5FXYA

Structure of the human rbbp4:mta1(464-546) complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
402
structure length
381
Chain Sequence
b'DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPNLSGHLLSASDDHTICLWDISAVPGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-BINDING PROTEIN RBBP4
publication title The structure of the core NuRD repression complex provides insights into its interaction with chromatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 381
sequence length 402
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fxyA00
4GMBA 4A0BB 3MKSB 4A11B 3U4YA 2B5LA 1JJUB 2QC5A 4I79A 4ZN4A 2HYEA 2BCJB 1OMWB 3E0CA 1PBYB 5EMJB 2YBAA 2OVRB 3FGBA 5I5MA 4D6VA 5AFU3 3EI3A 2AGXA 4CI3A 5EARA 5EM2A 3RN0D 4JSPC 2PM9B 1JMZB 3OKYB 5THAA 2P9NC 1R5MA 1FWXA 3PXTD 3MMYA 2I3TA 3SCYA 1SHYB 3SBPA 3SMRA 3SXTD 2PM7B 3JRPA 2I0SA 4GGAA 4D0KA 3FRXA 2H14A 1JOFA 1TYQC 3SFZA 4X60B 4JSVC 3UVNA 2CE9A 4JT5C 3EI4A 4XYIA 2TRCB 1A0RB 2XYIA 3C5MA 3EWEA 3ORVD 5B4WA 3EG6A 3UKRC 4FAND 1N6EA 3IJCA 5FQDA 3SHFA 2OIZA 1GOTB 2P9UC 2B4EA 4LG9A 3C9CA 2G99A 4E5ZA 1JMXB 3MZKA 2P9LC 3V5WB 4GQ2P 5TF2A 4CY2A 3JZNA 3BG0A 4X3EA 3A0FA 4QQEA 5C9ZB 3SBQA 2HJ4A 4XEIC 4PSWB 4O9DA 4CY3A 1PGUA 2H9MA 4A08A 4J77A 3UVMA 4X63B 3PE7A 3C75H 2GC4A 2I0RA 4R7AB 3OL2A 4FB1D 4HDJA 3AFCA 2I3SA 3IJ1A 4A0AA 3JZGA 5HE1B 4FWWA 4J82A 4N14A 4H5JA 4K3JB 5CXBA 1Q47A 4FHLA 5CYKB 4Z8LA 5IC7A 4PBYA 1N6FA 2IUVA 3I7OA 2XU7A 3SJLD 3DSMA 2Z2NA 3MKQA 1SQ9A 2P9SC 3PSLA 5IJ7E 2UZXB 2HKMA 1RI6A 3RLMD 3I7KA 4CC9A 3UVOA 2OK6A 3EI3B 3V7DB 2YB8B 4O1QD 5FKQA 3EI2B 4GGCA 2H6QA 5SXMA 4GQBB 4PBZA 4J8GA 4GZ8A 4J81A 4KFMB 4AOWA 3VH0A 4PNKB 2IURA 3CFVA 2AGYA 4JSNC 4ZOXA 4J84A 5I5JA 4GQ1A 4E54B 3L4MD 4UI9R 4JT6C 5IJ8E 5EMMB 5AJAA 3NVNA 4L3HD 5HQGA 4K3ID 3I7NA 2XL2A 3VA6A 2G9AA 4OWRA 3GREA 1XHMA 3C99A 2CN3A 2UZYB 2AQ5A 4ZOVA 3N0DA 5I5IA 2AH0A 2B5NA 2IWKA 1XIPA 2IWFA 4JD2C 3J80g 4ERQA 3KRWB 2EBSA 2IUQA 1N6DA 3IJ0A 5EMKB 3F3FA 4J0XA 1MDAH 4A11A 4U7AA 5HE2B 5AMSA 4A09A 3JROA 3RN1D 2YNNA 3RSEC 5FLXg 3OKTA 4O45A 3I7PA 5IT9g 1U2VC 2P9IC 5GMKn 2AGZA 4CI1A 1XKSA 3DWLC 3N0EA 2H3XA 1GP2B 4J8BA 2YNOA 4J0WA 3AL8B 3EI1A 4A08B 2P9PC 2PM9A 1PI6A 3F3GA 2OK4A 2HESX 2YMUA 4GGDA 2OJYA 3K26A 3OL2B 3RMZD 2HKRA 2Q7QA 4A0AB 4BUJC 2CO0A 4ERYA 4FA1D 1ERJA 2PBIB 4ESGA 2H6NA 4CZXA 5HE0B 3RFGA 1B9XA 3CFSB 1GG2B 4GM3A 4ERZA 5A2Qg 5TDHB 4J87A 5TEEA 4CZYA 3NVQA 3EMHA 4GM8A 2H9LA 1NR0A 2H9PA 4IMMA 2O9KA 2CN2A 3RFHA 3EU7A 2IAAA 4CY1A 2J55H 2AGWA 3AL9A 5TEFA 2QXVA 4J78A 2B5MA 3SVWD 1MG3A 1SQJA 3B7FA 4QRJA 3I7HA 4QT8A 4J79A 3I7LA 3I89A 5FA5B 3NVXA 1P22A 5EM2B 3IIYA 4YVDA 4ZOZA 3KRXB 3RRMC 3I8EA 2H47A 4CI8A 4X61B 1NEXB 4U1EI 3PXSD 5IGOA 3PSCB 5EAMA 4AEZA 1MG2A 3GFCA 3OW8A 5FXYA 3FM0A 5H1MA 3F3PA 4CY5A 4XYHA 2MTAH 3MXXA 1K8KC 4Y5RD 3SLED 4FA4D 2CNXA 5EAPA 4O3UB 1B9YA 1PEVA 3HFQA 3EI4B 4EWRA 4A09B 2CO0C 5CYKA 4J86A 5CXCA 3V9FA 4A2MA 4CI2A 2J57G 3PVWB 4H5IA 4BL0A 2Z2OA 3OKWA 4PC0A 5K1CC 3EI2A 3K27A 5K19A 5FKRA 3EI1B 4E5ZB 4A0BA 2J56H 5H14A 2H68A 4A7JA 3W15A 3ZWLB 4GM9A 1L0QA 4BH6A 3PVUB 2W18A 2I0TA 4L9OA 2OVQB 3AH8B 3IIWA 5IGQA 2H9NA 3UKUC 4E54A 3P4FA 3OTTA 3UVLA 2H6KA 3SN6B 4L3GD 5GXIA 1QNIA 3OKYA 3DXKC 4A2LA 3DXMC 3J81g 5FKSA 2XL3A 4LGNA 3VGZA 5CXBB 4CZVA 4FA5D 3MZLA 4JXMA 3DM0A 1K32A 5EALA 3UR4A 5H17A 4ZOYA 2YNPA 3L4OD 4PXWA 4OZUA 5JWZA 2HXCA 4O3TB 4PSXB 3I8CA 4Y7RA 5EMLB 4JSXC 4ES0A 4FA9D 5FKTA 5GSAA 1GXRA 3ODTA 3PXWD 2BBKH 5GXHA 3JPXA 2AGLA 2CE8A 3BWSA 5KDOB 1VYHC 1U4CA 3JZHA 2IUPA 5C2WB 2P9KC 4LG8A 3JB9L 3AL8A 3ULEC 3UVKA 1YFQA 4G56B 1TBGA 4MK0B 4FAVD 3SBRA 3IKOA 2AH1A 2H13A 3CIKB 3SWSD 2PM6B 4QL1A 4IA9A 3BG1A 4NSXA 5C2VB 4TZ4A 3I2NA 3JAMg 5CXCB 2Z2PA 1S4UX 4J73A 2OVPB 1OLZA 5HE3B 2GNQA 2HJBA 4L1QD 2GC7A 5HYNB
chains in the Genus database with same CATH superfamily
4GMBA 4AN1A 1H2ZA 4A0BB 3MKSB 3MVDK 4A11B 1QFMA 3U4YA 2B5LA 3EQ9A 1JJUB 2QC5A 4G1MA 4I79A 1VE6A 1O6GA 3EQ8A 4ZN4A 2HYEA 2BCJB 1OMWB 3E0CA 1PBYB 4AMYA 5EMJB 2YBAA 2OVRB 2HU7A 3FGBA 3GC3B 5I5MA 4D6VA 5AFU3 3EI3A 2AGXA 4CI3A 5EARA 5EM2A 2HU5A 3RN0D 4JSPC 2QZPA 2PM9B 1JMZB 3OKYB 5THAA 2P9NC 1R5MA 1FWXA 3PXTD 3MMYA 1JTDB 2I3TA 3SCYA 1SHYB 3SBPA 3SMRA 3SXTD 2PM7B 1YR2A 3JRPA 4BCBA 2I0SA 4GGAA 4D0KA 2HU8A 3FRXA 4MMZA 2H14A 3V4PA 1JOFA 4Z7NA 1TYQC 3SFZA 4X60B 4JSVC 5E6SA 3UVNA 2CE9A 4JT5C 3EI4A 4XYIA 1UOQA 1T2XA 5FFGA 2TRCB 1A0RB 2XYIA 3C5MA 3EWEA 3ORVD 4NC4A 5B4WA 3EG6A 3UKRC 3GD1I 4FAND 1N6EA 3IJCA 2VDPA 4AN0A 5FQDA 3SHFA 2OIZA 3ZDYA 3MUOA 1GOTB 2P9UC 2B4EA 4LG9A 3C9CA 2G99A 4E5ZA 1VZ3A 1JMXB 3MZKA 2P9LC 3V5WB 4GQ2P 5TF2A 4CY2A 4O02A 3MUNA 3JZNA 3BG0A 4X3EA 5E6UA 1A12A 3A0FA 4QQEA 5C9ZB 4DNUA 3IUNA 3SBQA 2HJ4A 4XEIC 4PSWB 4O9DA 4NBMA 3T3MA 4CY3A 1PGUA 1TYEA 2H9MA 4A08A 4J77A 4WK4A 3UVMA 4G55A 4X63B 5HDBA 1C9LA 3ZE1A 3PE7A 3C75H 3FCSA 2GC4A 4RE6A 2I0RA 4R7AB 3OL2A 1O6FA 4RE5A 4AMZA 4FB1D 4HDJA 3AFCA 2I3SA 3IJ1A 4A0AA 3JZGA 5HE1B 4FWWA 4J82A 4N14A 4H5JA 4K3JB 5CXBA 1Q47A 4FHLA 5CYKB 4Z8LA 5IC7A 4PBYA 1N6FA 2IUVA 3I7OA 2XU7A 3SJLD 3DSMA 2Z2NA 3MKQA 1SQ9A 2P9SC 2EICA 3PSLA 5IJ7E 2UZXB 2HKMA 1RI6A 3RLMD 3I7KA 4CC9A 3UVOA 2OK6A 3EI3B 3V7DB 2YB8B 4UM8A 4O1QD 5FKQA 2WQ8A 3EI2B 4GGCA 2H6QA 5SXMA 3IUQA 4IRZA 4GQBB 4PBZA 4J8GA 4WK0A 4GZ8A 4J81A 3IULA 4KFMB 4AOWA 3VH0A 4PNKB 4JHPC 2IURA 3CFVA 1H2XA 2AGYA 4JSNC 4BP9A 4ZOXA 4J84A 5I5JA 5M5VA 4GQ1A 4E54B 3L4MD 4UI9R 2JKXA 4JT6C 5EMMB 5IJ8E 3O4HA 5AJAA 3NVNA 2EIEA 4L3HD 5HQGA 3VI4A 4K3ID 3I7NA 2XL2A 3VA6A 2G9AA 5M61A 4OWRA 3GREA 1XHMA 3C99A 2CN3A 2UZYB 5FFOA 2AQ5A 5C86A 4MMXA 4ZOVA 1JV2A 3N0DA 5I5IA 2AH0A 3T3PA 2VDQA 2B5NA 2IWKA 1XIPA 2IWFA 4JD2C 3J80g 3NIGA 4ERQA 5M5SA 3KRWB 2EBSA 2IUQA 1N6DA 3IJ0A 5EMKB 3ZE0A 3F3FA 4J0XA 1MDAH 4A11A 2XE4A 1K3IA 4U7AA 2VDNA 5HE2B 1E8MA 5AMSA 4A09A 3JROA 3RN1D 2YNNA 3RSEC 5FLXg 3OKTA 4O45A 3I7PA 5IT9g 1U2VC 2P9IC 5GMKn 2AGZA 4CI1A 1XKSA 3DWLC 3N0EA 5M5TA 2H3XA 1GP2B 4J8BA 2YNOA 4J0WA 3AL8B 3EI1A 4A08B 2P9PC 2PM9A 1PI6A 4MMYA 3F3GA 4D9SA 2OK4A 2HESX 2YMUA 4GGDA 2OJYA 3K26A 2VDOA 3OL2B 3RMZD 3V4VA 2HKRA 2Q7QA 4A0AB 4BUJC 4UM9A 2CO0A 4ERYA 4FA1D 1ERJA 1GOGA 2PBIB 4ESGA 2H6NA 4CZXA 5HE0B 3RFGA 3KCIA 4AX4A 5E6RA 3IJEA 1B9XA 3CFSB 1GG2B 4GM3A 4ERZA 5A2Qg 3NIDA 5TDHB 4J87A 5TEEA 4BP8A 1E5TA 4CZYA 3NVQA 3EMHA 4GM8A 3QHYB 1UTCA 2H9LA 1BPOA 1NR0A 2H9PA 2O9KA 4IMMA 3O4JA 2CN2A 3RFHA 4JHNA 3EU7A 2IAAA 4CY1A 2J55H 2AGWA 1UOOA 3AL9A 5TEFA 2QXVA 4J78A 2B5MA 3SVWD 3NIFA 1MG3A 1SQJA 3B7FA 4QAMA 1I2MB 4QRJA 3ZE2A 3I7HA 4QT8A 4J79A 3FCUA 3I7LA 3I89A 2VDMA 5FA5B 3NVXA 3ZDXA 1P22A 2XDWA 5EM2B 2VZ1A 3VI3A 3IIYA 1L5GA 4NAAA 4YVDA 4ZOZA 3KRXB 3RRMC 3I8EA 2H47A 4WJKA 4CI8A 4X61B 1NEXB 4U1EI 3PXSD 5IGOA 3PSCB 5EAMA 4AEZA 4BCCA 1MG2A 3GFCA 3K72A 3OW8A 5FXYA 3FM0A 4BCDA 5H1MA 2BKLA 3F3PA 4CY5A 4DNWA 1U8CA 2EIDA 4XYHA 2MTAH 1GOFA 4G1EA 3MXXA 4O2WA 1K8KC 3DDUA 3IUMA 4Y5RD 3SLED 4FA4D 2CNXA 5EAPA 4O3UB 1B9YA 1PEVA 3HFQA 3EI4B 4EWRA 4A09B 2CO0C 5CYKA 2QR5A 4J86A 5CXCA 3V9FA 4A2MA 4CI2A 2J57G 3PVWB 3IURA 1VZ2A 4H5IA 4BL0A 2Z2OA 3OKWA 4PC0A 5K1CC 1H2WA 3EI2A 3K27A 5K19A 5FKRA 3EI1B 3EQ7A 4E5ZB 4A0BA 2J56H 5H14A 2H68A 4A7JA 5M5RA 3W15A 3ZWLB 3O4IA 4GM9A 1L0QA 4BH6A 1M1XA 1QFSA 3PVUB 3IVMA 2W18A 1GOHA 5M5UA 2I0TA 4L9OA 2OVQB 4Z7OA 3AH8B 3IIWA 5IGQA 2H9NA 3UKUC 4E54A 3P4FA 5C92A 3OTTA 3UVLA 3O4GA 1E8NA 2H6KA 3SN6B 4L3GD 5GXIA 1QNIA 3OKYA 3DXKC 4A2LA 3DXMC 3J81g 3K6SA 3ZDZA 4L1MA 5FKSA 1H2YA 2XL3A 4LGNA 3VGZA 5CXBB 4CZVA 4FA5D 3MZLA 4JXMA 3DM0A 1K32A 5EALA 3UR4A 5H17A 4ZOYA 2VDLA 2YNPA 3L4OD 4PXWA 4OZUA 1VE7A 3IUJA 5JWZA 2HXCA 3OF7A 4O3TB 4PSXB 3I8CA 2VZ3A 4Y7RA 5EMLB 4JSXC 1C9IA 3QI0A 4ES0A 4FA9D 5FKTA 5GSAA 1GXRA 3ODTA 3PXWD 2BBKH 5GXHA 3JPXA 2AGLA 2CE8A 3BWSA 5KDOB 4WK2A 1VYHC 2VC2A 1U4CA 3JZHA 2IUPA 5C2WB 2P9KC 4LG8A 2VDRA 3JB9L 3AL8A 3ULEC 3UVKA 1YFQA 4G56B 1TBGA 2VDKA 4MK0B 4DNVA 4FAVD 4NENA 3K71A 3SBRA 3IKOA 2AH1A 2H13A 3CIKB 3SWSD 2XZGA 2PM6B 4QL1A 4IA9A 3BG1A 4NSXA 5C2VB 4TZ4A 3I2NA 3JAMg 5CXCB 2Z2PA 1S4UX 4J73A 2OVPB 1OLZA 1UOPA 5HE3B 2EIBA 2GNQA 2HJBA 4L1QD 4Z7QA 2GC7A 5HYNB
chains in the Genus database with same CATH topology
4GMBA 4A0BB 3MKSB 4A11B 3U4YA 2B5LA 1JJUB 2QC5A 4I79A 4ZN4A 2HYEA 2BCJB 1OMWB 3E0CA 1PBYB 5EMJB 2YBAA 2OVRB 3FGBA 5I5MA 4D6VA 5AFU3 3EI3A 2AGXA 4CI3A 5EARA 5EM2A 3RN0D 4JSPC 2PM9B 1JMZB 3OKYB 5THAA 2P9NC 1R5MA 1FWXA 3PXTD 3MMYA 2I3TA 3SCYA 1SHYB 3SBPA 3SMRA 3SXTD 2PM7B 3JRPA 2I0SA 4GGAA 4D0KA 3FRXA 2H14A 1JOFA 1TYQC 3SFZA 4X60B 4JSVC 3UVNA 2CE9A 4JT5C 3EI4A 4XYIA 2TRCB 1A0RB 2XYIA 3C5MA 3EWEA 3ORVD 5B4WA 3EG6A 3UKRC 4FAND 1N6EA 3IJCA 5FQDA 3SHFA 2OIZA 1GOTB 2P9UC 2B4EA 4LG9A 3C9CA 2G99A 4E5ZA 1JMXB 3MZKA 2P9LC 3V5WB 4GQ2P 5TF2A 4CY2A 3JZNA 3BG0A 4X3EA 3A0FA 4QQEA 5C9ZB 3SBQA 2HJ4A 4XEIC 4PSWB 4O9DA 4CY3A 1PGUA 2H9MA 4A08A 4J77A 3UVMA 4X63B 3PE7A 3C75H 2GC4A 2I0RA 4R7AB 3OL2A 4FB1D 4HDJA 3AFCA 2I3SA 3IJ1A 4A0AA 3JZGA 5HE1B 4FWWA 4J82A 4N14A 4H5JA 4K3JB 5CXBA 1Q47A 4FHLA 5CYKB 4Z8LA 5IC7A 4PBYA 1N6FA 2IUVA 3I7OA 2XU7A 3SJLD 3DSMA 2Z2NA 3MKQA 1SQ9A 2P9SC 3PSLA 5IJ7E 2UZXB 2HKMA 1RI6A 3RLMD 3I7KA 4CC9A 3UVOA 2OK6A 3EI3B 3V7DB 2YB8B 4O1QD 5FKQA 3EI2B 4GGCA 2H6QA 5SXMA 4GQBB 4PBZA 4J8GA 4GZ8A 4J81A 4KFMB 4AOWA 3VH0A 4PNKB 2IURA 3CFVA 2AGYA 4JSNC 4ZOXA 4J84A 5I5JA 4GQ1A 4E54B 3L4MD 4UI9R 4JT6C 5IJ8E 5EMMB 5AJAA 3NVNA 4L3HD 5HQGA 4K3ID 3I7NA 2XL2A 3VA6A 2G9AA 4OWRA 3GREA 1XHMA 3C99A 2CN3A 2UZYB 2AQ5A 4ZOVA 3N0DA 5I5IA 2AH0A 2B5NA 2IWKA 1XIPA 2IWFA 4JD2C 3J80g 4ERQA 3KRWB 2EBSA 2IUQA 1N6DA 3IJ0A 5EMKB 3F3FA 4J0XA 1MDAH 4A11A 4U7AA 5HE2B 5AMSA 4A09A 3JROA 3RN1D 2YNNA 3RSEC 5FLXg 3OKTA 4O45A 3I7PA 5IT9g 1U2VC 2P9IC 5GMKn 2AGZA 4CI1A 1XKSA 3DWLC 3N0EA 2H3XA 1GP2B 4J8BA 2YNOA 4J0WA 3AL8B 3EI1A 4A08B 2P9PC 2PM9A 1PI6A 3F3GA 2OK4A 2HESX 2YMUA 4GGDA 2OJYA 3K26A 3OL2B 3RMZD 2HKRA 2Q7QA 4A0AB 4BUJC 2CO0A 4ERYA 4FA1D 1ERJA 2PBIB 4ESGA 2H6NA 4CZXA 5HE0B 3RFGA 1B9XA 3CFSB 1GG2B 4GM3A 4ERZA 5A2Qg 5TDHB 4J87A 5TEEA 4CZYA 3NVQA 3EMHA 4GM8A 2H9LA 1NR0A 2H9PA 4IMMA 2O9KA 2CN2A 3RFHA 3EU7A 2IAAA 4CY1A 2J55H 2AGWA 3AL9A 5TEFA 2QXVA 4J78A 2B5MA 3SVWD 1MG3A 1SQJA 3B7FA 4QRJA 3I7HA 4QT8A 4J79A 3I7LA 3I89A 5FA5B 3NVXA 1P22A 5EM2B 3IIYA 4YVDA 4ZOZA 3KRXB 3RRMC 3I8EA 2H47A 4CI8A 4X61B 1NEXB 4U1EI 3PXSD 5IGOA 3PSCB 5EAMA 4AEZA 1MG2A 3GFCA 3OW8A 5FXYA 3FM0A 5H1MA 3F3PA 4CY5A 4XYHA 2MTAH 3MXXA 1K8KC 4Y5RD 3SLED 4FA4D 2CNXA 5EAPA 4O3UB 1B9YA 1PEVA 3HFQA 3EI4B 4EWRA 4A09B 2CO0C 5CYKA 4J86A 5CXCA 3V9FA 4A2MA 4CI2A 2J57G 3PVWB 4H5IA 4BL0A 2Z2OA 3OKWA 4PC0A 5K1CC 3EI2A 3K27A 5K19A 5FKRA 3EI1B 4E5ZB 4A0BA 2J56H 5H14A 2H68A 4A7JA 3W15A 3ZWLB 4GM9A 1L0QA 4BH6A 3PVUB 2W18A 2I0TA 4L9OA 2OVQB 3AH8B 3IIWA 5IGQA 2H9NA 3UKUC 4E54A 3P4FA 3OTTA 3UVLA 2H6KA 3SN6B 4L3GD 5GXIA 1QNIA 3OKYA 3DXKC 4A2LA 3DXMC 3J81g 5FKSA 2XL3A 4LGNA 3VGZA 5CXBB 4CZVA 4FA5D 3MZLA 4JXMA 3DM0A 1K32A 5EALA 3UR4A 5H17A 4ZOYA 2YNPA 3L4OD 4PXWA 4OZUA 5JWZA 2HXCA 4O3TB 4PSXB 3I8CA 4Y7RA 5EMLB 4JSXC 4ES0A 4FA9D 5FKTA 5GSAA 1GXRA 3ODTA 3PXWD 2BBKH 5GXHA 3JPXA 2AGLA 2CE8A 3BWSA 5KDOB 1VYHC 1U4CA 3JZHA 2IUPA 5C2WB 2P9KC 4LG8A 3JB9L 3AL8A 3ULEC 3UVKA 1YFQA 4G56B 1TBGA 4MK0B 4FAVD 3SBRA 3IKOA 2AH1A 2H13A 3CIKB 3SWSD 2PM6B 4QL1A 4IA9A 3BG1A 4NSXA 5C2VB 4TZ4A 3I2NA 3JAMg 5CXCB 2Z2PA 1S4UX 4J73A 2OVPB 1OLZA 5HE3B 2GNQA 2HJBA 4L1QD 2GC7A 5HYNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMB A;  4A0B B;  3MKS B;  4A11 B;  3U4Y A;  2B5L A;  1JJU B;  2QC5 A;  4I79 A;  4ZN4 A;  2HYE A;  2BCJ B;  1OMW B;  3E0C A;  1PBY B;  5EMJ B;  2YBA A;  2OVR B;  3FGB A;  5I5M A;  4D6V A;  5AFU 3;  3EI3 A;  2AGX A;  4CI3 A;  5EAR A;  5EM2 A;  3RN0 D;  4JSP C;  2PM9 B;  1JMZ B;  3OKY B;  5THA A;  2P9N C;  1R5M A;  1FWX A;  3PXT D;  3MMY A;  2I3T A;  3SCY A;  1SHY B;  3SBP A;  3SMR A;  3SXT D;  2PM7 B;  3JRP A;  2I0S A;  4GGA A;  4D0K A;  3FRX A;  2H14 A;  1JOF A;  1TYQ C;  3SFZ A;  4X60 B;  4JSV C;  3UVN A;  2CE9 A;  4JT5 C;  3EI4 A;  4XYI A;  2TRC B;  1A0R B;  2XYI A;  3C5M A;  3EWE A;  3ORV D;  5B4W A;  3EG6 A;  3UKR C;  4FAN D;  1N6E A;  3IJC A;  5FQD A;  3SHF A;  2OIZ A;  1GOT B;  2P9U C;  2B4E A;  4LG9 A;  3C9C A;  2G99 A;  4E5Z A;  1JMX B;  3MZK A;  2P9L C;  3V5W B;  4GQ2 P;  5TF2 A;  4CY2 A;  3JZN A;  3BG0 A;  4X3E A;  3A0F A;  4QQE A;  5C9Z B;  3SBQ A;  2HJ4 A;  4XEI C;  4PSW B;  4O9D A;  4CY3 A;  1PGU A;  2H9M A;  4A08 A;  4J77 A;  3UVM A;  4X63 B;  3PE7 A;  3C75 H;  2GC4 A;  2I0R A;  4R7A B;  3OL2 A;  4FB1 D;  4HDJ A;  3AFC A;  2I3S A;  3IJ1 A;  4A0A A;  3JZG A;  5HE1 B;  4FWW A;  4J82 A;  4N14 A;  4H5J A;  4K3J B;  5CXB A;  1Q47 A;  4FHL A;  5CYK B;  4Z8L A;  5IC7 A;  4PBY A;  1N6F A;  2IUV A;  3I7O A;  2XU7 A;  3SJL D;  3DSM A;  2Z2N A;  3MKQ A;  1SQ9 A;  2P9S C;  3PSL A;  5IJ7 E;  2UZX B;  2HKM A;  1RI6 A;  3RLM D;  3I7K A;  4CC9 A;  3UVO A;  2OK6 A;  3EI3 B;  3V7D B;  2YB8 B;  4O1Q D;  5FKQ A;  3EI2 B;  4GGC A;  2H6Q A;  5SXM A;  4GQB B;  4PBZ A;  4J8G A;  4GZ8 A;  4J81 A;  4KFM B;  4AOW A;  3VH0 A;  4PNK B;  2IUR A;  3CFV A;  2AGY A;  4JSN C;  4ZOX A;  4J84 A;  5I5J A;  4GQ1 A;  4E54 B;  3L4M D;  4UI9 R;  4JT6 C;  5IJ8 E;  5EMM B;  5AJA A;  3NVN A;  4L3H D;  5HQG A;  4K3I D;  3I7N A;  2XL2 A;  3VA6 A;  2G9A A;  4OWR A;  3GRE A;  1XHM A;  3C99 A;  2CN3 A;  2UZY B;  2AQ5 A;  4ZOV A;  3N0D A;  5I5I A;  2AH0 A;  2B5N A;  2IWK A;  1XIP A;  2IWF A;  4JD2 C;  3J80 g;  4ERQ A;  3KRW B;  2EBS A;  2IUQ A;  1N6D A;  3IJ0 A;  5EMK B;  3F3F A;  4J0X A;  1MDA H;  4A11 A;  4U7A A;  5HE2 B;  5AMS A;  4A09 A;  3JRO A;  3RN1 D;  2YNN A;  3RSE C;  5FLX g;  3OKT A;  4O45 A;  3I7P A;  5IT9 g;  1U2V C;  2P9I C;  5GMK n;  2AGZ A;  4CI1 A;  1XKS A;  3DWL C;  3N0E A;  2H3X A;  1GP2 B;  4J8B A;  2YNO A;  4J0W A;  3AL8 B;  3EI1 A;  4A08 B;  2P9P C;  2PM9 A;  1PI6 A;  3F3G A;  2OK4 A;  2HES X;  2YMU A;  4GGD A;  2OJY A;  3K26 A;  3OL2 B;  3RMZ D;  2HKR A;  2Q7Q A;  4A0A B;  4BUJ C;  2CO0 A;  4ERY A;  4FA1 D;  1ERJ A;  2PBI B;  4ESG A;  2H6N A;  4CZX A;  5HE0 B;  3RFG A;  1B9X A;  3CFS B;  1GG2 B;  4GM3 A;  4ERZ A;  5A2Q g;  5TDH B;  4J87 A;  5TEE A;  4CZY A;  3NVQ A;  3EMH A;  4GM8 A;  2H9L A;  1NR0 A;  2H9P A;  4IMM A;  2O9K A;  2CN2 A;  3RFH A;  3EU7 A;  2IAA A;  4CY1 A;  2J55 H;  2AGW A;  3AL9 A;  5TEF A;  2QXV A;  4J78 A;  2B5M A;  3SVW D;  1MG3 A;  1SQJ A;  3B7F A;  4QRJ A;  3I7H A;  4QT8 A;  4J79 A;  3I7L A;  3I89 A;  5FA5 B;  3NVX A;  1P22 A;  5EM2 B;  3IIY A;  4YVD A;  4ZOZ A;  3KRX B;  3RRM C;  3I8E A;  2H47 A;  4CI8 A;  4X61 B;  1NEX B;  4U1E I;  3PXS D;  5IGO A;  3PSC B;  5EAM A;  4AEZ A;  1MG2 A;  3GFC A;  3OW8 A;  5FXY A;  3FM0 A;  5H1M A;  3F3P A;  4CY5 A;  4XYH A;  2MTA H;  3MXX A;  1K8K C;  4Y5R D;  3SLE D;  4FA4 D;  2CNX A;  5EAP A;  4O3U B;  1B9Y A;  1PEV A;  3HFQ A;  3EI4 B;  4EWR A;  4A09 B;  2CO0 C;  5CYK A;  4J86 A;  5CXC A;  3V9F A;  4A2M A;  4CI2 A;  2J57 G;  3PVW B;  4H5I A;  4BL0 A;  2Z2O A;  3OKW A;  4PC0 A;  5K1C C;  3EI2 A;  3K27 A;  5K19 A;  5FKR A;  3EI1 B;  4E5Z B;  4A0B A;  2J56 H;  5H14 A;  2H68 A;  4A7J A;  3W15 A;  3ZWL B;  4GM9 A;  1L0Q A;  4BH6 A;  3PVU B;  2W18 A;  2I0T A;  4L9O A;  2OVQ B;  3AH8 B;  3IIW A;  5IGQ A;  2H9N A;  3UKU C;  4E54 A;  3P4F A;  3OTT A;  3UVL A;  2H6K A;  3SN6 B;  4L3G D;  5GXI A;  1QNI A;  3OKY A;  3DXK C;  4A2L A;  3DXM C;  3J81 g;  5FKS A;  2XL3 A;  4LGN A;  3VGZ A;  5CXB B;  4CZV A;  4FA5 D;  3MZL A;  4JXM A;  3DM0 A;  1K32 A;  5EAL A;  3UR4 A;  5H17 A;  4ZOY A;  2YNP A;  3L4O D;  4PXW A;  4OZU A;  5JWZ A;  2HXC A;  4O3T B;  4PSX B;  3I8C A;  4Y7R A;  5EML B;  4JSX C;  4ES0 A;  4FA9 D;  5FKT A;  5GSA A;  1GXR A;  3ODT A;  3PXW D;  2BBK H;  5GXH A;  3JPX A;  2AGL A;  2CE8 A;  3BWS A;  5KDO B;  1VYH C;  1U4C A;  3JZH A;  2IUP A;  5C2W B;  2P9K C;  4LG8 A;  3JB9 L;  3AL8 A;  3ULE C;  3UVK A;  1YFQ A;  4G56 B;  1TBG A;  4MK0 B;  4FAV D;  3SBR A;  3IKO A;  2AH1 A;  2H13 A;  3CIK B;  3SWS D;  2PM6 B;  4QL1 A;  4IA9 A;  3BG1 A;  4NSX A;  5C2V B;  4TZ4 A;  3I2N A;  3JAM g;  5CXC B;  2Z2P A;  1S4U X;  4J73 A;  2OVP B;  1OLZ A;  5HE3 B;  2GNQ A;  2HJB A;  4L1Q D;  2GC7 A;  5HYN B; 
#chains in the Genus database with same CATH topology
 4GMB A;  4AN1 A;  1H2Z A;  4A0B B;  3MKS B;  3MVD K;  4A11 B;  1QFM A;  3U4Y A;  2B5L A;  3EQ9 A;  1JJU B;  2QC5 A;  4G1M A;  4I79 A;  1VE6 A;  1O6G A;  3EQ8 A;  4ZN4 A;  2HYE A;  2BCJ B;  1OMW B;  3E0C A;  1PBY B;  4AMY A;  5EMJ B;  2YBA A;  2OVR B;  2HU7 A;  3FGB A;  3GC3 B;  5I5M A;  4D6V A;  5AFU 3;  3EI3 A;  2AGX A;  4CI3 A;  5EAR A;  5EM2 A;  2HU5 A;  3RN0 D;  4JSP C;  2QZP A;  2PM9 B;  1JMZ B;  3OKY B;  5THA A;  2P9N C;  1R5M A;  1FWX A;  3PXT D;  3MMY A;  1JTD B;  2I3T A;  3SCY A;  1SHY B;  3SBP A;  3SMR A;  3SXT D;  2PM7 B;  1YR2 A;  3JRP A;  4BCB A;  2I0S A;  4GGA A;  4D0K A;  2HU8 A;  3FRX A;  4MMZ A;  2H14 A;  3V4P A;  1JOF A;  4Z7N A;  1TYQ C;  3SFZ A;  4X60 B;  4JSV C;  5E6S A;  3UVN A;  2CE9 A;  4JT5 C;  3EI4 A;  4XYI A;  1UOQ A;  1T2X A;  5FFG A;  2TRC B;  1A0R B;  2XYI A;  3C5M A;  3EWE A;  3ORV D;  4NC4 A;  5B4W A;  3EG6 A;  3UKR C;  3GD1 I;  4FAN D;  1N6E A;  3IJC A;  2VDP A;  4AN0 A;  5FQD A;  3SHF A;  2OIZ A;  3ZDY A;  3MUO A;  1GOT B;  2P9U C;  2B4E A;  4LG9 A;  3C9C A;  2G99 A;  4E5Z A;  1VZ3 A;  1JMX B;  3MZK A;  2P9L C;  3V5W B;  4GQ2 P;  5TF2 A;  4CY2 A;  4O02 A;  3MUN A;  3JZN A;  3BG0 A;  4X3E A;  5E6U A;  1A12 A;  3A0F A;  4QQE A;  5C9Z B;  4DNU A;  3IUN A;  3SBQ A;  2HJ4 A;  4XEI C;  4PSW B;  4O9D A;  4NBM A;  3T3M A;  4CY3 A;  1PGU A;  1TYE A;  2H9M A;  4A08 A;  4J77 A;  4WK4 A;  3UVM A;  4G55 A;  4X63 B;  5HDB A;  1C9L A;  3ZE1 A;  3PE7 A;  3C75 H;  3FCS A;  2GC4 A;  4RE6 A;  2I0R A;  4R7A B;  3OL2 A;  1O6F A;  4RE5 A;  4AMZ A;  4FB1 D;  4HDJ A;  3AFC A;  2I3S A;  3IJ1 A;  4A0A A;  3JZG A;  5HE1 B;  4FWW A;  4J82 A;  4N14 A;  4H5J A;  4K3J B;  5CXB A;  1Q47 A;  4FHL A;  5CYK B;  4Z8L A;  5IC7 A;  4PBY A;  1N6F A;  2IUV A;  3I7O A;  2XU7 A;  3SJL D;  3DSM A;  2Z2N A;  3MKQ A;  1SQ9 A;  2P9S C;  2EIC A;  3PSL A;  5IJ7 E;  2UZX B;  2HKM A;  1RI6 A;  3RLM D;  3I7K A;  4CC9 A;  3UVO A;  2OK6 A;  3EI3 B;  3V7D B;  2YB8 B;  4UM8 A;  4O1Q D;  5FKQ A;  2WQ8 A;  3EI2 B;  4GGC A;  2H6Q A;  5SXM A;  3IUQ A;  4IRZ A;  4GQB B;  4PBZ A;  4J8G A;  4WK0 A;  4GZ8 A;  4J81 A;  3IUL A;  4KFM B;  4AOW A;  3VH0 A;  4PNK B;  4JHP C;  2IUR A;  3CFV A;  1H2X A;  2AGY A;  4JSN C;  4BP9 A;  4ZOX A;  4J84 A;  5I5J A;  5M5V A;  4GQ1 A;  4E54 B;  3L4M D;  4UI9 R;  2JKX A;  4JT6 C;  5EMM B;  5IJ8 E;  3O4H A;  5AJA A;  3NVN A;  2EIE A;  4L3H D;  5HQG A;  3VI4 A;  4K3I D;  3I7N A;  2XL2 A;  3VA6 A;  2G9A A;  5M61 A;  4OWR A;  3GRE A;  1XHM A;  3C99 A;  2CN3 A;  2UZY B;  5FFO A;  2AQ5 A;  5C86 A;  4MMX A;  4ZOV A;  1JV2 A;  3N0D A;  5I5I A;  2AH0 A;  3T3P A;  2VDQ A;  2B5N A;  2IWK A;  1XIP A;  2IWF A;  4JD2 C;  3J80 g;  3NIG A;  4ERQ A;  5M5S A;  3KRW B;  2EBS A;  2IUQ A;  1N6D A;  3IJ0 A;  5EMK B;  3ZE0 A;  3F3F A;  4J0X A;  1MDA H;  4A11 A;  2XE4 A;  1K3I A;  4U7A A;  2VDN A;  5HE2 B;  1E8M A;  5AMS A;  4A09 A;  3JRO A;  3RN1 D;  2YNN A;  3RSE C;  5FLX g;  3OKT A;  4O45 A;  3I7P A;  5IT9 g;  1U2V C;  2P9I C;  5GMK n;  2AGZ A;  4CI1 A;  1XKS A;  3DWL C;  3N0E A;  5M5T A;  2H3X A;  1GP2 B;  4J8B A;  2YNO A;  4J0W A;  3AL8 B;  3EI1 A;  4A08 B;  2P9P C;  2PM9 A;  1PI6 A;  4MMY A;  3F3G A;  4D9S A;  2OK4 A;  2HES X;  2YMU A;  4GGD A;  2OJY A;  3K26 A;  2VDO A;  3OL2 B;  3RMZ D;  3V4V A;  2HKR A;  2Q7Q A;  4A0A B;  4BUJ C;  4UM9 A;  2CO0 A;  4ERY A;  4FA1 D;  1ERJ A;  1GOG A;  2PBI B;  4ESG A;  2H6N A;  4CZX A;  5HE0 B;  3RFG A;  3KCI A;  4AX4 A;  5E6R A;  3IJE A;  1B9X A;  3CFS B;  1GG2 B;  4GM3 A;  4ERZ A;  5A2Q g;  3NID A;  5TDH B;  4J87 A;  5TEE A;  4BP8 A;  1E5T A;  4CZY A;  3NVQ A;  3EMH A;  4GM8 A;  3QHY B;  1UTC A;  2H9L A;  1BPO A;  1NR0 A;  2H9P A;  2O9K A;  4IMM A;  3O4J A;  2CN2 A;  3RFH A;  4JHN A;  3EU7 A;  2IAA A;  4CY1 A;  2J55 H;  2AGW A;  1UOO A;  3AL9 A;  5TEF A;  2QXV A;  4J78 A;  2B5M A;  3SVW D;  3NIF A;  1MG3 A;  1SQJ A;  3B7F A;  4QAM A;  1I2M B;  4QRJ A;  3ZE2 A;  3I7H A;  4QT8 A;  4J79 A;  3FCU A;  3I7L A;  3I89 A;  2VDM A;  5FA5 B;  3NVX A;  3ZDX A;  1P22 A;  2XDW A;  5EM2 B;  2VZ1 A;  3VI3 A;  3IIY A;  1L5G A;  4NAA A;  4YVD A;  4ZOZ A;  3KRX B;  3RRM C;  3I8E A;  2H47 A;  4WJK A;  4CI8 A;  4X61 B;  1NEX B;  4U1E I;  3PXS D;  5IGO A;  3PSC B;  5EAM A;  4AEZ A;  4BCC A;  1MG2 A;  3GFC A;  3K72 A;  3OW8 A;  5FXY A;  3FM0 A;  4BCD A;  5H1M A;  2BKL A;  3F3P A;  4CY5 A;  4DNW A;  1U8C A;  2EID A;  4XYH A;  2MTA H;  1GOF A;  4G1E A;  3MXX A;  4O2W A;  1K8K C;  3DDU A;  3IUM A;  4Y5R D;  3SLE D;  4FA4 D;  2CNX A;  5EAP A;  4O3U B;  1B9Y A;  1PEV A;  3HFQ A;  3EI4 B;  4EWR A;  4A09 B;  2CO0 C;  5CYK A;  2QR5 A;  4J86 A;  5CXC A;  3V9F A;  4A2M A;  4CI2 A;  2J57 G;  3PVW B;  3IUR A;  1VZ2 A;  4H5I A;  4BL0 A;  2Z2O A;  3OKW A;  4PC0 A;  5K1C C;  1H2W A;  3EI2 A;  3K27 A;  5K19 A;  5FKR A;  3EI1 B;  3EQ7 A;  4E5Z B;  4A0B A;  2J56 H;  5H14 A;  2H68 A;  4A7J A;  5M5R A;  3W15 A;  3ZWL B;  3O4I A;  4GM9 A;  1L0Q A;  4BH6 A;  1M1X A;  1QFS A;  3PVU B;  3IVM A;  2W18 A;  1GOH A;  5M5U A;  2I0T A;  4L9O A;  2OVQ B;  4Z7O A;  3AH8 B;  3IIW A;  5IGQ A;  2H9N A;  3UKU C;  4E54 A;  3P4F A;  5C92 A;  3OTT A;  3UVL A;  3O4G A;  1E8N A;  2H6K A;  3SN6 B;  4L3G D;  5GXI A;  1QNI A;  3OKY A;  3DXK C;  4A2L A;  3DXM C;  3J81 g;  3K6S A;  3ZDZ A;  4L1M A;  5FKS A;  1H2Y A;  2XL3 A;  4LGN A;  3VGZ A;  5CXB B;  4CZV A;  4FA5 D;  3MZL A;  4JXM A;  3DM0 A;  1K32 A;  5EAL A;  3UR4 A;  5H17 A;  4ZOY A;  2VDL A;  2YNP A;  3L4O D;  4PXW A;  4OZU A;  1VE7 A;  3IUJ A;  5JWZ A;  2HXC A;  3OF7 A;  4O3T B;  4PSX B;  3I8C A;  2VZ3 A;  4Y7R A;  5EML B;  4JSX C;  1C9I A;  3QI0 A;  4ES0 A;  4FA9 D;  5FKT A;  5GSA A;  1GXR A;  3ODT A;  3PXW D;  2BBK H;  5GXH A;  3JPX A;  2AGL A;  2CE8 A;  3BWS A;  5KDO B;  4WK2 A;  1VYH C;  2VC2 A;  1U4C A;  3JZH A;  2IUP A;  5C2W B;  2P9K C;  4LG8 A;  2VDR A;  3JB9 L;  3AL8 A;  3ULE C;  3UVK A;  1YFQ A;  4G56 B;  1TBG A;  2VDK A;  4MK0 B;  4DNV A;  4FAV D;  4NEN A;  3K71 A;  3SBR A;  3IKO A;  2AH1 A;  2H13 A;  3CIK B;  3SWS D;  2XZG A;  2PM6 B;  4QL1 A;  4IA9 A;  3BG1 A;  4NSX A;  5C2V B;  4TZ4 A;  3I2N A;  3JAM g;  5CXC B;  2Z2P A;  1S4U X;  4J73 A;  2OVP B;  1OLZ A;  1UOP A;  5HE3 B;  2EIB A;  2GNQ A;  2HJB A;  4L1Q D;  4Z7Q A;  2GC7 A;  5HYN B; 
#chains in the Genus database with same CATH homology
 4GMB A;  4A0B B;  3MKS B;  4A11 B;  3U4Y A;  2B5L A;  1JJU B;  2QC5 A;  4I79 A;  4ZN4 A;  2HYE A;  2BCJ B;  1OMW B;  3E0C A;  1PBY B;  5EMJ B;  2YBA A;  2OVR B;  3FGB A;  5I5M A;  4D6V A;  5AFU 3;  3EI3 A;  2AGX A;  4CI3 A;  5EAR A;  5EM2 A;  3RN0 D;  4JSP C;  2PM9 B;  1JMZ B;  3OKY B;  5THA A;  2P9N C;  1R5M A;  1FWX A;  3PXT D;  3MMY A;  2I3T A;  3SCY A;  1SHY B;  3SBP A;  3SMR A;  3SXT D;  2PM7 B;  3JRP A;  2I0S A;  4GGA A;  4D0K A;  3FRX A;  2H14 A;  1JOF A;  1TYQ C;  3SFZ A;  4X60 B;  4JSV C;  3UVN A;  2CE9 A;  4JT5 C;  3EI4 A;  4XYI A;  2TRC B;  1A0R B;  2XYI A;  3C5M A;  3EWE A;  3ORV D;  5B4W A;  3EG6 A;  3UKR C;  4FAN D;  1N6E A;  3IJC A;  5FQD A;  3SHF A;  2OIZ A;  1GOT B;  2P9U C;  2B4E A;  4LG9 A;  3C9C A;  2G99 A;  4E5Z A;  1JMX B;  3MZK A;  2P9L C;  3V5W B;  4GQ2 P;  5TF2 A;  4CY2 A;  3JZN A;  3BG0 A;  4X3E A;  3A0F A;  4QQE A;  5C9Z B;  3SBQ A;  2HJ4 A;  4XEI C;  4PSW B;  4O9D A;  4CY3 A;  1PGU A;  2H9M A;  4A08 A;  4J77 A;  3UVM A;  4X63 B;  3PE7 A;  3C75 H;  2GC4 A;  2I0R A;  4R7A B;  3OL2 A;  4FB1 D;  4HDJ A;  3AFC A;  2I3S A;  3IJ1 A;  4A0A A;  3JZG A;  5HE1 B;  4FWW A;  4J82 A;  4N14 A;  4H5J A;  4K3J B;  5CXB A;  1Q47 A;  4FHL A;  5CYK B;  4Z8L A;  5IC7 A;  4PBY A;  1N6F A;  2IUV A;  3I7O A;  2XU7 A;  3SJL D;  3DSM A;  2Z2N A;  3MKQ A;  1SQ9 A;  2P9S C;  3PSL A;  5IJ7 E;  2UZX B;  2HKM A;  1RI6 A;  3RLM D;  3I7K A;  4CC9 A;  3UVO A;  2OK6 A;  3EI3 B;  3V7D B;  2YB8 B;  4O1Q D;  5FKQ A;  3EI2 B;  4GGC A;  2H6Q A;  5SXM A;  4GQB B;  4PBZ A;  4J8G A;  4GZ8 A;  4J81 A;  4KFM B;  4AOW A;  3VH0 A;  4PNK B;  2IUR A;  3CFV A;  2AGY A;  4JSN C;  4ZOX A;  4J84 A;  5I5J A;  4GQ1 A;  4E54 B;  3L4M D;  4UI9 R;  4JT6 C;  5IJ8 E;  5EMM B;  5AJA A;  3NVN A;  4L3H D;  5HQG A;  4K3I D;  3I7N A;  2XL2 A;  3VA6 A;  2G9A A;  4OWR A;  3GRE A;  1XHM A;  3C99 A;  2CN3 A;  2UZY B;  2AQ5 A;  4ZOV A;  3N0D A;  5I5I A;  2AH0 A;  2B5N A;  2IWK A;  1XIP A;  2IWF A;  4JD2 C;  3J80 g;  4ERQ A;  3KRW B;  2EBS A;  2IUQ A;  1N6D A;  3IJ0 A;  5EMK B;  3F3F A;  4J0X A;  1MDA H;  4A11 A;  4U7A A;  5HE2 B;  5AMS A;  4A09 A;  3JRO A;  3RN1 D;  2YNN A;  3RSE C;  5FLX g;  3OKT A;  4O45 A;  3I7P A;  5IT9 g;  1U2V C;  2P9I C;  5GMK n;  2AGZ A;  4CI1 A;  1XKS A;  3DWL C;  3N0E A;  2H3X A;  1GP2 B;  4J8B A;  2YNO A;  4J0W A;  3AL8 B;  3EI1 A;  4A08 B;  2P9P C;  2PM9 A;  1PI6 A;  3F3G A;  2OK4 A;  2HES X;  2YMU A;  4GGD A;  2OJY A;  3K26 A;  3OL2 B;  3RMZ D;  2HKR A;  2Q7Q A;  4A0A B;  4BUJ C;  2CO0 A;  4ERY A;  4FA1 D;  1ERJ A;  2PBI B;  4ESG A;  2H6N A;  4CZX A;  5HE0 B;  3RFG A;  1B9X A;  3CFS B;  1GG2 B;  4GM3 A;  4ERZ A;  5A2Q g;  5TDH B;  4J87 A;  5TEE A;  4CZY A;  3NVQ A;  3EMH A;  4GM8 A;  2H9L A;  1NR0 A;  2H9P A;  4IMM A;  2O9K A;  2CN2 A;  3RFH A;  3EU7 A;  2IAA A;  4CY1 A;  2J55 H;  2AGW A;  3AL9 A;  5TEF A;  2QXV A;  4J78 A;  2B5M A;  3SVW D;  1MG3 A;  1SQJ A;  3B7F A;  4QRJ A;  3I7H A;  4QT8 A;  4J79 A;  3I7L A;  3I89 A;  5FA5 B;  3NVX A;  1P22 A;  5EM2 B;  3IIY A;  4YVD A;  4ZOZ A;  3KRX B;  3RRM C;  3I8E A;  2H47 A;  4CI8 A;  4X61 B;  1NEX B;  4U1E I;  3PXS D;  5IGO A;  3PSC B;  5EAM A;  4AEZ A;  1MG2 A;  3GFC A;  3OW8 A;  5FXY A;  3FM0 A;  5H1M A;  3F3P A;  4CY5 A;  4XYH A;  2MTA H;  3MXX A;  1K8K C;  4Y5R D;  3SLE D;  4FA4 D;  2CNX A;  5EAP A;  4O3U B;  1B9Y A;  1PEV A;  3HFQ A;  3EI4 B;  4EWR A;  4A09 B;  2CO0 C;  5CYK A;  4J86 A;  5CXC A;  3V9F A;  4A2M A;  4CI2 A;  2J57 G;  3PVW B;  4H5I A;  4BL0 A;  2Z2O A;  3OKW A;  4PC0 A;  5K1C C;  3EI2 A;  3K27 A;  5K19 A;  5FKR A;  3EI1 B;  4E5Z B;  4A0B A;  2J56 H;  5H14 A;  2H68 A;  4A7J A;  3W15 A;  3ZWL B;  4GM9 A;  1L0Q A;  4BH6 A;  3PVU B;  2W18 A;  2I0T A;  4L9O A;  2OVQ B;  3AH8 B;  3IIW A;  5IGQ A;  2H9N A;  3UKU C;  4E54 A;  3P4F A;  3OTT A;  3UVL A;  2H6K A;  3SN6 B;  4L3G D;  5GXI A;  1QNI A;  3OKY A;  3DXK C;  4A2L A;  3DXM C;  3J81 g;  5FKS A;  2XL3 A;  4LGN A;  3VGZ A;  5CXB B;  4CZV A;  4FA5 D;  3MZL A;  4JXM A;  3DM0 A;  1K32 A;  5EAL A;  3UR4 A;  5H17 A;  4ZOY A;  2YNP A;  3L4O D;  4PXW A;  4OZU A;  5JWZ A;  2HXC A;  4O3T B;  4PSX B;  3I8C A;  4Y7R A;  5EML B;  4JSX C;  4ES0 A;  4FA9 D;  5FKT A;  5GSA A;  1GXR A;  3ODT A;  3PXW D;  2BBK H;  5GXH A;  3JPX A;  2AGL A;  2CE8 A;  3BWS A;  5KDO B;  1VYH C;  1U4C A;  3JZH A;  2IUP A;  5C2W B;  2P9K C;  4LG8 A;  3JB9 L;  3AL8 A;  3ULE C;  3UVK A;  1YFQ A;  4G56 B;  1TBG A;  4MK0 B;  4FAV D;  3SBR A;  3IKO A;  2AH1 A;  2H13 A;  3CIK B;  3SWS D;  2PM6 B;  4QL1 A;  4IA9 A;  3BG1 A;  4NSX A;  5C2V B;  4TZ4 A;  3I2N A;  3JAM g;  5CXC B;  2Z2P A;  1S4U X;  4J73 A;  2OVP B;  1OLZ A;  5HE3 B;  2GNQ A;  2HJB A;  4L1Q D;  2GC7 A;  5HYN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...