5FXYA

Structure of the human rbbp4:mta1(464-546) complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
402
structure length
381
Chain Sequence
DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPNLSGHLLSASDDHTICLWDISAVPGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-BINDING PROTEIN RBBP4
publication title The structure of the core NuRD repression complex provides insights into its interaction with chromatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 381
sequence length 402
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fxyA00
5HYNB 4GQ1A 4O9DA 2XU7A 2H13A 3N0DA 5IGOA 5C2VB 2I3TA 3C99A 4K3JB 3SVWD 4O3TB 2UZYB 3F3GA 2H14A 2B5LA 3MKQA 4PBZA 4CI3A 4XYHA 5FKSA 4IMMA 5EAPA 1NR0A 4EWRA 5EMJB 3SN6B 3JZNA 4JT6C 1A0RB 3K27A 4ZOXA 3V9FA 1FWXA 1N6EA 4ZOYA 4J79A 2AGYA 4A7JA 4FA9D 5IT9g 4CY2A 1S4UX 3E0CA 4KFMB 1GXRA 5EALA 4IA9A 4ZN4A 3L4MD 3I7OA 4QT8A 4JXMA 4Y7RA 3BWSA 3DM0A 2IWKA 1U4CA 3F3FA 2H6KA 5AMSA 4FA4D 1U2VC 4ZOVA 4J81A 3EMHA 4GM8A 4NSXA 1JMXB 3I7HA 4A0AA 2YBAA 3EI3A 3I2NA 2HKMA 3V5WB 3NVQA 4J84A 5GXHA 4I79A 4JT5C 3F3PA 3EU7A 3VA6A 3JPXA 3KRXB 2B5NA 2QC5A 4J78A 4U1EI 4JSVC 2AH1A 4ERZA 4J0XA 1N6FA 1SQJA 3PXWD 2BCJB 1TBGA 3OTTA 3PXTD 5AJAA 2AGLA 3MKSB 2P9PC 4J77A 2O9KA 2IURA 2YNNA 3RFGA 4D0KA 4XEIC 1B9XA 1MDAH 5TEFA 3A0FA 3DWLC 5GXIA 4LGNA 3IKOA 3IIYA 3VGZA 4L9OA 2P9KC 3RFHA 4Z8LA 3EI3B 5FLXg 4X61B 3EWEA 3OKTA 4HDJA 5CXBA 4ERYA 4G56B 2IWFA 1N6DA 5TEEA 2IUQA 5HE0B 3SBQA 5EMLB 3EI4A 3OW8A 4JSPC 1K8KC 5GSAA 3C9CA 3SBRA 3IIWA 4PC0A 5B4WA 3ODTA 3RLMD 5HE3B 3DSMA 3MZKA 5CYKB 5IC7A 5K19A 2Z2OA 5H17A 1GOTB 4CY3A 4A09B 3SXTD 4CZXA 4UI9R 2P9LC 4JD2C 4FAND 3OKYA 3CFSB 4A0BA 2XL2A 3SFZA 3IJCA 4CI1A 1QNIA 2CN3A 2XL3A 5H1MA 4GQBB 2AH0A 3B7FA 1XKSA 3C75H 2P9NC 5I5IA 5IJ8E 1JOFA 2QXVA 5CXBB 3U4YA 3GFCA 1VYHC 4FAVD 4CZVA 2IUPA 3EG6A 3AFCA 3AH8B 3UKRC 3EI4B 3JRPA 1JMZB 2CO0C 2PM7B 4BL0A 4PBYA 5FQDA 4D6VA 5FA5B 1OLZA 4R7AB 3GREA 4PSWB 3C5MA 5GMKn 4LG8A 4TZ4A 5C9ZB 2Z2PA 4H5IA 3SCYA 3I89A 4GGCA 3I7PA 1OMWB 5KDOB 3CFVA 5H14A 3CIKB 2HJBA 2IAAA 4A0BB 3OKYB 4XYIA 2P9UC 3UVKA 4CZYA 2G9AA 3I7LA 2H9LA 5FKRA 3EI2B 5CYKA 2OVPB 3OL2A 2B5MA 4ES0A 3W15A 2H9NA 2CN2A 3KRWB 5I5MA 4A09A 3HFQA 2HJ4A 3I7NA 3UVNA 3P4FA 4AOWA 2EBSA 3FM0A 2XYIA 3RSEC 4QQEA 4CC9A 2YMUA 1SHYB 3UVLA 2H6QA 2AGXA 2OVQB 2H47A 1PBYB 4OWRA 1JJUB 2G99A 4L3GD 4FB1D 3JZHA 5EM2A 1PI6A 5TDHB 4O1QD 4CI8A 5A2Qg 4Y5RD 2OK6A 3JAMg 2H6NA 4O45A 4E5ZA 5CXCA 2HKRA 4L3HD 1XIPA 3PSLA 5AFU3 1RI6A 2PM6B 5K1CC 3OL2B 5FXYA 1B9YA 2PM9A 4ZOZA 1MG3A 2I0RA 3J80g 5THAA 2CE9A 3PVUB 1ERJA 3IJ0A 5EAMA 3AL9A 4N14A 2AGWA 2IUVA 5EMKB 5FKQA 2I3SA 4O3UB 4FA5D 5JWZA 1R5MA 3NVXA 4AEZA 2UZXB 3DXMC 4LG9A 3PE7A 4J0WA 5C2WB 4ESGA 3MMYA 1PGUA 4ERQA 3EI2A 2I0TA 4H5JA 4FA1D 3EI1A 3JB9L 5EM2B 4J73A 2OJYA 3NVNA 4J87A 3UVOA 5TF2A 4A08A 1PEVA 2CO0A 3ZWLB 3UR4A 4J82A 4J86A 4A2MA 3AL8A 4A11A 3BG0A 2GC4A 1XHMA 3I8CA 4JSNC 2MTAH 5HQGA 2W18A 3PVWB 4GMBA 4J8GA 1Q47A 2TRCB 4E5ZB 3L4OD 5CXCB 4YVDA 2OVRB 3UKUC 1GP2B 1YFQA 2J56H 2H3XA 3PXSD 3FRXA 4L1QD 2PM9B 3RMZD 3RRMC 3JZGA 4X60B 4E54A 4PXWA 4FWWA 4CY5A 3ORVD 4GQ2P 2P9IC 3SBPA 5EMMB 5IJ7E 2HYEA 4GM9A 3IJ1A 3RN0D 2CNXA 4GZ8A 1MG2A 3SHFA 4A2LA 1GG2B 3SLED 1SQ9A 3N0EA 2J55H 2PBIB 3PSCB 1NEXB 4FHLA 4PSXB 4U7AA 4BH6A 2YNOA 3UVMA 3EI1B 3MXXA 4PNKB 5SXMA 2Z2NA 4K3ID 1P22A 2HESX 3SWSD 5HE1B 3MZLA 2GNQA 4J8BA 3V7DB 1K32A 2YB8B 3J81g 4A08B 2AGZA 1TYQC 2H9PA 2YNPA 4GGDA 3AL8B 2B4EA 2BBKH 2OIZA 2P9SC 4A11B 4GM3A 3OKWA 2OK4A 4JSXC 3RN1D 2CE8A 2GC7A 5I5JA 2AQ5A 3JROA 3SJLD 5FKTA 4MK0B 2H68A 3DXKC 3K26A 4CY1A 2Q7QA 4E54B 3ULEC 2I0SA 2J57G 4QRJA 4CI2A 5IGQA 4X3EA 3I8EA 5HE2B 4GGAA 4QL1A 3VH0A 4A0AB 3I7KA 4BUJC 2H9MA 1L0QA 3BG1A 3FGBA 4OZUA 5EARA 4X63B 3SMRA 2HXCA
chains in the Genus database with same CATH superfamily
5HYNB 4GQ1A 4O9DA 5M5TA 2XU7A 1I2MB 2H13A 3N0DA 5IGOA 5C2VB 2I3TA 3C99A 4K3JB 3SVWD 4O3TB 2UZYB 3F3GA 2H14A 2B5LA 3IUMA 3MKQA 4PBZA 3VI4A 4CI3A 4XYHA 5FKSA 4BCBA 4IMMA 5EAPA 4DNWA 1NR0A 2XE4A 3KCIA 4EWRA 5EMJB 3SN6B 4NENA 4DNUA 3JZNA 4JT6C 1A0RB 3K27A 4ZOXA 3V9FA 1FWXA 1N6EA 4ZOYA 4J79A 2AGYA 4BCDA 4A7JA 4FA9D 5IT9g 4CY2A 1S4UX 3E0CA 4KFMB 1GXRA 5EALA 4IA9A 4ZN4A 3L4MD 3I7OA 1VZ3A 4QT8A 4JXMA 1GOHA 3T3PA 1GOFA 4Y7RA 3BWSA 3DM0A 2IWKA 4WK0A 1U4CA 3K71A 5M5UA 3F3FA 2H6KA 5AMSA 4FA4D 1U2VC 4ZOVA 4J81A 3IURA 3EMHA 4GM8A 4NSXA 3O4GA 1JMXB 3I7HA 4A0AA 2YBAA 4O2WA 3EI3A 3I2NA 1GOGA 2HKMA 3V5WB 3O4JA 3NVQA 4J84A 2VDOA 2WQ8A 4QAMA 5GXHA 1UTCA 4I79A 4JT5C 3F3PA 3EU7A 3VA6A 3JPXA 3KRXB 2B5NA 3GC3B 3MVDK 3ZE0A 2XZGA 3NIGA 2QC5A 1H2YA 4J78A 4L1MA 4U1EI 4JSVC 2AH1A 1UOQA 4ERZA 4J0XA 1N6FA 1SQJA 3PXWD 4UM8A 2BCJB 1TBGA 3OTTA 3PXTD 4AX4A 3IULA 3IUQA 5AJAA 2AGLA 3MKSB 3ZDZA 2P9PC 4J77A 2O9KA 2VZ3A 2IURA 2YNNA 2VDNA 3RFGA 2JKXA 4D0KA 4XEIC 5E6SA 1B9XA 5FFGA 1MDAH 5TEFA 3A0FA 3DWLC 3K72A 5GXIA 4LGNA 3IKOA 3OF7A 3IIYA 3VGZA 4L9OA 2P9KC 3RFHA 4Z8LA 3EI3B 5FLXg 1E5TA 2XDWA 4X61B 4BP9A 3EWEA 3OKTA 4HDJA 5CXBA 4ERYA 4G56B 4G1MA 2IWFA 5M5VA 3DDUA 3ZE2A 4NAAA 1N6DA 5TEEA 2IUQA 5HE0B 3SBQA 1H2XA 3EI4A 5EMLB 3OW8A 4JSPC 3T3MA 3VI3A 1K8KC 5GSAA 2VDKA 2HU8A 4Z7QA 3C9CA 3V4PA 3SBRA 3IIWA 4PC0A 5B4WA 3ODTA 2EIDA 3ZDYA 3RLMD 5HE3B 2EIEA 3DSMA 3MZKA 5CYKB 5IC7A 5K19A 2Z2OA 5H17A 1GOTB 2HU7A 4JHNA 4WK2A 4CY3A 4A09B 4G55A 3SXTD 1QFSA 4CZXA 4UI9R 1UOPA 2P9LC 4JD2C 4AMYA 3OKYA 3CFSB 4FAND 4A0BA 2XL2A 3EQ8A 3SFZA 3IJCA 4CI1A 1QNIA 2CN3A 2XL3A 5H1MA 4O02A 4GQBB 3IUNA 4BP8A 2AH0A 3B7FA 1XKSA 3C75H 1A12A 2P9NC 1C9IA 5I5IA 1JTDB 5IJ8E 1JOFA 2QXVA 5CXBB 4Z7OA 3U4YA 3GFCA 1VYHC 4FAVD 4CZVA 2IUPA 1VZ2A 3EG6A 3AFCA 4Z7NA 3AH8B 3UKRC 3EI4B 3JRPA 1JMZB 2CO0C 2VC2A 2PM7B 4BL0A 4PBYA 5FQDA 4D6VA 5FA5B 1OLZA 5M61A 3QI0A 4R7AB 3GREA 4MMYA 4PSWB 5C86A 3C5MA 3V4VA 5GMKn 4LG8A 4TZ4A 5C9ZB 2Z2PA 4H5IA 2EICA 3SCYA 3I89A 1JV2A 1O6GA 1L5GA 4GGCA 3I7PA 1OMWB 5KDOB 3CFVA 5H14A 1BPOA 3CIKB 3MUNA 2HJBA 2IAAA 2BKLA 4A0BB 3OKYB 4XYIA 3O4IA 2P9UC 4MMXA 3UVKA 4CZYA 2G9AA 1UOOA 3I7LA 2H9LA 1H2ZA 3EQ7A 5FKRA 3EI2B 4MMZA 5CYKA 4WK4A 2OVPB 3OL2A 3ZE1A 2B5MA 4ES0A 3W15A 4WJKA 2H9NA 2CN2A 2VZ1A 3KRWB 5I5MA 4A09A 3HFQA 2HJ4A 3I7NA 4G1EA 3P4FA 3UVNA 4AOWA 2EBSA 3FM0A 2XYIA 3RSEC 4QQEA 4CC9A 2QZPA 2YMUA 1SHYB 1E8NA 4RE5A 2H6QA 2AGXA 3UVLA 2OVQB 2H47A 1PBYB 3EQ9A 4OWRA 2EIBA 1JJUB 2G99A 4L3GD 4FB1D 3JZHA 5EM2A 1M1XA 2VDQA 4IRZA 1PI6A 5TDHB 4O1QD 4CI8A 1E8MA 4JHPC 3GD1I 3O4HA 5A2Qg 1C9LA 3FCSA 4Y5RD 2OK6A 3JAMg 2H6NA 4O45A 4E5ZA 5CXCA 2HKRA 4L3HD 2VDMA 1XIPA 3PSLA 1T2XA 5AFU3 1RI6A 2PM6B 5K1CC 3OL2B 5FXYA 1B9YA 4AN0A 3K6SA 2PM9A 4ZOZA 1MG3A 2I0RA 3J80g 5THAA 2CE9A 3PVUB 1ERJA 1U8CA 3IJ0A 5EAMA 3AL9A 4N14A 4BCCA 2AGWA 2IUVA 5EMKB 5FKQA 3FCUA 2I3SA 4O3UB 4FA5D 3IUJA 5JWZA 1R5MA 3NVXA 4AN1A 4AEZA 1VE6A 2UZXB 3DXMC 4LG9A 3PE7A 4J0WA 5C2WB 4ESGA 3MMYA 1PGUA 4ERQA 3EI2A 2I0TA 4H5JA 3NIDA 4FA1D 3EI1A 3JB9L 5EM2B 4AMZA 4J73A 2OJYA 3NVNA 4J87A 3UVOA 5TF2A 4A08A 1PEVA 2CO0A 3ZWLB 3UR4A 4J82A 4J86A 4A2MA 3AL8A 4A11A 3BG0A 2GC4A 3ZDXA 1XHMA 3I8CA 4JSNC 2MTAH 5HQGA 1VE7A 2W18A 3PVWB 4GMBA 4J8GA 1Q47A 2TRCB 4E5ZB 3L4OD 5E6UA 5CXCB 4YVDA 5M5RA 2OVRB 3UKUC 3IVMA 1GP2B 1YFQA 2J56H 2H3XA 3PXSD 3FRXA 4L1QD 2PM9B 4D9SA 3RMZD 3RRMC 3JZGA 4X60B 4E54A 4PXWA 4FWWA 4CY5A 3ORVD 4GQ2P 2P9IC 4UM9A 2HU5A 4NBMA 3SBPA 5EMMB 5IJ7E 3NIFA 2HYEA 4GM9A 3IJ1A 3RN0D 1YR2A 2CNXA 4GZ8A 1MG2A 5FFOA 4NC4A 3SHFA 1H2WA 4A2LA 1GG2B 3IJEA 3SLED 1SQ9A 3N0EA 2J55H 2PBIB 3PSCB 1NEXB 4FHLA 4PSXB 4U7AA 4BH6A 2YNOA 3UVMA 3EI1B 3MXXA 4PNKB 5SXMA 2Z2NA 4K3ID 1P22A 2HESX 3SWSD 5HE1B 3MZLA 2GNQA 4J8BA 1O6FA 3V7DB 1K32A 2YB8B 3J81g 4A08B 2AGZA 1TYQC 2H9PA 2YNPA 4GGDA 5M5SA 3AL8B 2B4EA 2BBKH 2OIZA 2P9SC 4A11B 4GM3A 3OKWA 2OK4A 4JSXC 3RN1D 2CE8A 2GC7A 1QFMA 5I5JA 2AQ5A 3JROA 3SJLD 1TYEA 5FKTA 4MK0B 2H68A 3DXKC 3K26A 4CY1A 2Q7QA 4E54B 3ULEC 2QR5A 2I0SA 2VDPA 2J57G 4QRJA 5C92A 4CI2A 5IGQA 4X3EA 4RE6A 3I8EA 5HE2B 4GGAA 4QL1A 3VH0A 4A0AB 3QHYB 1K3IA 3I7KA 4BUJC 2VDLA 5HDBA 2VDRA 4DNVA 2H9MA 1L0QA 3BG1A 3FGBA 4OZUA 5EARA 4X63B 3SMRA 2HXCA 5E6RA 3MUOA
chains in the Genus database with same CATH topology
5HYNB 4GQ1A 4O9DA 2XU7A 2H13A 3N0DA 5IGOA 5C2VB 2I3TA 3C99A 4K3JB 3SVWD 4O3TB 2UZYB 3F3GA 2H14A 2B5LA 3MKQA 4PBZA 4CI3A 4XYHA 5FKSA 4IMMA 5EAPA 1NR0A 4EWRA 5EMJB 3SN6B 3JZNA 4JT6C 1A0RB 3K27A 4ZOXA 3V9FA 1FWXA 1N6EA 4ZOYA 4J79A 2AGYA 4A7JA 4FA9D 5IT9g 4CY2A 1S4UX 3E0CA 4KFMB 1GXRA 5EALA 4IA9A 4ZN4A 3L4MD 3I7OA 4QT8A 4JXMA 4Y7RA 3BWSA 3DM0A 2IWKA 1U4CA 3F3FA 2H6KA 5AMSA 4FA4D 1U2VC 4ZOVA 4J81A 3EMHA 4GM8A 4NSXA 1JMXB 3I7HA 4A0AA 2YBAA 3EI3A 3I2NA 2HKMA 3V5WB 3NVQA 4J84A 5GXHA 4I79A 4JT5C 3F3PA 3EU7A 3VA6A 3JPXA 3KRXB 2B5NA 2QC5A 4J78A 4U1EI 4JSVC 2AH1A 4ERZA 4J0XA 1N6FA 1SQJA 3PXWD 2BCJB 1TBGA 3OTTA 3PXTD 5AJAA 2AGLA 3MKSB 2P9PC 4J77A 2O9KA 2IURA 2YNNA 3RFGA 4D0KA 4XEIC 1B9XA 1MDAH 5TEFA 3A0FA 3DWLC 5GXIA 4LGNA 3IKOA 3IIYA 3VGZA 4L9OA 2P9KC 3RFHA 4Z8LA 3EI3B 5FLXg 4X61B 3EWEA 3OKTA 4HDJA 5CXBA 4ERYA 4G56B 2IWFA 1N6DA 5TEEA 2IUQA 5HE0B 3SBQA 5EMLB 3EI4A 3OW8A 4JSPC 1K8KC 5GSAA 3C9CA 3SBRA 3IIWA 4PC0A 5B4WA 3ODTA 3RLMD 5HE3B 3DSMA 3MZKA 5CYKB 5IC7A 5K19A 2Z2OA 5H17A 1GOTB 4CY3A 4A09B 3SXTD 4CZXA 4UI9R 2P9LC 4JD2C 4FAND 3OKYA 3CFSB 4A0BA 2XL2A 3SFZA 3IJCA 4CI1A 1QNIA 2CN3A 2XL3A 5H1MA 4GQBB 2AH0A 3B7FA 1XKSA 3C75H 2P9NC 5I5IA 5IJ8E 1JOFA 2QXVA 5CXBB 3U4YA 3GFCA 1VYHC 4FAVD 4CZVA 2IUPA 3EG6A 3AFCA 3AH8B 3UKRC 3EI4B 3JRPA 1JMZB 2CO0C 2PM7B 4BL0A 4PBYA 5FQDA 4D6VA 5FA5B 1OLZA 4R7AB 3GREA 4PSWB 3C5MA 5GMKn 4LG8A 4TZ4A 5C9ZB 2Z2PA 4H5IA 3SCYA 3I89A 4GGCA 3I7PA 1OMWB 5KDOB 3CFVA 5H14A 3CIKB 2HJBA 2IAAA 4A0BB 3OKYB 4XYIA 2P9UC 3UVKA 4CZYA 2G9AA 3I7LA 2H9LA 5FKRA 3EI2B 5CYKA 2OVPB 3OL2A 2B5MA 4ES0A 3W15A 2H9NA 2CN2A 3KRWB 5I5MA 4A09A 3HFQA 2HJ4A 3I7NA 3UVNA 3P4FA 4AOWA 2EBSA 3FM0A 2XYIA 3RSEC 4QQEA 4CC9A 2YMUA 1SHYB 3UVLA 2H6QA 2AGXA 2OVQB 2H47A 1PBYB 4OWRA 1JJUB 2G99A 4L3GD 4FB1D 3JZHA 5EM2A 1PI6A 5TDHB 4O1QD 4CI8A 5A2Qg 4Y5RD 2OK6A 3JAMg 2H6NA 4O45A 4E5ZA 5CXCA 2HKRA 4L3HD 1XIPA 3PSLA 5AFU3 1RI6A 2PM6B 5K1CC 3OL2B 5FXYA 1B9YA 2PM9A 4ZOZA 1MG3A 2I0RA 3J80g 5THAA 2CE9A 3PVUB 1ERJA 3IJ0A 5EAMA 3AL9A 4N14A 2AGWA 2IUVA 5EMKB 5FKQA 2I3SA 4O3UB 4FA5D 5JWZA 1R5MA 3NVXA 4AEZA 2UZXB 3DXMC 4LG9A 3PE7A 4J0WA 5C2WB 4ESGA 3MMYA 1PGUA 4ERQA 3EI2A 2I0TA 4H5JA 4FA1D 3EI1A 3JB9L 5EM2B 4J73A 2OJYA 3NVNA 4J87A 3UVOA 5TF2A 4A08A 1PEVA 2CO0A 3ZWLB 3UR4A 4J82A 4J86A 4A2MA 3AL8A 4A11A 3BG0A 2GC4A 1XHMA 3I8CA 4JSNC 2MTAH 5HQGA 2W18A 3PVWB 4GMBA 4J8GA 1Q47A 2TRCB 4E5ZB 3L4OD 5CXCB 4YVDA 2OVRB 3UKUC 1GP2B 1YFQA 2J56H 2H3XA 3PXSD 3FRXA 4L1QD 2PM9B 3RMZD 3RRMC 3JZGA 4X60B 4E54A 4PXWA 4FWWA 4CY5A 3ORVD 4GQ2P 2P9IC 3SBPA 5EMMB 5IJ7E 2HYEA 4GM9A 3IJ1A 3RN0D 2CNXA 4GZ8A 1MG2A 3SHFA 4A2LA 1GG2B 3SLED 1SQ9A 3N0EA 2J55H 2PBIB 3PSCB 1NEXB 4FHLA 4PSXB 4U7AA 4BH6A 2YNOA 3UVMA 3EI1B 3MXXA 4PNKB 5SXMA 2Z2NA 4K3ID 1P22A 2HESX 3SWSD 5HE1B 3MZLA 2GNQA 4J8BA 3V7DB 1K32A 2YB8B 3J81g 4A08B 2AGZA 1TYQC 2H9PA 2YNPA 4GGDA 3AL8B 2B4EA 2BBKH 2OIZA 2P9SC 4A11B 4GM3A 3OKWA 2OK4A 4JSXC 3RN1D 2CE8A 2GC7A 5I5JA 2AQ5A 3JROA 3SJLD 5FKTA 4MK0B 2H68A 3DXKC 3K26A 4CY1A 2Q7QA 4E54B 3ULEC 2I0SA 2J57G 4QRJA 4CI2A 5IGQA 4X3EA 3I8EA 5HE2B 4GGAA 4QL1A 3VH0A 4A0AB 3I7KA 4BUJC 2H9MA 1L0QA 3BG1A 3FGBA 4OZUA 5EARA 4X63B 3SMRA 2HXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYN B;  4GQ1 A;  4O9D A;  2XU7 A;  2H13 A;  3N0D A;  5IGO A;  5C2V B;  2I3T A;  3C99 A;  4K3J B;  3SVW D;  4O3T B;  2UZY B;  3F3G A;  2H14 A;  2B5L A;  3MKQ A;  4PBZ A;  4CI3 A;  4XYH A;  5FKS A;  4IMM A;  5EAP A;  1NR0 A;  4EWR A;  5EMJ B;  3SN6 B;  3JZN A;  4JT6 C;  1A0R B;  3K27 A;  4ZOX A;  3V9F A;  1FWX A;  1N6E A;  4ZOY A;  4J79 A;  2AGY A;  4A7J A;  4FA9 D;  5IT9 g;  4CY2 A;  1S4U X;  3E0C A;  4KFM B;  1GXR A;  5EAL A;  4IA9 A;  4ZN4 A;  3L4M D;  3I7O A;  4QT8 A;  4JXM A;  4Y7R A;  3BWS A;  3DM0 A;  2IWK A;  1U4C A;  3F3F A;  2H6K A;  5AMS A;  4FA4 D;  1U2V C;  4ZOV A;  4J81 A;  3EMH A;  4GM8 A;  4NSX A;  1JMX B;  3I7H A;  4A0A A;  2YBA A;  3EI3 A;  3I2N A;  2HKM A;  3V5W B;  3NVQ A;  4J84 A;  5GXH A;  4I79 A;  4JT5 C;  3F3P A;  3EU7 A;  3VA6 A;  3JPX A;  3KRX B;  2B5N A;  2QC5 A;  4J78 A;  4U1E I;  4JSV C;  2AH1 A;  4ERZ A;  4J0X A;  1N6F A;  1SQJ A;  3PXW D;  2BCJ B;  1TBG A;  3OTT A;  3PXT D;  5AJA A;  2AGL A;  3MKS B;  2P9P C;  4J77 A;  2O9K A;  2IUR A;  2YNN A;  3RFG A;  4D0K A;  4XEI C;  1B9X A;  1MDA H;  5TEF A;  3A0F A;  3DWL C;  5GXI A;  4LGN A;  3IKO A;  3IIY A;  3VGZ A;  4L9O A;  2P9K C;  3RFH A;  4Z8L A;  3EI3 B;  5FLX g;  4X61 B;  3EWE A;  3OKT A;  4HDJ A;  5CXB A;  4ERY A;  4G56 B;  2IWF A;  1N6D A;  5TEE A;  2IUQ A;  5HE0 B;  3SBQ A;  5EML B;  3EI4 A;  3OW8 A;  4JSP C;  1K8K C;  5GSA A;  3C9C A;  3SBR A;  3IIW A;  4PC0 A;  5B4W A;  3ODT A;  3RLM D;  5HE3 B;  3DSM A;  3MZK A;  5CYK B;  5IC7 A;  5K19 A;  2Z2O A;  5H17 A;  1GOT B;  4CY3 A;  4A09 B;  3SXT D;  4CZX A;  4UI9 R;  2P9L C;  4JD2 C;  4FAN D;  3OKY A;  3CFS B;  4A0B A;  2XL2 A;  3SFZ A;  3IJC A;  4CI1 A;  1QNI A;  2CN3 A;  2XL3 A;  5H1M A;  4GQB B;  2AH0 A;  3B7F A;  1XKS A;  3C75 H;  2P9N C;  5I5I A;  5IJ8 E;  1JOF A;  2QXV A;  5CXB B;  3U4Y A;  3GFC A;  1VYH C;  4FAV D;  4CZV A;  2IUP A;  3EG6 A;  3AFC A;  3AH8 B;  3UKR C;  3EI4 B;  3JRP A;  1JMZ B;  2CO0 C;  2PM7 B;  4BL0 A;  4PBY A;  5FQD A;  4D6V A;  5FA5 B;  1OLZ A;  4R7A B;  3GRE A;  4PSW B;  3C5M A;  5GMK n;  4LG8 A;  4TZ4 A;  5C9Z B;  2Z2P A;  4H5I A;  3SCY A;  3I89 A;  4GGC A;  3I7P A;  1OMW B;  5KDO B;  3CFV A;  5H14 A;  3CIK B;  2HJB A;  2IAA A;  4A0B B;  3OKY B;  4XYI A;  2P9U C;  3UVK A;  4CZY A;  2G9A A;  3I7L A;  2H9L A;  5FKR A;  3EI2 B;  5CYK A;  2OVP B;  3OL2 A;  2B5M A;  4ES0 A;  3W15 A;  2H9N A;  2CN2 A;  3KRW B;  5I5M A;  4A09 A;  3HFQ A;  2HJ4 A;  3I7N A;  3UVN A;  3P4F A;  4AOW A;  2EBS A;  3FM0 A;  2XYI A;  3RSE C;  4QQE A;  4CC9 A;  2YMU A;  1SHY B;  3UVL A;  2H6Q A;  2AGX A;  2OVQ B;  2H47 A;  1PBY B;  4OWR A;  1JJU B;  2G99 A;  4L3G D;  4FB1 D;  3JZH A;  5EM2 A;  1PI6 A;  5TDH B;  4O1Q D;  4CI8 A;  5A2Q g;  4Y5R D;  2OK6 A;  3JAM g;  2H6N A;  4O45 A;  4E5Z A;  5CXC A;  2HKR A;  4L3H D;  1XIP A;  3PSL A;  5AFU 3;  1RI6 A;  2PM6 B;  5K1C C;  3OL2 B;  5FXY A;  1B9Y A;  2PM9 A;  4ZOZ A;  1MG3 A;  2I0R A;  3J80 g;  5THA A;  2CE9 A;  3PVU B;  1ERJ A;  3IJ0 A;  5EAM A;  3AL9 A;  4N14 A;  2AGW A;  2IUV A;  5EMK B;  5FKQ A;  2I3S A;  4O3U B;  4FA5 D;  5JWZ A;  1R5M A;  3NVX A;  4AEZ A;  2UZX B;  3DXM C;  4LG9 A;  3PE7 A;  4J0W A;  5C2W B;  4ESG A;  3MMY A;  1PGU A;  4ERQ A;  3EI2 A;  2I0T A;  4H5J A;  4FA1 D;  3EI1 A;  3JB9 L;  5EM2 B;  4J73 A;  2OJY A;  3NVN A;  4J87 A;  3UVO A;  5TF2 A;  4A08 A;  1PEV A;  2CO0 A;  3ZWL B;  3UR4 A;  4J82 A;  4J86 A;  4A2M A;  3AL8 A;  4A11 A;  3BG0 A;  2GC4 A;  1XHM A;  3I8C A;  4JSN C;  2MTA H;  5HQG A;  2W18 A;  3PVW B;  4GMB A;  4J8G A;  1Q47 A;  2TRC B;  4E5Z B;  3L4O D;  5CXC B;  4YVD A;  2OVR B;  3UKU C;  1GP2 B;  1YFQ A;  2J56 H;  2H3X A;  3PXS D;  3FRX A;  4L1Q D;  2PM9 B;  3RMZ D;  3RRM C;  3JZG A;  4X60 B;  4E54 A;  4PXW A;  4FWW A;  4CY5 A;  3ORV D;  4GQ2 P;  2P9I C;  3SBP A;  5EMM B;  5IJ7 E;  2HYE A;  4GM9 A;  3IJ1 A;  3RN0 D;  2CNX A;  4GZ8 A;  1MG2 A;  3SHF A;  4A2L A;  1GG2 B;  3SLE D;  1SQ9 A;  3N0E A;  2J55 H;  2PBI B;  3PSC B;  1NEX B;  4FHL A;  4PSX B;  4U7A A;  4BH6 A;  2YNO A;  3UVM A;  3EI1 B;  3MXX A;  4PNK B;  5SXM A;  2Z2N A;  4K3I D;  1P22 A;  2HES X;  3SWS D;  5HE1 B;  3MZL A;  2GNQ A;  4J8B A;  3V7D B;  1K32 A;  2YB8 B;  3J81 g;  4A08 B;  2AGZ A;  1TYQ C;  2H9P A;  2YNP A;  4GGD A;  3AL8 B;  2B4E A;  2BBK H;  2OIZ A;  2P9S C;  4A11 B;  4GM3 A;  3OKW A;  2OK4 A;  4JSX C;  3RN1 D;  2CE8 A;  2GC7 A;  5I5J A;  2AQ5 A;  3JRO A;  3SJL D;  5FKT A;  4MK0 B;  2H68 A;  3DXK C;  3K26 A;  4CY1 A;  2Q7Q A;  4E54 B;  3ULE C;  2I0S A;  2J57 G;  4QRJ A;  4CI2 A;  5IGQ A;  4X3E A;  3I8E A;  5HE2 B;  4GGA A;  4QL1 A;  3VH0 A;  4A0A B;  3I7K A;  4BUJ C;  2H9M A;  1L0Q A;  3BG1 A;  3FGB A;  4OZU A;  5EAR A;  4X63 B;  3SMR A;  2HXC A; 
#chains in the Genus database with same CATH topology
 5HYN B;  4GQ1 A;  4O9D A;  5M5T A;  2XU7 A;  1I2M B;  2H13 A;  3N0D A;  5IGO A;  5C2V B;  2I3T A;  3C99 A;  4K3J B;  3SVW D;  4O3T B;  2UZY B;  3F3G A;  2H14 A;  2B5L A;  3IUM A;  3MKQ A;  4PBZ A;  3VI4 A;  4CI3 A;  4XYH A;  5FKS A;  4BCB A;  4IMM A;  5EAP A;  4DNW A;  1NR0 A;  2XE4 A;  3KCI A;  4EWR A;  5EMJ B;  3SN6 B;  4NEN A;  4DNU A;  3JZN A;  4JT6 C;  1A0R B;  3K27 A;  4ZOX A;  3V9F A;  1FWX A;  1N6E A;  4ZOY A;  4J79 A;  2AGY A;  4BCD A;  4A7J A;  4FA9 D;  5IT9 g;  4CY2 A;  1S4U X;  3E0C A;  4KFM B;  1GXR A;  5EAL A;  4IA9 A;  4ZN4 A;  3L4M D;  3I7O A;  1VZ3 A;  4QT8 A;  4JXM A;  1GOH A;  3T3P A;  1GOF A;  4Y7R A;  3BWS A;  3DM0 A;  2IWK A;  4WK0 A;  1U4C A;  3K71 A;  5M5U A;  3F3F A;  2H6K A;  5AMS A;  4FA4 D;  1U2V C;  4ZOV A;  4J81 A;  3IUR A;  3EMH A;  4GM8 A;  4NSX A;  3O4G A;  1JMX B;  3I7H A;  4A0A A;  2YBA A;  4O2W A;  3EI3 A;  3I2N A;  1GOG A;  2HKM A;  3V5W B;  3O4J A;  3NVQ A;  4J84 A;  2VDO A;  2WQ8 A;  4QAM A;  5GXH A;  1UTC A;  4I79 A;  4JT5 C;  3F3P A;  3EU7 A;  3VA6 A;  3JPX A;  3KRX B;  2B5N A;  3GC3 B;  3MVD K;  3ZE0 A;  2XZG A;  3NIG A;  2QC5 A;  1H2Y A;  4J78 A;  4L1M A;  4U1E I;  4JSV C;  2AH1 A;  1UOQ A;  4ERZ A;  4J0X A;  1N6F A;  1SQJ A;  3PXW D;  4UM8 A;  2BCJ B;  1TBG A;  3OTT A;  3PXT D;  4AX4 A;  3IUL A;  3IUQ A;  5AJA A;  2AGL A;  3MKS B;  3ZDZ A;  2P9P C;  4J77 A;  2O9K A;  2VZ3 A;  2IUR A;  2YNN A;  2VDN A;  3RFG A;  2JKX A;  4D0K A;  4XEI C;  5E6S A;  1B9X A;  5FFG A;  1MDA H;  5TEF A;  3A0F A;  3DWL C;  3K72 A;  5GXI A;  4LGN A;  3IKO A;  3OF7 A;  3IIY A;  3VGZ A;  4L9O A;  2P9K C;  3RFH A;  4Z8L A;  3EI3 B;  5FLX g;  1E5T A;  2XDW A;  4X61 B;  4BP9 A;  3EWE A;  3OKT A;  4HDJ A;  5CXB A;  4ERY A;  4G56 B;  4G1M A;  2IWF A;  5M5V A;  3DDU A;  3ZE2 A;  4NAA A;  1N6D A;  5TEE A;  2IUQ A;  5HE0 B;  3SBQ A;  1H2X A;  3EI4 A;  5EML B;  3OW8 A;  4JSP C;  3T3M A;  3VI3 A;  1K8K C;  5GSA A;  2VDK A;  2HU8 A;  4Z7Q A;  3C9C A;  3V4P A;  3SBR A;  3IIW A;  4PC0 A;  5B4W A;  3ODT A;  2EID A;  3ZDY A;  3RLM D;  5HE3 B;  2EIE A;  3DSM A;  3MZK A;  5CYK B;  5IC7 A;  5K19 A;  2Z2O A;  5H17 A;  1GOT B;  2HU7 A;  4JHN A;  4WK2 A;  4CY3 A;  4A09 B;  4G55 A;  3SXT D;  1QFS A;  4CZX A;  4UI9 R;  1UOP A;  2P9L C;  4JD2 C;  4AMY A;  3OKY A;  3CFS B;  4FAN D;  4A0B A;  2XL2 A;  3EQ8 A;  3SFZ A;  3IJC A;  4CI1 A;  1QNI A;  2CN3 A;  2XL3 A;  5H1M A;  4O02 A;  4GQB B;  3IUN A;  4BP8 A;  2AH0 A;  3B7F A;  1XKS A;  3C75 H;  1A12 A;  2P9N C;  1C9I A;  5I5I A;  1JTD B;  5IJ8 E;  1JOF A;  2QXV A;  5CXB B;  4Z7O A;  3U4Y A;  3GFC A;  1VYH C;  4FAV D;  4CZV A;  2IUP A;  1VZ2 A;  3EG6 A;  3AFC A;  4Z7N A;  3AH8 B;  3UKR C;  3EI4 B;  3JRP A;  1JMZ B;  2CO0 C;  2VC2 A;  2PM7 B;  4BL0 A;  4PBY A;  5FQD A;  4D6V A;  5FA5 B;  1OLZ A;  5M61 A;  3QI0 A;  4R7A B;  3GRE A;  4MMY A;  4PSW B;  5C86 A;  3C5M A;  3V4V A;  5GMK n;  4LG8 A;  4TZ4 A;  5C9Z B;  2Z2P A;  4H5I A;  2EIC A;  3SCY A;  3I89 A;  1JV2 A;  1O6G A;  1L5G A;  4GGC A;  3I7P A;  1OMW B;  5KDO B;  3CFV A;  5H14 A;  1BPO A;  3CIK B;  3MUN A;  2HJB A;  2IAA A;  2BKL A;  4A0B B;  3OKY B;  4XYI A;  3O4I A;  2P9U C;  4MMX A;  3UVK A;  4CZY A;  2G9A A;  1UOO A;  3I7L A;  2H9L A;  1H2Z A;  3EQ7 A;  5FKR A;  3EI2 B;  4MMZ A;  5CYK A;  4WK4 A;  2OVP B;  3OL2 A;  3ZE1 A;  2B5M A;  4ES0 A;  3W15 A;  4WJK A;  2H9N A;  2CN2 A;  2VZ1 A;  3KRW B;  5I5M A;  4A09 A;  3HFQ A;  2HJ4 A;  3I7N A;  4G1E A;  3P4F A;  3UVN A;  4AOW A;  2EBS A;  3FM0 A;  2XYI A;  3RSE C;  4QQE A;  4CC9 A;  2QZP A;  2YMU A;  1SHY B;  1E8N A;  4RE5 A;  2H6Q A;  2AGX A;  3UVL A;  2OVQ B;  2H47 A;  1PBY B;  3EQ9 A;  4OWR A;  2EIB A;  1JJU B;  2G99 A;  4L3G D;  4FB1 D;  3JZH A;  5EM2 A;  1M1X A;  2VDQ A;  4IRZ A;  1PI6 A;  5TDH B;  4O1Q D;  4CI8 A;  1E8M A;  4JHP C;  3GD1 I;  3O4H A;  5A2Q g;  1C9L A;  3FCS A;  4Y5R D;  2OK6 A;  3JAM g;  2H6N A;  4O45 A;  4E5Z A;  5CXC A;  2HKR A;  4L3H D;  2VDM A;  1XIP A;  3PSL A;  1T2X A;  5AFU 3;  1RI6 A;  2PM6 B;  5K1C C;  3OL2 B;  5FXY A;  1B9Y A;  4AN0 A;  3K6S A;  2PM9 A;  4ZOZ A;  1MG3 A;  2I0R A;  3J80 g;  5THA A;  2CE9 A;  3PVU B;  1ERJ A;  1U8C A;  3IJ0 A;  5EAM A;  3AL9 A;  4N14 A;  4BCC A;  2AGW A;  2IUV A;  5EMK B;  5FKQ A;  3FCU A;  2I3S A;  4O3U B;  4FA5 D;  3IUJ A;  5JWZ A;  1R5M A;  3NVX A;  4AN1 A;  4AEZ A;  1VE6 A;  2UZX B;  3DXM C;  4LG9 A;  3PE7 A;  4J0W A;  5C2W B;  4ESG A;  3MMY A;  1PGU A;  4ERQ A;  3EI2 A;  2I0T A;  4H5J A;  3NID A;  4FA1 D;  3EI1 A;  3JB9 L;  5EM2 B;  4AMZ A;  4J73 A;  2OJY A;  3NVN A;  4J87 A;  3UVO A;  5TF2 A;  4A08 A;  1PEV A;  2CO0 A;  3ZWL B;  3UR4 A;  4J82 A;  4J86 A;  4A2M A;  3AL8 A;  4A11 A;  3BG0 A;  2GC4 A;  3ZDX A;  1XHM A;  3I8C A;  4JSN C;  2MTA H;  5HQG A;  1VE7 A;  2W18 A;  3PVW B;  4GMB A;  4J8G A;  1Q47 A;  2TRC B;  4E5Z B;  3L4O D;  5E6U A;  5CXC B;  4YVD A;  5M5R A;  2OVR B;  3UKU C;  3IVM A;  1GP2 B;  1YFQ A;  2J56 H;  2H3X A;  3PXS D;  3FRX A;  4L1Q D;  2PM9 B;  4D9S A;  3RMZ D;  3RRM C;  3JZG A;  4X60 B;  4E54 A;  4PXW A;  4FWW A;  4CY5 A;  3ORV D;  4GQ2 P;  2P9I C;  4UM9 A;  2HU5 A;  4NBM A;  3SBP A;  5EMM B;  5IJ7 E;  3NIF A;  2HYE A;  4GM9 A;  3IJ1 A;  3RN0 D;  1YR2 A;  2CNX A;  4GZ8 A;  1MG2 A;  5FFO A;  4NC4 A;  3SHF A;  1H2W A;  4A2L A;  1GG2 B;  3IJE A;  3SLE D;  1SQ9 A;  3N0E A;  2J55 H;  2PBI B;  3PSC B;  1NEX B;  4FHL A;  4PSX B;  4U7A A;  4BH6 A;  2YNO A;  3UVM A;  3EI1 B;  3MXX A;  4PNK B;  5SXM A;  2Z2N A;  4K3I D;  1P22 A;  2HES X;  3SWS D;  5HE1 B;  3MZL A;  2GNQ A;  4J8B A;  1O6F A;  3V7D B;  1K32 A;  2YB8 B;  3J81 g;  4A08 B;  2AGZ A;  1TYQ C;  2H9P A;  2YNP A;  4GGD A;  5M5S A;  3AL8 B;  2B4E A;  2BBK H;  2OIZ A;  2P9S C;  4A11 B;  4GM3 A;  3OKW A;  2OK4 A;  4JSX C;  3RN1 D;  2CE8 A;  2GC7 A;  1QFM A;  5I5J A;  2AQ5 A;  3JRO A;  3SJL D;  1TYE A;  5FKT A;  4MK0 B;  2H68 A;  3DXK C;  3K26 A;  4CY1 A;  2Q7Q A;  4E54 B;  3ULE C;  2QR5 A;  2I0S A;  2VDP A;  2J57 G;  4QRJ A;  5C92 A;  4CI2 A;  5IGQ A;  4X3E A;  4RE6 A;  3I8E A;  5HE2 B;  4GGA A;  4QL1 A;  3VH0 A;  4A0A B;  3QHY B;  1K3I A;  3I7K A;  4BUJ C;  2VDL A;  5HDB A;  2VDR A;  4DNV A;  2H9M A;  1L0Q A;  3BG1 A;  3FGB A;  4OZU A;  5EAR A;  4X63 B;  3SMR A;  2HXC A;  5E6R A;  3MUO A; 
#chains in the Genus database with same CATH homology
 5HYN B;  4GQ1 A;  4O9D A;  2XU7 A;  2H13 A;  3N0D A;  5IGO A;  5C2V B;  2I3T A;  3C99 A;  4K3J B;  3SVW D;  4O3T B;  2UZY B;  3F3G A;  2H14 A;  2B5L A;  3MKQ A;  4PBZ A;  4CI3 A;  4XYH A;  5FKS A;  4IMM A;  5EAP A;  1NR0 A;  4EWR A;  5EMJ B;  3SN6 B;  3JZN A;  4JT6 C;  1A0R B;  3K27 A;  4ZOX A;  3V9F A;  1FWX A;  1N6E A;  4ZOY A;  4J79 A;  2AGY A;  4A7J A;  4FA9 D;  5IT9 g;  4CY2 A;  1S4U X;  3E0C A;  4KFM B;  1GXR A;  5EAL A;  4IA9 A;  4ZN4 A;  3L4M D;  3I7O A;  4QT8 A;  4JXM A;  4Y7R A;  3BWS A;  3DM0 A;  2IWK A;  1U4C A;  3F3F A;  2H6K A;  5AMS A;  4FA4 D;  1U2V C;  4ZOV A;  4J81 A;  3EMH A;  4GM8 A;  4NSX A;  1JMX B;  3I7H A;  4A0A A;  2YBA A;  3EI3 A;  3I2N A;  2HKM A;  3V5W B;  3NVQ A;  4J84 A;  5GXH A;  4I79 A;  4JT5 C;  3F3P A;  3EU7 A;  3VA6 A;  3JPX A;  3KRX B;  2B5N A;  2QC5 A;  4J78 A;  4U1E I;  4JSV C;  2AH1 A;  4ERZ A;  4J0X A;  1N6F A;  1SQJ A;  3PXW D;  2BCJ B;  1TBG A;  3OTT A;  3PXT D;  5AJA A;  2AGL A;  3MKS B;  2P9P C;  4J77 A;  2O9K A;  2IUR A;  2YNN A;  3RFG A;  4D0K A;  4XEI C;  1B9X A;  1MDA H;  5TEF A;  3A0F A;  3DWL C;  5GXI A;  4LGN A;  3IKO A;  3IIY A;  3VGZ A;  4L9O A;  2P9K C;  3RFH A;  4Z8L A;  3EI3 B;  5FLX g;  4X61 B;  3EWE A;  3OKT A;  4HDJ A;  5CXB A;  4ERY A;  4G56 B;  2IWF A;  1N6D A;  5TEE A;  2IUQ A;  5HE0 B;  3SBQ A;  5EML B;  3EI4 A;  3OW8 A;  4JSP C;  1K8K C;  5GSA A;  3C9C A;  3SBR A;  3IIW A;  4PC0 A;  5B4W A;  3ODT A;  3RLM D;  5HE3 B;  3DSM A;  3MZK A;  5CYK B;  5IC7 A;  5K19 A;  2Z2O A;  5H17 A;  1GOT B;  4CY3 A;  4A09 B;  3SXT D;  4CZX A;  4UI9 R;  2P9L C;  4JD2 C;  4FAN D;  3OKY A;  3CFS B;  4A0B A;  2XL2 A;  3SFZ A;  3IJC A;  4CI1 A;  1QNI A;  2CN3 A;  2XL3 A;  5H1M A;  4GQB B;  2AH0 A;  3B7F A;  1XKS A;  3C75 H;  2P9N C;  5I5I A;  5IJ8 E;  1JOF A;  2QXV A;  5CXB B;  3U4Y A;  3GFC A;  1VYH C;  4FAV D;  4CZV A;  2IUP A;  3EG6 A;  3AFC A;  3AH8 B;  3UKR C;  3EI4 B;  3JRP A;  1JMZ B;  2CO0 C;  2PM7 B;  4BL0 A;  4PBY A;  5FQD A;  4D6V A;  5FA5 B;  1OLZ A;  4R7A B;  3GRE A;  4PSW B;  3C5M A;  5GMK n;  4LG8 A;  4TZ4 A;  5C9Z B;  2Z2P A;  4H5I A;  3SCY A;  3I89 A;  4GGC A;  3I7P A;  1OMW B;  5KDO B;  3CFV A;  5H14 A;  3CIK B;  2HJB A;  2IAA A;  4A0B B;  3OKY B;  4XYI A;  2P9U C;  3UVK A;  4CZY A;  2G9A A;  3I7L A;  2H9L A;  5FKR A;  3EI2 B;  5CYK A;  2OVP B;  3OL2 A;  2B5M A;  4ES0 A;  3W15 A;  2H9N A;  2CN2 A;  3KRW B;  5I5M A;  4A09 A;  3HFQ A;  2HJ4 A;  3I7N A;  3UVN A;  3P4F A;  4AOW A;  2EBS A;  3FM0 A;  2XYI A;  3RSE C;  4QQE A;  4CC9 A;  2YMU A;  1SHY B;  3UVL A;  2H6Q A;  2AGX A;  2OVQ B;  2H47 A;  1PBY B;  4OWR A;  1JJU B;  2G99 A;  4L3G D;  4FB1 D;  3JZH A;  5EM2 A;  1PI6 A;  5TDH B;  4O1Q D;  4CI8 A;  5A2Q g;  4Y5R D;  2OK6 A;  3JAM g;  2H6N A;  4O45 A;  4E5Z A;  5CXC A;  2HKR A;  4L3H D;  1XIP A;  3PSL A;  5AFU 3;  1RI6 A;  2PM6 B;  5K1C C;  3OL2 B;  5FXY A;  1B9Y A;  2PM9 A;  4ZOZ A;  1MG3 A;  2I0R A;  3J80 g;  5THA A;  2CE9 A;  3PVU B;  1ERJ A;  3IJ0 A;  5EAM A;  3AL9 A;  4N14 A;  2AGW A;  2IUV A;  5EMK B;  5FKQ A;  2I3S A;  4O3U B;  4FA5 D;  5JWZ A;  1R5M A;  3NVX A;  4AEZ A;  2UZX B;  3DXM C;  4LG9 A;  3PE7 A;  4J0W A;  5C2W B;  4ESG A;  3MMY A;  1PGU A;  4ERQ A;  3EI2 A;  2I0T A;  4H5J A;  4FA1 D;  3EI1 A;  3JB9 L;  5EM2 B;  4J73 A;  2OJY A;  3NVN A;  4J87 A;  3UVO A;  5TF2 A;  4A08 A;  1PEV A;  2CO0 A;  3ZWL B;  3UR4 A;  4J82 A;  4J86 A;  4A2M A;  3AL8 A;  4A11 A;  3BG0 A;  2GC4 A;  1XHM A;  3I8C A;  4JSN C;  2MTA H;  5HQG A;  2W18 A;  3PVW B;  4GMB A;  4J8G A;  1Q47 A;  2TRC B;  4E5Z B;  3L4O D;  5CXC B;  4YVD A;  2OVR B;  3UKU C;  1GP2 B;  1YFQ A;  2J56 H;  2H3X A;  3PXS D;  3FRX A;  4L1Q D;  2PM9 B;  3RMZ D;  3RRM C;  3JZG A;  4X60 B;  4E54 A;  4PXW A;  4FWW A;  4CY5 A;  3ORV D;  4GQ2 P;  2P9I C;  3SBP A;  5EMM B;  5IJ7 E;  2HYE A;  4GM9 A;  3IJ1 A;  3RN0 D;  2CNX A;  4GZ8 A;  1MG2 A;  3SHF A;  4A2L A;  1GG2 B;  3SLE D;  1SQ9 A;  3N0E A;  2J55 H;  2PBI B;  3PSC B;  1NEX B;  4FHL A;  4PSX B;  4U7A A;  4BH6 A;  2YNO A;  3UVM A;  3EI1 B;  3MXX A;  4PNK B;  5SXM A;  2Z2N A;  4K3I D;  1P22 A;  2HES X;  3SWS D;  5HE1 B;  3MZL A;  2GNQ A;  4J8B A;  3V7D B;  1K32 A;  2YB8 B;  3J81 g;  4A08 B;  2AGZ A;  1TYQ C;  2H9P A;  2YNP A;  4GGD A;  3AL8 B;  2B4E A;  2BBK H;  2OIZ A;  2P9S C;  4A11 B;  4GM3 A;  3OKW A;  2OK4 A;  4JSX C;  3RN1 D;  2CE8 A;  2GC7 A;  5I5J A;  2AQ5 A;  3JRO A;  3SJL D;  5FKT A;  4MK0 B;  2H68 A;  3DXK C;  3K26 A;  4CY1 A;  2Q7Q A;  4E54 B;  3ULE C;  2I0S A;  2J57 G;  4QRJ A;  4CI2 A;  5IGQ A;  4X3E A;  3I8E A;  5HE2 B;  4GGA A;  4QL1 A;  3VH0 A;  4A0A B;  3I7K A;  4BUJ C;  2H9M A;  1L0Q A;  3BG1 A;  3FGB A;  4OZU A;  5EAR A;  4X63 B;  3SMR A;  2HXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...