4R7A B;  3ULE C;  3IUL A;  3NVN A;  4JSP C;  4PSX B;  3T3M A;  4BH6 A;  3F3P A;  4E5Z B;  3SBQ A;  4FA9 D;  1I2M B;  2W18 A;  3AFC A;  4JSN C;  4Z7O A;  5GMK n;  4G1E A;  3O4G A;  3AL8 A;  2AGX A;  2OK4 A;  3PVW B;  5CXB B;  3EI3 A;  1C9L A;  3VGZ A;  4LGN A;  2I0T A;  2P9P C;  4O02 A;  1K3I A;  3PXT D;  5M5R A;  5CYK A;  4GZ8 A;  3J81 g;  3K6S A;  4J84 A;  2H3X A;  2MTA H;  2HXC A;  5M5U A;  4A11 B;  1XIP A;  3MZL A;  2Q7Q A;  2P9U C;  3NVX A;  3GRE A;  4EWR A;  2TRC B;  5I5M A;  3SBP A;  1E8M A;  4L1M A;  4QAM A;  4H5I A;  5FA5 B;  4G55 A;  3EU7 A;  4A0A B;  4J0W A;  4Z8L A;  3IJC A;  3UVO A;  2G9A A;  3DWL C;  4WK0 A;  3BWS A;  4LG9 A;  4J86 A;  1JMZ B;  3IUM A;  4X63 B;  5C92 A;  3F3F A;  4GQB B;  4PSW B;  3JZG A;  1B9X A;  1H2W A;  2H9M A;  3J80 g;  4ESG A;  1GOF A;  1PI6 A;  4A08 A;  3JPX A;  3JZH A;  3I8C A;  2YNN A;  2VZ1 A;  5EM2 A;  3PXS D;  2YNP A;  4MMX A;  2AGL A;  3RMZ D;  3C99 A;  2HU8 A;  2IUV A;  2VDM A;  4BL0 A;  1YR2 A;  3ZE0 A;  2I3T A;  4J8B A;  5M5V A;  1OMW B;  4QQE A;  4U7A A;  5CXC A;  2CN2 A;  3C9C A;  2H9N A;  2VDR A;  5EAP A;  3I7K A;  4AMZ A;  4JSX C;  2CO0 C;  3MXX A;  1U2V C;  3FRX A;  2HES X;  3AL9 A;  3JRP A;  5I5J A;  4BP9 A;  5I5I A;  2WQ8 A;  4ERZ A;  4ZN4 A;  4D9S A;  4D0K A;  4ERY A;  3AH8 B;  3RSE C;  3VA6 A;  3EWE A;  3A0F A;  4FA4 D;  2QZP A;  5TEF A;  2AGW A;  4AOW A;  4K3I D;  4BUJ C;  2EIB A;  1GOH A;  3K72 A;  3GD1 I;  3IUJ A;  5IT9 g;  1VE6 A;  2PM9 B;  4X3E A;  1U8C A;  2I0S A;  2J57 G;  5IJ7 E;  3C75 H;  3UR4 A;  2HKM A;  4FAV D;  4IA9 A;  1T2X A;  2QC5 A;  5FQD A;  2H6K A;  3EG6 A;  3DXK C;  3FCS A;  4NEN A;  1OLZ A;  4O3U B;  1H2Y A;  1SQ9 A;  3OL2 A;  4QT8 A;  3SLE D;  3NIF A;  2XE4 A;  3PVU B;  4ZOX A;  1VYH C;  3OKW A;  4PBY A;  3V4V A;  2P9K C;  3IJE A;  3O4J A;  2YBA A;  2PM6 B;  4UI9 R;  1N6D A;  3K26 A;  3MMY A;  3C5M A;  2VDP A;  5FKQ A;  5GXI A;  3GFC A;  4CY3 A;  3CFV A;  5H1M A;  4CZV A;  4LG8 A;  1XHM A;  3K27 A;  4O3T B;  1VE7 A;  3UVM A;  3SWS D;  3ZE2 A;  2JKX A;  5KDO B;  2CNX A;  5IJ8 E;  1GOT B;  1NR0 A;  2XU7 A;  1UTC A;  4DNV A;  4FAN D;  5E6U A;  2XL2 A;  4CZY A;  3IUN A;  3JAM g;  4QRJ A;  2XZG A;  5K19 A;  4IMM A;  1JOF A;  3SVW D;  4A2M A;  5FFO A;  4GQ2 P;  2P9I C;  5EMK B;  5HE2 B;  4ZOV A;  1P22 A;  3FCU A;  3V4P A;  4O2W A;  3QHY B;  5THA A;  3I8E A;  4O9D A;  3AL8 B;  3EMH A;  3KCI A;  3PXW D;  2GNQ A;  4X60 B;  4XEI C;  4E54 B;  4JD2 C;  4DNW A;  4NSX A;  2CE8 A;  4WK2 A;  5A2Q g;  1H2Z A;  2H68 A;  4KFM B;  4GM8 A;  3EI1 B;  3BG1 A;  4XYH A;  3KRW B;  2AH1 A;  2BCJ B;  3SJL D;  3W15 A;  2VZ3 A;  1Q47 A;  4G56 B;  5EAL A;  1QNI A;  2YNO A;  4J82 A;  3N0E A;  2G99 A;  1UOQ A;  4ERQ A;  4A09 B;  5CXC B;  3B7F A;  3ORV D;  2PM7 B;  3MKS B;  3I7P A;  2EBS A;  2HYE A;  4QL1 A;  3IKO A;  1BPO A;  3T3P A;  4E5Z A;  5EAR A;  3MUO A;  5FKS A;  4PBZ A;  1MDA H;  2J56 H;  4CI2 A;  1UOP A;  2YB8 B;  5IGQ A;  4FB1 D;  3EI3 B;  3RFH A;  4G1M A;  1PEV A;  2B4E A;  3ZE1 A;  3JZN A;  4UM9 A;  4CY5 A;  4GQ1 A;  1E5T A;  2YMU A;  4PNK B;  2CE9 A;  2PM9 A;  5GXH A;  3ZWL B;  3MUN A;  2Z2O A;  4GMB A;  4JSV C;  5K1C C;  4FHL A;  4CC9 A;  1UOO A;  4CI8 A;  3CFS B;  3N0D A;  2OIZ A;  4AX4 A;  4GGA A;  1GP2 B;  5C9Z B;  2QR5 A;  4NBM A;  1JMX B;  1H2X A;  5B4W A;  2AQ5 A;  5EML B;  5TDH B;  2PBI B;  4BCC A;  1JV2 A;  4CY2 A;  4J77 A;  4J79 A;  5H17 A;  5TF2 A;  3NID A;  1M1X A;  2VDL A;  4JHP C;  4A0B B;  1VZ2 A;  3QI0 A;  3RLM D;  5CXB A;  5C86 A;  2HKR A;  4CI1 A;  3MZK A;  4Y5R D;  3FM0 A;  4OWR A;  4AN0 A;  5H14 A;  3I7L A;  1R5M A;  1O6F A;  3SHF A;  3I7N A;  4NAA A;  1TYQ C;  2HJ4 A;  2IWF A;  3NVQ A;  4PC0 A;  4IRZ A;  5HYN B;  3U4Y A;  4A09 A;  3IJ0 A;  3UVL A;  4L9O A;  5EMM B;  3DDU A;  4L3G D;  1A0R B;  3DXM C;  5EAM A;  2I0R A;  3I7H A;  4J73 A;  1PGU A;  2HU7 A;  5M61 A;  3V9F A;  5AJA A;  5FKT A;  5E6S A;  4ZOZ A;  3E0C A;  5EM2 B;  4MK0 B;  4JHN A;  3PE7 A;  4GM3 A;  3OL2 B;  3JB9 L;  3O4H A;  2HJB A;  4GGC A;  3EQ9 A;  5M5T A;  2BKL A;  2H9P A;  3EQ8 A;  3OF7 A;  3IIY A;  1U4C A;  2P9N C;  3ZDZ A;  2O9K A;  4J81 A;  1SQJ A;  4A0A A;  1N6F A;  2VDQ A;  2B5N A;  1TBG A;  4PXW A;  1ERJ A;  3L4O D;  5FFG A;  2EID A;  2H6Q A;  3EI4 B;  3OKT A;  4JT5 C;  5FKR A;  2OVQ B;  3KRX B;  5HE0 B;  3UKU C;  2IUQ A;  5C2V B;  5HQG A;  4CI3 A;  4Z7N A;  2IUR A;  4GM9 A;  5HE3 B;  3SFZ A;  4I79 A;  5IGO A;  5CYK B;  2GC4 A;  3SMR A;  3SN6 B;  3JRO A;  1O6G A;  4X61 B;  2OJY A;  4FA1 D;  3DM0 A;  3OTT A;  5SXM A;  3HFQ A;  4Z7Q A;  4L3H D;  2IAA A;  3IUQ A;  4Y7R A;  2EIC A;  3IVM A;  1L5G A;  5GSA A;  2J55 H;  3V5W B;  4OZU A;  3L4M D;  4O1Q D;  5FXY A;  2HU5 A;  3MKQ A;  3PSL A;  5AMS A;  2BBK H;  3ODT A;  4HDJ A;  4D6V A;  3IUR A;  1RI6 A;  4H5J A;  1TYE A;  1K32 A;  1K8K C;  3EQ7 A;  4K3J B;  4RE6 A;  2VDK A;  4RE5 A;  4AMY A;  2H13 A;  3O4I A;  3VI3 A;  4BCD A;  2Z2P A;  2CN3 A;  4J78 A;  2B5M A;  4L1Q D;  3PSC B;  3OW8 A;  3ZDY A;  2UZY B;  5E6R A;  4UM8 A;  4TZ4 A;  3UKR C;  3EI2 B;  4GGD A;  2QXV A;  3FGB A;  2GC7 A;  4A7J A;  2UZX B;  3RN1 D;  2H6N A;  4J0X A;  4JT6 C;  1B9Y A;  3SXT D;  4A0B A;  3K71 A;  5FLX g;  2IUP A;  4YVD A;  1N6E A;  4MMZ A;  2P9L C;  4A11 A;  2XYI A;  2AH0 A;  5HE1 B;  2VDO A;  2XDW A;  3RN0 D;  2H47 A;  4XYI A;  5EMJ B;  1C9I A;  1VZ3 A;  3OKY A;  4N14 A;  4A2L A;  1GG2 B;  1JJU B;  4FA5 D;  4E54 A;  4CY1 A;  3P4F A;  5AFU 3;  1S4U X;  3CIK B;  2VC2 A;  4MMY A;  1MG3 A;  1FWX A;  2IWK A;  4J8G A;  3EI1 A;  1YFQ A;  3NIG A;  3IJ1 A;  4U1E I;  5TEE A;  5M5S A;  3BG0 A;  1QFS A;  1A12 A;  4FWW A;  4O45 A;  2EIE A;  3DSM A;  5HDB A; 
#chains in the Genus database with same CATH homology
 2AGY A;  3V7D B;  2H9L A;  3VH0 A;  3SBR A;  1XKS A;  4JXM A;  3SCY A;  3I7O A;  3UVK A;  3OKY B;  3IIW A;  3I89 A;  1L0Q A;  2OVP B;  2XL3 A;  5C2W B;  2OVR B;  1MG2 A;  1PBY B;  3EI4 A;  3UVN A;  4CZX A;  3RRM C;  3EI2 A;  3I2N A;  2OK6 A;  4AEZ A;  2P9S C;  2H14 A;  4ES0 A;  4ZOY A;  2I3S A;  1GXR A;  2B5L A;  2Z2N A;  3RFG A;  3F3G A;  4A08 B;  5JWZ A;  5IC7 A;  2AGZ A;  2CO0 A;  1SHY B;  4J87 A;  1NEX B;  4R7A B;  3ULE C;  3NVN A;  4JSP C;  4PSX B;  4BH6 A;  3F3P A;  4E5Z B;  3SBQ A;  4FA9 D;  4JSN C;  2W18 A;  3AFC A;  5GMK n;  3AL8 A;  2AGX A;  2OK4 A;  3PVW B;  5CXB B;  3EI3 A;  3VGZ A;  4LGN A;  2I0T A;  2P9P C;  3PXT D;  5CYK A;  4GZ8 A;  3J81 g;  4J84 A;  2H3X A;  2MTA H;  2HXC A;  4A11 B;  1XIP A;  3MZL A;  2Q7Q A;  2P9U C;  3NVX A;  3GRE A;  4EWR A;  2TRC B;  5I5M A;  3SBP A;  4H5I A;  5FA5 B;  4A0A B;  3EU7 A;  4J0W A;  4Z8L A;  3IJC A;  3UVO A;  2G9A A;  3DWL C;  3BWS A;  4LG9 A;  4J86 A;  1JMZ B;  4X63 B;  3F3F A;  4PSW B;  4GQB B;  3JZG A;  1B9X A;  2H9M A;  3J80 g;  4ESG A;  1PI6 A;  4A08 A;  3JPX A;  3JZH A;  3I8C A;  2YNN A;  5EM2 A;  3PXS D;  2YNP A;  2AGL A;  3RMZ D;  3C99 A;  2IUV A;  4BL0 A;  2I3T A;  4J8B A;  1OMW B;  4QQE A;  4U7A A;  5CXC A;  2CN2 A;  3C9C A;  2H9N A;  5EAP A;  3I7K A;  4JSX C;  2CO0 C;  3MXX A;  1U2V C;  3FRX A;  2HES X;  3AL9 A;  3JRP A;  5I5J A;  5I5I A;  4ERZ A;  4ZN4 A;  4D0K A;  4ERY A;  3AH8 B;  3RSE C;  3VA6 A;  3EWE A;  3A0F A;  4FA4 D;  5TEF A;  2AGW A;  4AOW A;  4K3I D;  4BUJ C;  5IT9 g;  2PM9 B;  4X3E A;  2I0S A;  2J57 G;  5IJ7 E;  3C75 H;  3UR4 A;  2HKM A;  4FAV D;  4IA9 A;  2QC5 A;  5FQD A;  2H6K A;  3EG6 A;  3DXK C;  1OLZ A;  4O3U B;  1SQ9 A;  3OL2 A;  4QT8 A;  3SLE D;  3PVU B;  4ZOX A;  1VYH C;  3OKW A;  4PBY A;  2P9K C;  2YBA A;  2PM6 B;  4UI9 R;  1N6D A;  3K26 A;  3MMY A;  3C5M A;  5FKQ A;  5GXI A;  3GFC A;  4CY3 A;  3CFV A;  5H1M A;  4CZV A;  4LG8 A;  1XHM A;  3K27 A;  4O3T B;  3UVM A;  3SWS D;  5KDO B;  2CNX A;  5IJ8 E;  1GOT B;  1NR0 A;  2XU7 A;  4FAN D;  2XL2 A;  4CZY A;  3JAM g;  4QRJ A;  5K19 A;  4IMM A;  1JOF A;  3SVW D;  4A2M A;  4GQ2 P;  2P9I C;  5EMK B;  5HE2 B;  4ZOV A;  1P22 A;  5THA A;  3I8E A;  4O9D A;  3AL8 B;  4XEI C;  4X60 B;  3EMH A;  3PXW D;  2GNQ A;  4E54 B;  4JD2 C;  4NSX A;  2CE8 A;  5A2Q g;  2H68 A;  4KFM B;  4GM8 A;  3EI1 B;  3BG1 A;  4XYH A;  3KRW B;  2AH1 A;  2BCJ B;  3SJL D;  3W15 A;  1Q47 A;  4G56 B;  5EAL A;  1QNI A;  2YNO A;  4J82 A;  3N0E A;  2G99 A;  4ERQ A;  4A09 B;  5CXC B;  3B7F A;  3ORV D;  2PM7 B;  3MKS B;  3I7P A;  2EBS A;  2HYE A;  4QL1 A;  3IKO A;  4E5Z A;  5EAR A;  5FKS A;  4PBZ A;  1MDA H;  2J56 H;  4CI2 A;  2YB8 B;  5IGQ A;  4FB1 D;  3EI3 B;  3RFH A;  1PEV A;  2B4E A;  3JZN A;  4CY5 A;  4GQ1 A;  4PNK B;  2YMU A;  2CE9 A;  2PM9 A;  5GXH A;  3ZWL B;  2Z2O A;  4GMB A;  4JSV C;  5K1C C;  4FHL A;  4CC9 A;  4CI8 A;  3CFS B;  3N0D A;  2OIZ A;  5C9Z B;  4GGA A;  1GP2 B;  1JMX B;  5B4W A;  2AQ5 A;  5EML B;  5TDH B;  2PBI B;  4CY2 A;  4J77 A;  4J79 A;  5H17 A;  5TF2 A;  4A0B B;  3RLM D;  5CXB A;  2HKR A;  4CI1 A;  3MZK A;  4Y5R D;  3FM0 A;  4OWR A;  5H14 A;  3I7L A;  1R5M A;  3SHF A;  3I7N A;  1TYQ C;  2HJ4 A;  2IWF A;  3NVQ A;  4PC0 A;  5HYN B;  3U4Y A;  4A09 A;  3IJ0 A;  3UVL A;  4L9O A;  5EMM B;  4L3G D;  1A0R B;  3DXM C;  5EAM A;  2I0R A;  3I7H A;  4J73 A;  1PGU A;  3V9F A;  5AJA A;  5FKT A;  4ZOZ A;  3E0C A;  5EM2 B;  4MK0 B;  3PE7 A;  4GM3 A;  3OL2 B;  3JB9 L;  4GGC A;  2HJB A;  2H9P A;  3IIY A;  1U4C A;  2P9N C;  2O9K A;  4J81 A;  1SQJ A;  4A0A A;  1N6F A;  2B5N A;  1TBG A;  4PXW A;  1ERJ A;  3L4O D;  2OVQ B;  2H6Q A;  3OKT A;  3EI4 B;  4JT5 C;  5FKR A;  3KRX B;  5HE0 B;  3UKU C;  2IUQ A;  5C2V B;  5HQG A;  4CI3 A;  2IUR A;  4GM9 A;  5HE3 B;  3SFZ A;  4I79 A;  5IGO A;  5CYK B;  2GC4 A;  3SMR A;  3SN6 B;  3JRO A;  4X61 B;  2OJY A;  4FA1 D;  3DM0 A;  3OTT A;  5SXM A;  3HFQ A;  4L3H D;  2IAA A;  4Y7R A;  5GSA A;  2J55 H;  3V5W B;  4OZU A;  3L4M D;  4O1Q D;  5FXY A;  3MKQ A;  3PSL A;  5AMS A;  2BBK H;  3ODT A;  4HDJ A;  4D6V A;  1RI6 A;  4H5J A;  1K32 A;  1K8K C;  4K3J B;  2H13 A;  2Z2P A;  2CN3 A;  4J78 A;  2B5M A;  4L1Q D;  3PSC B;  3OW8 A;  2UZY B;  4TZ4 A;  3UKR C;  3EI2 B;  4GGD A;  2QXV A;  3FGB A;  2GC7 A;  4A7J A;  2UZX B;  3RN1 D;  2H6N A;  4J0X A;  4JT6 C;  1B9Y A;  3SXT D;  4A0B A;  5FLX g;  2IUP A;  4YVD A;  1N6E A;  4A11 A;  2P9L C;  2XYI A;  2AH0 A;  5HE1 B;  3RN0 D;  2H47 A;  4XYI A;  5EMJ B;  3OKY A;  4N14 A;  4A2L A;  1GG2 B;  1JJU B;  4FA5 D;  4E54 A;  4CY1 A;  3P4F A;  5AFU 3;  1S4U X;  3CIK B;  1MG3 A;  1FWX A;  2IWK A;  4J8G A;  3EI1 A;  1YFQ A;  3IJ1 A;  4U1E I;  5TEE A;  3BG0 A;  4FWW A;  4O45 A;  3DSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...