5FXYA

Structure of the human rbbp4:mta1(464-546) complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
402
structure length
381
Chain Sequence
DAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPECNPDLRLRGGYGLSWNPNLSGHLLSASDDHTICLWDISAVPGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the core NuRD repression complex provides insights into its interaction with chromatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords HISTONE-BINDING PROTEIN RBBP4
total genus 80
structure length 381
sequence length 402
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fxyA00
2P9PC 4CI8A 2HXCA 4X60B 2H9PA 5IGQA 1JMZB 2AGLA 2GC4A 3FM0A 5EARA 3NVXA 4PSXB 3E0CA 4JXMA 4A2MA 2YNPA 1PI6A 2XU7A 3C5MA 5THAA 3AL8A 1FWXA 3MMYA 3SBRA 2H13A 3PVUB 1NEXB 2XL2A 3MXXA 4BH6A 4O9DA 4L9OA 4GGDA 5HE0B 3SN6B 1PEVA 3MZKA 4ZOVA 2OK4A 2IUPA 3JROA 4IA9A 2OJYA 2H3XA 3I7HA 3DSMA 3RMZD 2IWKA 2OVRB 4XYIA 1QNIA 4BL0A 5IGOA 5HQGA 2UZXB 4J73A 4O3UB 4LGNA 4ZOXA 2CN3A 4FAVD 2PM9A 3BG1A 3UKUC 3F3GA 4GGCA 4JT6C 1PGUA 4JSXC 1XKSA 5FXYA 5TDHB 4R7AB 3VGZA 3EI3B 2P9NC 1A0RB 4PBYA 3I7OA 4QRJA 5EAMA 3BWSA 2CE8A 4A0BB 4O3TB 1N6EA 5GXIA 2I0SA 4MK0B 1R5MA 4AEZA 4GM9A 3UVLA 1XHMA 1SQJA 4J0WA 4PNKB 4A2LA 1MG3A 3I7KA 2AGWA 5I5JA 1GOTB 4U1EI 4AOWA 3DXKC 3C75H 3K27A 4LG9A 3MKQA 4PC0A 4FA4D 2G9AA 4FAND 3B7FA 1JOFA 5EALA 3GFCA 3EG6A 2H9LA 4E5ZB 2MTAH 3EMHA 4Y5RD 1MG2A 2PM6B 5CYKA 3L4OD 3OW8A 4LG8A 3SMRA 1U2VC 3W15A 3OTTA 5H17A 2TRCB 4CZYA 5AMSA 3JZHA 2HKRA 4XEIC 3U4YA 2IURA 4Y7RA 3SXTD 2XL3A 5IJ8E 5EAPA 3MZLA 3JZNA 2H47A 2B5LA 2Z2PA 4FA1D 2P9KC 3C99A 1OMWB 4KFMB 3SCYA 4H5IA 3ULEC 3F3PA 2Z2OA 4XYHA 3AFCA 4G56B 4OWRA 5C2WB 2I3TA 2CE9A 4A0AB 1JMXB 2YNNA 2P9IC 4ZOYA 4L3HD 5H1MA 3UVOA 1B9XA 3RN1D 5IT9g 1N6FA 2B5MA 4D0KA 3PSCB 2H9NA 4J77A 1P22A 3UKRC 2AGYA 3EI4B 3VA6A 5FKQA 4GQ2P 4J78A 3FRXA 4FWWA 4J8GA 2B4EA 4ZOZA 4GMBA 3SWSD 4L3GD 4A08B 4Z8LA 3IIYA 2IUVA 4A7JA 3I2NA 2IWFA 3I7NA 4GQ1A 4CC9A 3PXWD 3NVNA 1SHYB 4FB1D 2IUQA 3DM0A 4D6VA 5HE3B 5AJAA 4TZ4A 5EM2B 1XIPA 3PVWB 5CXBA 1PBYB 2GNQA 2YMUA 1ERJA 5FQDA 5JWZA 4GM3A 4JSNC 5CXBB 4J82A 4BUJC 5KDOB 3FGBA 4A0AA 1N6DA 3JZGA 4OZUA 5CYKB 4QT8A 1YFQA 2OVPB 2I0RA 4N14A 1K8KC 2YNOA 4J79A 4O1QD 3J81g 3UVNA 5TEFA 3KRXB 3OL2A 5K19A 4CY5A 2EBSA 4CZXA 1TYQC 4FHLA 3RFHA 3JRPA 2CO0A 4CI2A 3IJ0A 4PXWA 2BCJB 4E54B 3V9FA 3UVKA 4A08A 1L0QA 3JPXA 4GZ8A 1GP2B 3GREA 4X61B 3EI1B 4X63B 3C9CA 5B4WA 2AH0A 2CN2A 3I8CA 2Z2NA 2QXVA 3P4FA 3I7LA 4JD2C 3PSLA 1Q47A 2H6KA 2HESX 3IIWA 3KRWB 4E5ZA 2AGXA 2OK6A 3UR4A 1RI6A 4YVDA 1U4CA 5FLXg 1GG2B 4QQEA 3IKOA 2P9UC 1K32A 3L4MD 3RSEC 4L1QD 3PXSD 4J8BA 4PSWB 4JT5C 2AH1A 2H68A 5CXCA 5IC7A 4U7AA 3IJCA 4A0BA 3SFZA 4HDJA 3SBQA 4K3ID 3ZWLB 3JB9L 3RN0D 2QC5A 1NR0A 2HJ4A 2XYIA 3SHFA 3RFGA 4EWRA 4E54A 3SLED 2HKMA 3CFSB 4IMMA 5AFU3 1OLZA 4ERQA 3F3FA 2J56H 2HJBA 2PM7B 3PE7A 4ERYA 3AL9A 4PBZA 4FA5D 3PXTD 2I0TA 5IJ7E 4CI3A 5I5MA 4ES0A 3VH0A 3SVWD 4ESGA 2PM9B 4J84A 3UVMA 4CY3A 3CFVA 3NVQA 3CIKB 5HE1B 2H6NA 3ORVD 4A11A 1SQ9A 2HYEA 5C9ZB 5A2Qg 2H6QA 4QL1A 4CZVA 3DWLC 5TF2A 5TEEA 2P9SC 2W18A 4CY2A 5EMKB 5EMMB 3OKTA 4J86A 3OKYB 2OVQB 4X3EA 4ERZA 2OIZA 2CO0C 3EI3A 5K1CC 3SBPA 5GMKn 5FA5B 1MDAH 5HYNB 3OKYA 3ODTA 4J81A 4NSXA 4J87A 5EMJB 3A0FA 3EI1A 1GXRA 2H14A 4JSPC 2YBAA 3I89A 3HFQA 4GGAA 5HE2B 2J57G 3SJLD 2H9MA 2I3SA 4H5JA 3N0DA 3EWEA 3V5WB 3IJ1A 2Q7QA 5FKTA 3V7DB 2B5NA 5GSAA 4CY1A 3OL2B 3EU7A 4I79A 4K3JB 2UZYB 4O45A 1JJUB 4ZN4A 4JSVC 4FA9D 2J55H 4A11B 3EI2A 5FKSA 2CNXA 3AL8B 2P9LC 2AGZA 5SXMA 3EI4A 5CXCB 4GQBB 3EI2B 2GC7A 4J0XA 4GM8A 3RLMD 3JAMg 3OKWA 3BG0A 5H14A 5C2VB 2YB8B 5EM2A 2AQ5A 2G99A 2BBKH 1VYHC 3I7PA 1S4UX 2O9KA 3K26A 1TBGA 3DXMC 4UI9R 3RRMC 3MKSB 1B9YA 3I8EA 4A09B 5EMLB 5FKRA 2PBIB 3J80g 2IAAA 4CI1A 4A09A 5I5IA 3AH8B 5GXHA 3N0EA
chains in the Genus database with same CATH superfamily
2P9PC 3QHYB 4CI8A 2HXCA 4X60B 2H9PA 5IGQA 1JMZB 1UOPA 2AGLA 2GC4A 4RE5A 4DNVA 3FM0A 5EARA 3NVXA 4PSXB 3E0CA 4JXMA 2EIBA 4A2MA 2YNPA 1PI6A 2XU7A 3C5MA 5THAA 3AL8A 1FWXA 3MMYA 3SBRA 1QFMA 2H13A 3PVUB 1NEXB 2XL2A 3MXXA 4BH6A 5E6RA 4O9DA 1VZ3A 4D9SA 4L9OA 4GGDA 5HE0B 3SN6B 3MZKA 1PEVA 2XZGA 4ZOVA 3ZDYA 2OK4A 2IUPA 3JROA 4IA9A 3IUJA 2OJYA 2VDQA 2H3XA 3I7HA 3DSMA 3RMZD 2IWKA 3VI4A 2OVRB 4XYIA 1QNIA 4BL0A 1C9LA 1H2XA 2UZXB 4J73A 5HQGA 5IGOA 5E6UA 4O3UB 4LGNA 4ZOXA 2CN3A 2VDRA 4FAVD 2PM9A 3BG1A 3IUNA 4AMYA 3UKUC 1H2ZA 3IURA 3F3GA 4GGCA 4JT6C 1PGUA 4JSXC 1XKSA 5FXYA 5TDHB 4R7AB 3VGZA 3MUOA 1I2MB 2P9NC 3EI3B 1A0RB 4PBYA 4O02A 3I7OA 4QRJA 5EAMA 3BWSA 2CE8A 2XE4A 4A0BB 4O3TB 1N6EA 5GXIA 2I0SA 4MK0B 1R5MA 4AEZA 4GM9A 3UVLA 1XHMA 1SQJA 4J0WA 4PNKB 1VZ2A 4A2LA 1MG3A 3I7KA 2AGWA 5I5JA 1GOTB 3K6SA 4U1EI 4G1MA 4AOWA 3DXKC 3C75H 3K27A 4LG9A 3MKQA 4PC0A 4FA4D 2G9AA 4FAND 3B7FA 1JOFA 5EALA 3GFCA 3EG6A 2H9LA 4E5ZB 2MTAH 3EMHA 4Y5RD 1UOQA 1MG2A 2PM6B 4WJKA 5C92A 2HU8A 4MMZA 5CYKA 3MUNA 3L4OD 3OW8A 3NIFA 4LG8A 3SMRA 2EICA 3O4GA 1U2VC 3W15A 3OTTA 5H17A 2TRCB 4CZYA 4NC4A 5AMSA 3JZHA 2HKRA 4XEIC 2BKLA 3U4YA 2IURA 4Y7RA 3SXTD 3NIGA 3ZE0A 2XL3A 5IJ8E 5EAPA 3MZLA 3JZNA 4NBMA 2B5LA 2H47A 2Z2PA 4FA1D 2P9KC 3C99A 1OMWB 2VDKA 4KFMB 1M1XA 3SCYA 4H5IA 3ULEC 3F3PA 2VC2A 2VDLA 2Z2OA 1YR2A 4G55A 4XYHA 3AFCA 4G56B 4OWRA 5C2WB 2JKXA 2I3TA 2CE9A 2VZ1A 1E8NA 4A0AB 1JMXB 2YNNA 2P9IC 4ZOYA 4L3HD 5H1MA 3UVOA 1B9XA 3RN1D 4JHNA 5IT9g 1N6FA 2B5MA 3NIDA 4RE6A 3T3PA 4D0KA 3PSCB 2H9NA 4J77A 1P22A 3UKRC 2AGYA 3EI4B 3K71A 3VA6A 4O2WA 2QR5A 5FKQA 4GQ2P 4J78A 3FRXA 4FWWA 4J8GA 2B4EA 4ZOZA 4GMBA 3SWSD 4L3GD 4A08B 4Z8LA 3IIYA 2IUVA 4A7JA 4WK2A 3I2NA 2IWFA 3I7NA 4GQ1A 4CC9A 3PXWD 3NVNA 1SHYB 4FB1D 4G1EA 1VE7A 4AMZA 2IUQA 4NAAA 2WQ8A 3DM0A 4MMXA 4D6VA 3FCSA 5AJAA 5HE3B 4TZ4A 5EM2B 1UTCA 1XIPA 3PVWB 5CXBA 1PBYB 2GNQA 2YMUA 1ERJA 5FQDA 5JWZA 4GM3A 4JSNC 1GOFA 5CXBB 4J82A 4BUJC 4WK4A 5KDOB 3FGBA 4A0AA 1N6DA 3JZGA 4OZUA 5CYKB 4QT8A 1E8MA 3EQ9A 1YFQA 2I0RA 2OVPB 5M61A 4N14A 1K8KC 2YNOA 4J79A 4O1QD 3J81g 3UVNA 5TEFA 3KRXB 3OL2A 3EQ8A 5K19A 4CY5A 2EBSA 4CZXA 1TYQC 4FHLA 3RFHA 3JRPA 2CO0A 4BCBA 4CI2A 1UOOA 3ZE1A 3IJ0A 4PXWA 2BCJB 4E54B 3V9FA 3UVKA 4A08A 1O6FA 1L0QA 3JPXA 4GZ8A 1GP2B 3GREA 4X61B 3EI1B 4X63B 1T2XA 3C9CA 5B4WA 2AH0A 2CN2A 3I8CA 3O4JA 2Z2NA 2QXVA 3P4FA 3I7LA 1GOGA 4JD2C 3PSLA 1Q47A 2H6KA 2HESX 3IIWA 3KRWB 4E5ZA 2AGXA 3ZDXA 1H2YA 2OK6A 3EQ7A 3UR4A 1RI6A 4YVDA 3V4PA 2EIEA 1U4CA 5E6SA 3O4IA 4JHPC 5FLXg 1GG2B 4QQEA 3IKOA 3KCIA 2P9UC 1K32A 3L4MD 3RSEC 3QI0A 3IUQA 4L1QD 3PXSD 4J8BA 4PSWB 4JT5C 2AH1A 2HU5A 2H68A 3FCUA 5CXCA 5FFOA 5IC7A 3T3MA 4Z7NA 2VZ3A 1VE6A 4U7AA 3IJCA 4A0BA 3SFZA 4HDJA 3SBQA 4K3ID 3ZWLB 3JB9L 3RN0D 1GOHA 2QC5A 3V4VA 1NR0A 2HJ4A 2XYIA 5FFGA 3IULA 3SHFA 2VDPA 5M5TA 3RFGA 4EWRA 4E54A 3SLED 2HKMA 2XDWA 3CFSB 4IMMA 5AFU3 1OLZA 4AN1A 4ERQA 3F3FA 5M5SA 2J56H 2HJBA 3IJEA 2PM7B 3PE7A 4ERYA 3AL9A 4L1MA 4PBZA 4FA5D 3PXTD 2I0TA 5IJ7E 3O4HA 4CI3A 4ES0A 5I5MA 3SVWD 3VH0A 4ESGA 2PM9B 4BP9A 4J84A 3UVMA 4CY3A 3CFVA 3NVQA 3CIKB 5HE1B 2H6NA 3ORVD 4A11A 1A12A 3ZE2A 1SQ9A 2HYEA 5C9ZB 4NENA 2HU7A 5A2Qg 2H6QA 4QL1A 4CZVA 2EIDA 3DWLC 5TF2A 5TEEA 2P9SC 2W18A 4CY2A 5EMKB 3MVDK 3OF7A 4QAMA 5EMMB 3OKTA 4AX4A 4J86A 3OKYB 4BCCA 2OVQB 4BCDA 4X3EA 4ERZA 2OIZA 1JV2A 2CO0C 3EI3A 5HDBA 5K1CC 3ZDZA 4Z7QA 3SBPA 2VDOA 5GMKn 5FA5B 1MDAH 5HYNB 3OKYA 3ODTA 1E5TA 3VI3A 4J81A 4NSXA 4J87A 5EMJB 3A0FA 3EI1A 1GXRA 2H14A 4MMYA 4JSPC 2YBAA 3I89A 3HFQA 4GGAA 1U8CA 5HE2B 4DNWA 2J57G 3SJLD 2H9MA 2I3SA 4H5JA 3N0DA 2VDNA 3EWEA 2VDMA 3V5WB 3IJ1A 2Q7QA 5FKTA 3V7DB 2B5NA 5GSAA 3IVMA 4CY1A 4Z7OA 1JTDB 3OL2B 3EU7A 4I79A 4K3JB 2UZYB 3GD1I 4O45A 1JJUB 4ZN4A 3K72A 4DNUA 4JSVC 4FA9D 2J55H 4A11B 3EI2A 5FKSA 2CNXA 3AL8B 2P9LC 2AGZA 5SXMA 3EI4A 5CXCB 3IUMA 3GC3B 4GQBB 3EI2B 1H2WA 2GC7A 4J0XA 4GM8A 3DDUA 3RLMD 3JAMg 3OKWA 3BG0A 5C86A 5H14A 5C2VB 2YB8B 4UM9A 2QZPA 4AN0A 5EM2A 5M5UA 2AQ5A 2G99A 2BBKH 1VYHC 3I7PA 1S4UX 1BPOA 1C9IA 2O9KA 5M5RA 1L5GA 3K26A 4UM8A 1K3IA 1TBGA 1QFSA 3DXMC 4IRZA 4UI9R 3RRMC 1O6GA 1TYEA 4BP8A 3MKSB 1B9YA 5M5VA 3I8EA 4A09B 5EMLB 5FKRA 2PBIB 3J80g 4WK0A 2IAAA 4CI1A 4A09A 5I5IA 3AH8B 5GXHA 3N0EA
chains in the Genus database with same CATH topology
2P9PC 4CI8A 2HXCA 4X60B 2H9PA 5IGQA 1JMZB 2AGLA 2GC4A 3FM0A 5EARA 3NVXA 4PSXB 3E0CA 4JXMA 4A2MA 2YNPA 1PI6A 2XU7A 3C5MA 5THAA 3AL8A 1FWXA 3MMYA 3SBRA 2H13A 3PVUB 1NEXB 2XL2A 3MXXA 4BH6A 4O9DA 4L9OA 4GGDA 5HE0B 3SN6B 1PEVA 3MZKA 4ZOVA 2OK4A 2IUPA 3JROA 4IA9A 2OJYA 2H3XA 3I7HA 3DSMA 3RMZD 2IWKA 2OVRB 4XYIA 1QNIA 4BL0A 5IGOA 5HQGA 2UZXB 4J73A 4O3UB 4LGNA 4ZOXA 2CN3A 4FAVD 2PM9A 3BG1A 3UKUC 3F3GA 4GGCA 4JT6C 1PGUA 4JSXC 1XKSA 5FXYA 5TDHB 4R7AB 3VGZA 3EI3B 2P9NC 1A0RB 4PBYA 3I7OA 4QRJA 5EAMA 3BWSA 2CE8A 4A0BB 4O3TB 1N6EA 5GXIA 2I0SA 4MK0B 1R5MA 4AEZA 4GM9A 3UVLA 1XHMA 1SQJA 4J0WA 4PNKB 4A2LA 1MG3A 3I7KA 2AGWA 5I5JA 1GOTB 4U1EI 4AOWA 3DXKC 3C75H 3K27A 4LG9A 3MKQA 4PC0A 4FA4D 2G9AA 4FAND 3B7FA 1JOFA 5EALA 3GFCA 3EG6A 2H9LA 4E5ZB 2MTAH 3EMHA 4Y5RD 1MG2A 2PM6B 5CYKA 3L4OD 3OW8A 4LG8A 3SMRA 1U2VC 3W15A 3OTTA 5H17A 2TRCB 4CZYA 5AMSA 3JZHA 2HKRA 4XEIC 3U4YA 2IURA 4Y7RA 3SXTD 2XL3A 5IJ8E 5EAPA 3MZLA 3JZNA 2H47A 2B5LA 2Z2PA 4FA1D 2P9KC 3C99A 1OMWB 4KFMB 3SCYA 4H5IA 3ULEC 3F3PA 2Z2OA 4XYHA 3AFCA 4G56B 4OWRA 5C2WB 2I3TA 2CE9A 4A0AB 1JMXB 2YNNA 2P9IC 4ZOYA 4L3HD 5H1MA 3UVOA 1B9XA 3RN1D 5IT9g 1N6FA 2B5MA 4D0KA 3PSCB 2H9NA 4J77A 1P22A 3UKRC 2AGYA 3EI4B 3VA6A 5FKQA 4GQ2P 4J78A 3FRXA 4FWWA 4J8GA 2B4EA 4ZOZA 4GMBA 3SWSD 4L3GD 4A08B 4Z8LA 3IIYA 2IUVA 4A7JA 3I2NA 2IWFA 3I7NA 4GQ1A 4CC9A 3PXWD 3NVNA 1SHYB 4FB1D 2IUQA 3DM0A 4D6VA 5HE3B 5AJAA 4TZ4A 5EM2B 1XIPA 3PVWB 5CXBA 1PBYB 2GNQA 2YMUA 1ERJA 5FQDA 5JWZA 4GM3A 4JSNC 5CXBB 4J82A 4BUJC 5KDOB 3FGBA 4A0AA 1N6DA 3JZGA 4OZUA 5CYKB 4QT8A 1YFQA 2OVPB 2I0RA 4N14A 1K8KC 2YNOA 4J79A 4O1QD 3J81g 3UVNA 5TEFA 3KRXB 3OL2A 5K19A 4CY5A 2EBSA 4CZXA 1TYQC 4FHLA 3RFHA 3JRPA 2CO0A 4CI2A 3IJ0A 4PXWA 2BCJB 4E54B 3V9FA 3UVKA 4A08A 1L0QA 3JPXA 4GZ8A 1GP2B 3GREA 4X61B 3EI1B 4X63B 3C9CA 5B4WA 2AH0A 2CN2A 3I8CA 2Z2NA 2QXVA 3P4FA 3I7LA 4JD2C 3PSLA 1Q47A 2H6KA 2HESX 3IIWA 3KRWB 4E5ZA 2AGXA 2OK6A 3UR4A 1RI6A 4YVDA 1U4CA 5FLXg 1GG2B 4QQEA 3IKOA 2P9UC 1K32A 3L4MD 3RSEC 4L1QD 3PXSD 4J8BA 4PSWB 4JT5C 2AH1A 2H68A 5CXCA 5IC7A 4U7AA 3IJCA 4A0BA 3SFZA 4HDJA 3SBQA 4K3ID 3ZWLB 3JB9L 3RN0D 2QC5A 1NR0A 2HJ4A 2XYIA 3SHFA 3RFGA 4EWRA 4E54A 3SLED 2HKMA 3CFSB 4IMMA 5AFU3 1OLZA 4ERQA 3F3FA 2J56H 2HJBA 2PM7B 3PE7A 4ERYA 3AL9A 4PBZA 4FA5D 3PXTD 2I0TA 5IJ7E 4CI3A 5I5MA 4ES0A 3VH0A 3SVWD 4ESGA 2PM9B 4J84A 3UVMA 4CY3A 3CFVA 3NVQA 3CIKB 5HE1B 2H6NA 3ORVD 4A11A 1SQ9A 2HYEA 5C9ZB 5A2Qg 2H6QA 4QL1A 4CZVA 3DWLC 5TF2A 5TEEA 2P9SC 2W18A 4CY2A 5EMKB 5EMMB 3OKTA 4J86A 3OKYB 2OVQB 4X3EA 4ERZA 2OIZA 2CO0C 3EI3A 5K1CC 3SBPA 5GMKn 5FA5B 1MDAH 5HYNB 3OKYA 3ODTA 4J81A 4NSXA 4J87A 5EMJB 3A0FA 3EI1A 1GXRA 2H14A 4JSPC 2YBAA 3I89A 3HFQA 4GGAA 5HE2B 2J57G 3SJLD 2H9MA 2I3SA 4H5JA 3N0DA 3EWEA 3V5WB 3IJ1A 2Q7QA 5FKTA 3V7DB 2B5NA 5GSAA 4CY1A 3OL2B 3EU7A 4I79A 4K3JB 2UZYB 4O45A 1JJUB 4ZN4A 4JSVC 4FA9D 2J55H 4A11B 3EI2A 5FKSA 2CNXA 3AL8B 2P9LC 2AGZA 5SXMA 3EI4A 5CXCB 4GQBB 3EI2B 2GC7A 4J0XA 4GM8A 3RLMD 3JAMg 3OKWA 3BG0A 5H14A 5C2VB 2YB8B 5EM2A 2AQ5A 2G99A 2BBKH 1VYHC 3I7PA 1S4UX 2O9KA 3K26A 1TBGA 3DXMC 4UI9R 3RRMC 3MKSB 1B9YA 3I8EA 4A09B 5EMLB 5FKRA 2PBIB 3J80g 2IAAA 4CI1A 4A09A 5I5IA 3AH8B 5GXHA 3N0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P C;  4CI8 A;  2HXC A;  4X60 B;  2H9P A;  5IGQ A;  1JMZ B;  2AGL A;  2GC4 A;  3FM0 A;  5EAR A;  3NVX A;  4PSX B;  3E0C A;  4JXM A;  4A2M A;  2YNP A;  1PI6 A;  2XU7 A;  3C5M A;  5THA A;  3AL8 A;  1FWX A;  3MMY A;  3SBR A;  2H13 A;  3PVU B;  1NEX B;  2XL2 A;  3MXX A;  4BH6 A;  4O9D A;  4L9O A;  4GGD A;  5HE0 B;  3SN6 B;  1PEV A;  3MZK A;  4ZOV A;  2OK4 A;  2IUP A;  3JRO A;  4IA9 A;  2OJY A;  2H3X A;  3I7H A;  3DSM A;  3RMZ D;  2IWK A;  2OVR B;  4XYI A;  1QNI A;  4BL0 A;  5IGO A;  5HQG A;  2UZX B;  4J73 A;  4O3U B;  4LGN A;  4ZOX A;  2CN3 A;  4FAV D;  2PM9 A;  3BG1 A;  3UKU C;  3F3G A;  4GGC A;  4JT6 C;  1PGU A;  4JSX C;  1XKS A;  5FXY A;  5TDH B;  4R7A B;  3VGZ A;  3EI3 B;  2P9N C;  1A0R B;  4PBY A;  3I7O A;  4QRJ A;  5EAM A;  3BWS A;  2CE8 A;  4A0B B;  4O3T B;  1N6E A;  5GXI A;  2I0S A;  4MK0 B;  1R5M A;  4AEZ A;  4GM9 A;  3UVL A;  1XHM A;  1SQJ A;  4J0W A;  4PNK B;  4A2L A;  1MG3 A;  3I7K A;  2AGW A;  5I5J A;  1GOT B;  4U1E I;  4AOW A;  3DXK C;  3C75 H;  3K27 A;  4LG9 A;  3MKQ A;  4PC0 A;  4FA4 D;  2G9A A;  4FAN D;  3B7F A;  1JOF A;  5EAL A;  3GFC A;  3EG6 A;  2H9L A;  4E5Z B;  2MTA H;  3EMH A;  4Y5R D;  1MG2 A;  2PM6 B;  5CYK A;  3L4O D;  3OW8 A;  4LG8 A;  3SMR A;  1U2V C;  3W15 A;  3OTT A;  5H17 A;  2TRC B;  4CZY A;  5AMS A;  3JZH A;  2HKR A;  4XEI C;  3U4Y A;  2IUR A;  4Y7R A;  3SXT D;  2XL3 A;  5IJ8 E;  5EAP A;  3MZL A;  3JZN A;  2H47 A;  2B5L A;  2Z2P A;  4FA1 D;  2P9K C;  3C99 A;  1OMW B;  4KFM B;  3SCY A;  4H5I A;  3ULE C;  3F3P A;  2Z2O A;  4XYH A;  3AFC A;  4G56 B;  4OWR A;  5C2W B;  2I3T A;  2CE9 A;  4A0A B;  1JMX B;  2YNN A;  2P9I C;  4ZOY A;  4L3H D;  5H1M A;  3UVO A;  1B9X A;  3RN1 D;  5IT9 g;  1N6F A;  2B5M A;  4D0K A;  3PSC B;  2H9N A;  4J77 A;  1P22 A;  3UKR C;  2AGY A;  3EI4 B;  3VA6 A;  5FKQ A;  4GQ2 P;  4J78 A;  3FRX A;  4FWW A;  4J8G A;  2B4E A;  4ZOZ A;  4GMB A;  3SWS D;  4L3G D;  4A08 B;  4Z8L A;  3IIY A;  2IUV A;  4A7J A;  3I2N A;  2IWF A;  3I7N A;  4GQ1 A;  4CC9 A;  3PXW D;  3NVN A;  1SHY B;  4FB1 D;  2IUQ A;  3DM0 A;  4D6V A;  5HE3 B;  5AJA A;  4TZ4 A;  5EM2 B;  1XIP A;  3PVW B;  5CXB A;  1PBY B;  2GNQ A;  2YMU A;  1ERJ A;  5FQD A;  5JWZ A;  4GM3 A;  4JSN C;  5CXB B;  4J82 A;  4BUJ C;  5KDO B;  3FGB A;  4A0A A;  1N6D A;  3JZG A;  4OZU A;  5CYK B;  4QT8 A;  1YFQ A;  2OVP B;  2I0R A;  4N14 A;  1K8K C;  2YNO A;  4J79 A;  4O1Q D;  3J81 g;  3UVN A;  5TEF A;  3KRX B;  3OL2 A;  5K19 A;  4CY5 A;  2EBS A;  4CZX A;  1TYQ C;  4FHL A;  3RFH A;  3JRP A;  2CO0 A;  4CI2 A;  3IJ0 A;  4PXW A;  2BCJ B;  4E54 B;  3V9F A;  3UVK A;  4A08 A;  1L0Q A;  3JPX A;  4GZ8 A;  1GP2 B;  3GRE A;  4X61 B;  3EI1 B;  4X63 B;  3C9C A;  5B4W A;  2AH0 A;  2CN2 A;  3I8C A;  2Z2N A;  2QXV A;  3P4F A;  3I7L A;  4JD2 C;  3PSL A;  1Q47 A;  2H6K A;  2HES X;  3IIW A;  3KRW B;  4E5Z A;  2AGX A;  2OK6 A;  3UR4 A;  1RI6 A;  4YVD A;  1U4C A;  5FLX g;  1GG2 B;  4QQE A;  3IKO A;  2P9U C;  1K32 A;  3L4M D;  3RSE C;  4L1Q D;  3PXS D;  4J8B A;  4PSW B;  4JT5 C;  2AH1 A;  2H68 A;  5CXC A;  5IC7 A;  4U7A A;  3IJC A;  4A0B A;  3SFZ A;  4HDJ A;  3SBQ A;  4K3I D;  3ZWL B;  3JB9 L;  3RN0 D;  2QC5 A;  1NR0 A;  2HJ4 A;  2XYI A;  3SHF A;  3RFG A;  4EWR A;  4E54 A;  3SLE D;  2HKM A;  3CFS B;  4IMM A;  5AFU 3;  1OLZ A;  4ERQ A;  3F3F A;  2J56 H;  2HJB A;  2PM7 B;  3PE7 A;  4ERY A;  3AL9 A;  4PBZ A;  4FA5 D;  3PXT D;  2I0T A;  5IJ7 E;  4CI3 A;  5I5M A;  4ES0 A;  3VH0 A;  3SVW D;  4ESG A;  2PM9 B;  4J84 A;  3UVM A;  4CY3 A;  3CFV A;  3NVQ A;  3CIK B;  5HE1 B;  2H6N A;  3ORV D;  4A11 A;  1SQ9 A;  2HYE A;  5C9Z B;  5A2Q g;  2H6Q A;  4QL1 A;  4CZV A;  3DWL C;  5TF2 A;  5TEE A;  2P9S C;  2W18 A;  4CY2 A;  5EMK B;  5EMM B;  3OKT A;  4J86 A;  3OKY B;  2OVQ B;  4X3E A;  4ERZ A;  2OIZ A;  2CO0 C;  3EI3 A;  5K1C C;  3SBP A;  5GMK n;  5FA5 B;  1MDA H;  5HYN B;  3OKY A;  3ODT A;  4J81 A;  4NSX A;  4J87 A;  5EMJ B;  3A0F A;  3EI1 A;  1GXR A;  2H14 A;  4JSP C;  2YBA A;  3I89 A;  3HFQ A;  4GGA A;  5HE2 B;  2J57 G;  3SJL D;  2H9M A;  2I3S A;  4H5J A;  3N0D A;  3EWE A;  3V5W B;  3IJ1 A;  2Q7Q A;  5FKT A;  3V7D B;  2B5N A;  5GSA A;  4CY1 A;  3OL2 B;  3EU7 A;  4I79 A;  4K3J B;  2UZY B;  4O45 A;  1JJU B;  4ZN4 A;  4JSV C;  4FA9 D;  2J55 H;  4A11 B;  3EI2 A;  5FKS A;  2CNX A;  3AL8 B;  2P9L C;  2AGZ A;  5SXM A;  3EI4 A;  5CXC B;  4GQB B;  3EI2 B;  2GC7 A;  4J0X A;  4GM8 A;  3RLM D;  3JAM g;  3OKW A;  3BG0 A;  5H14 A;  5C2V B;  2YB8 B;  5EM2 A;  2AQ5 A;  2G99 A;  2BBK H;  1VYH C;  3I7P A;  1S4U X;  2O9K A;  3K26 A;  1TBG A;  3DXM C;  4UI9 R;  3RRM C;  3MKS B;  1B9Y A;  3I8E A;  4A09 B;  5EML B;  5FKR A;  2PBI B;  3J80 g;  2IAA A;  4CI1 A;  4A09 A;  5I5I A;  3AH8 B;  5GXH A;  3N0E A; 
#chains in the Genus database with same CATH topology
 2P9P C;  3QHY B;  4CI8 A;  2HXC A;  4X60 B;  2H9P A;  5IGQ A;  1JMZ B;  1UOP A;  2AGL A;  2GC4 A;  4RE5 A;  4DNV A;  3FM0 A;  5EAR A;  3NVX A;  4PSX B;  3E0C A;  4JXM A;  2EIB A;  4A2M A;  2YNP A;  1PI6 A;  2XU7 A;  3C5M A;  5THA A;  3AL8 A;  1FWX A;  3MMY A;  3SBR A;  1QFM A;  2H13 A;  3PVU B;  1NEX B;  2XL2 A;  3MXX A;  4BH6 A;  5E6R A;  4O9D A;  1VZ3 A;  4D9S A;  4L9O A;  4GGD A;  5HE0 B;  3SN6 B;  3MZK A;  1PEV A;  2XZG A;  4ZOV A;  3ZDY A;  2OK4 A;  2IUP A;  3JRO A;  4IA9 A;  3IUJ A;  2OJY A;  2VDQ A;  2H3X A;  3I7H A;  3DSM A;  3RMZ D;  2IWK A;  3VI4 A;  2OVR B;  4XYI A;  1QNI A;  4BL0 A;  1C9L A;  1H2X A;  2UZX B;  4J73 A;  5HQG A;  5IGO A;  5E6U A;  4O3U B;  4LGN A;  4ZOX A;  2CN3 A;  2VDR A;  4FAV D;  2PM9 A;  3BG1 A;  3IUN A;  4AMY A;  3UKU C;  1H2Z A;  3IUR A;  3F3G A;  4GGC A;  4JT6 C;  1PGU A;  4JSX C;  1XKS A;  5FXY A;  5TDH B;  4R7A B;  3VGZ A;  3MUO A;  1I2M B;  2P9N C;  3EI3 B;  1A0R B;  4PBY A;  4O02 A;  3I7O A;  4QRJ A;  5EAM A;  3BWS A;  2CE8 A;  2XE4 A;  4A0B B;  4O3T B;  1N6E A;  5GXI A;  2I0S A;  4MK0 B;  1R5M A;  4AEZ A;  4GM9 A;  3UVL A;  1XHM A;  1SQJ A;  4J0W A;  4PNK B;  1VZ2 A;  4A2L A;  1MG3 A;  3I7K A;  2AGW A;  5I5J A;  1GOT B;  3K6S A;  4U1E I;  4G1M A;  4AOW A;  3DXK C;  3C75 H;  3K27 A;  4LG9 A;  3MKQ A;  4PC0 A;  4FA4 D;  2G9A A;  4FAN D;  3B7F A;  1JOF A;  5EAL A;  3GFC A;  3EG6 A;  2H9L A;  4E5Z B;  2MTA H;  3EMH A;  4Y5R D;  1UOQ A;  1MG2 A;  2PM6 B;  4WJK A;  5C92 A;  2HU8 A;  4MMZ A;  5CYK A;  3MUN A;  3L4O D;  3OW8 A;  3NIF A;  4LG8 A;  3SMR A;  2EIC A;  3O4G A;  1U2V C;  3W15 A;  3OTT A;  5H17 A;  2TRC B;  4CZY A;  4NC4 A;  5AMS A;  3JZH A;  2HKR A;  4XEI C;  2BKL A;  3U4Y A;  2IUR A;  4Y7R A;  3SXT D;  3NIG A;  3ZE0 A;  2XL3 A;  5IJ8 E;  5EAP A;  3MZL A;  3JZN A;  4NBM A;  2B5L A;  2H47 A;  2Z2P A;  4FA1 D;  2P9K C;  3C99 A;  1OMW B;  2VDK A;  4KFM B;  1M1X A;  3SCY A;  4H5I A;  3ULE C;  3F3P A;  2VC2 A;  2VDL A;  2Z2O A;  1YR2 A;  4G55 A;  4XYH A;  3AFC A;  4G56 B;  4OWR A;  5C2W B;  2JKX A;  2I3T A;  2CE9 A;  2VZ1 A;  1E8N A;  4A0A B;  1JMX B;  2YNN A;  2P9I C;  4ZOY A;  4L3H D;  5H1M A;  3UVO A;  1B9X A;  3RN1 D;  4JHN A;  5IT9 g;  1N6F A;  2B5M A;  3NID A;  4RE6 A;  3T3P A;  4D0K A;  3PSC B;  2H9N A;  4J77 A;  1P22 A;  3UKR C;  2AGY A;  3EI4 B;  3K71 A;  3VA6 A;  4O2W A;  2QR5 A;  5FKQ A;  4GQ2 P;  4J78 A;  3FRX A;  4FWW A;  4J8G A;  2B4E A;  4ZOZ A;  4GMB A;  3SWS D;  4L3G D;  4A08 B;  4Z8L A;  3IIY A;  2IUV A;  4A7J A;  4WK2 A;  3I2N A;  2IWF A;  3I7N A;  4GQ1 A;  4CC9 A;  3PXW D;  3NVN A;  1SHY B;  4FB1 D;  4G1E A;  1VE7 A;  4AMZ A;  2IUQ A;  4NAA A;  2WQ8 A;  3DM0 A;  4MMX A;  4D6V A;  3FCS A;  5AJA A;  5HE3 B;  4TZ4 A;  5EM2 B;  1UTC A;  1XIP A;  3PVW B;  5CXB A;  1PBY B;  2GNQ A;  2YMU A;  1ERJ A;  5FQD A;  5JWZ A;  4GM3 A;  4JSN C;  1GOF A;  5CXB B;  4J82 A;  4BUJ C;  4WK4 A;  5KDO B;  3FGB A;  4A0A A;  1N6D A;  3JZG A;  4OZU A;  5CYK B;  4QT8 A;  1E8M A;  3EQ9 A;  1YFQ A;  2I0R A;  2OVP B;  5M61 A;  4N14 A;  1K8K C;  2YNO A;  4J79 A;  4O1Q D;  3J81 g;  3UVN A;  5TEF A;  3KRX B;  3OL2 A;  3EQ8 A;  5K19 A;  4CY5 A;  2EBS A;  4CZX A;  1TYQ C;  4FHL A;  3RFH A;  3JRP A;  2CO0 A;  4BCB A;  4CI2 A;  1UOO A;  3ZE1 A;  3IJ0 A;  4PXW A;  2BCJ B;  4E54 B;  3V9F A;  3UVK A;  4A08 A;  1O6F A;  1L0Q A;  3JPX A;  4GZ8 A;  1GP2 B;  3GRE A;  4X61 B;  3EI1 B;  4X63 B;  1T2X A;  3C9C A;  5B4W A;  2AH0 A;  2CN2 A;  3I8C A;  3O4J A;  2Z2N A;  2QXV A;  3P4F A;  3I7L A;  1GOG A;  4JD2 C;  3PSL A;  1Q47 A;  2H6K A;  2HES X;  3IIW A;  3KRW B;  4E5Z A;  2AGX A;  3ZDX A;  1H2Y A;  2OK6 A;  3EQ7 A;  3UR4 A;  1RI6 A;  4YVD A;  3V4P A;  2EIE A;  1U4C A;  5E6S A;  3O4I A;  4JHP C;  5FLX g;  1GG2 B;  4QQE A;  3IKO A;  3KCI A;  2P9U C;  1K32 A;  3L4M D;  3RSE C;  3QI0 A;  3IUQ A;  4L1Q D;  3PXS D;  4J8B A;  4PSW B;  4JT5 C;  2AH1 A;  2HU5 A;  2H68 A;  3FCU A;  5CXC A;  5FFO A;  5IC7 A;  3T3M A;  4Z7N A;  2VZ3 A;  1VE6 A;  4U7A A;  3IJC A;  4A0B A;  3SFZ A;  4HDJ A;  3SBQ A;  4K3I D;  3ZWL B;  3JB9 L;  3RN0 D;  1GOH A;  2QC5 A;  3V4V A;  1NR0 A;  2HJ4 A;  2XYI A;  5FFG A;  3IUL A;  3SHF A;  2VDP A;  5M5T A;  3RFG A;  4EWR A;  4E54 A;  3SLE D;  2HKM A;  2XDW A;  3CFS B;  4IMM A;  5AFU 3;  1OLZ A;  4AN1 A;  4ERQ A;  3F3F A;  5M5S A;  2J56 H;  2HJB A;  3IJE A;  2PM7 B;  3PE7 A;  4ERY A;  3AL9 A;  4L1M A;  4PBZ A;  4FA5 D;  3PXT D;  2I0T A;  5IJ7 E;  3O4H A;  4CI3 A;  4ES0 A;  5I5M A;  3SVW D;  3VH0 A;  4ESG A;  2PM9 B;  4BP9 A;  4J84 A;  3UVM A;  4CY3 A;  3CFV A;  3NVQ A;  3CIK B;  5HE1 B;  2H6N A;  3ORV D;  4A11 A;  1A12 A;  3ZE2 A;  1SQ9 A;  2HYE A;  5C9Z B;  4NEN A;  2HU7 A;  5A2Q g;  2H6Q A;  4QL1 A;  4CZV A;  2EID A;  3DWL C;  5TF2 A;  5TEE A;  2P9S C;  2W18 A;  4CY2 A;  5EMK B;  3MVD K;  3OF7 A;  4QAM A;  5EMM B;  3OKT A;  4AX4 A;  4J86 A;  3OKY B;  4BCC A;  2OVQ B;  4BCD A;  4X3E A;  4ERZ A;  2OIZ A;  1JV2 A;  2CO0 C;  3EI3 A;  5HDB A;  5K1C C;  3ZDZ A;  4Z7Q A;  3SBP A;  2VDO A;  5GMK n;  5FA5 B;  1MDA H;  5HYN B;  3OKY A;  3ODT A;  1E5T A;  3VI3 A;  4J81 A;  4NSX A;  4J87 A;  5EMJ B;  3A0F A;  3EI1 A;  1GXR A;  2H14 A;  4MMY A;  4JSP C;  2YBA A;  3I89 A;  3HFQ A;  4GGA A;  1U8C A;  5HE2 B;  4DNW A;  2J57 G;  3SJL D;  2H9M A;  2I3S A;  4H5J A;  3N0D A;  2VDN A;  3EWE A;  2VDM A;  3V5W B;  3IJ1 A;  2Q7Q A;  5FKT A;  3V7D B;  2B5N A;  5GSA A;  3IVM A;  4CY1 A;  4Z7O A;  1JTD B;  3OL2 B;  3EU7 A;  4I79 A;  4K3J B;  2UZY B;  3GD1 I;  4O45 A;  1JJU B;  4ZN4 A;  3K72 A;  4DNU A;  4JSV C;  4FA9 D;  2J55 H;  4A11 B;  3EI2 A;  5FKS A;  2CNX A;  3AL8 B;  2P9L C;  2AGZ A;  5SXM A;  3EI4 A;  5CXC B;  3IUM A;  3GC3 B;  4GQB B;  3EI2 B;  1H2W A;  2GC7 A;  4J0X A;  4GM8 A;  3DDU A;  3RLM D;  3JAM g;  3OKW A;  3BG0 A;  5C86 A;  5H14 A;  5C2V B;  2YB8 B;  4UM9 A;  2QZP A;  4AN0 A;  5EM2 A;  5M5U A;  2AQ5 A;  2G99 A;  2BBK H;  1VYH C;  3I7P A;  1S4U X;  1BPO A;  1C9I A;  2O9K A;  5M5R A;  1L5G A;  3K26 A;  4UM8 A;  1K3I A;  1TBG A;  1QFS A;  3DXM C;  4IRZ A;  4UI9 R;  3RRM C;  1O6G A;  1TYE A;  4BP8 A;  3MKS B;  1B9Y A;  5M5V A;  3I8E A;  4A09 B;  5EML B;  5FKR A;  2PBI B;  3J80 g;  4WK0 A;  2IAA A;  4CI1 A;  4A09 A;  5I5I A;  3AH8 B;  5GXH A;  3N0E A; 
#chains in the Genus database with same CATH homology
 2P9P C;  4CI8 A;  2HXC A;  4X60 B;  2H9P A;  5IGQ A;  1JMZ B;  2AGL A;  2GC4 A;  3FM0 A;  5EAR A;  3NVX A;  4PSX B;  3E0C A;  4JXM A;  4A2M A;  2YNP A;  1PI6 A;  2XU7 A;  3C5M A;  5THA A;  3AL8 A;  1FWX A;  3MMY A;  3SBR A;  2H13 A;  3PVU B;  1NEX B;  2XL2 A;  3MXX A;  4BH6 A;  4O9D A;  4L9O A;  4GGD A;  5HE0 B;  3SN6 B;  1PEV A;  3MZK A;  4ZOV A;  2OK4 A;  2IUP A;  3JRO A;  4IA9 A;  2OJY A;  2H3X A;  3I7H A;  3DSM A;  3RMZ D;  2IWK A;  2OVR B;  4XYI A;  1QNI A;  4BL0 A;  5IGO A;  5HQG A;  2UZX B;  4J73 A;  4O3U B;  4LGN A;  4ZOX A;  2CN3 A;  4FAV D;  2PM9 A;  3BG1 A;  3UKU C;  3F3G A;  4GGC A;  4JT6 C;  1PGU A;  4JSX C;  1XKS A;  5FXY A;  5TDH B;  4R7A B;  3VGZ A;  3EI3 B;  2P9N C;  1A0R B;  4PBY A;  3I7O A;  4QRJ A;  5EAM A;  3BWS A;  2CE8 A;  4A0B B;  4O3T B;  1N6E A;  5GXI A;  2I0S A;  4MK0 B;  1R5M A;  4AEZ A;  4GM9 A;  3UVL A;  1XHM A;  1SQJ A;  4J0W A;  4PNK B;  4A2L A;  1MG3 A;  3I7K A;  2AGW A;  5I5J A;  1GOT B;  4U1E I;  4AOW A;  3DXK C;  3C75 H;  3K27 A;  4LG9 A;  3MKQ A;  4PC0 A;  4FA4 D;  2G9A A;  4FAN D;  3B7F A;  1JOF A;  5EAL A;  3GFC A;  3EG6 A;  2H9L A;  4E5Z B;  2MTA H;  3EMH A;  4Y5R D;  1MG2 A;  2PM6 B;  5CYK A;  3L4O D;  3OW8 A;  4LG8 A;  3SMR A;  1U2V C;  3W15 A;  3OTT A;  5H17 A;  2TRC B;  4CZY A;  5AMS A;  3JZH A;  2HKR A;  4XEI C;  3U4Y A;  2IUR A;  4Y7R A;  3SXT D;  2XL3 A;  5IJ8 E;  5EAP A;  3MZL A;  3JZN A;  2H47 A;  2B5L A;  2Z2P A;  4FA1 D;  2P9K C;  3C99 A;  1OMW B;  4KFM B;  3SCY A;  4H5I A;  3ULE C;  3F3P A;  2Z2O A;  4XYH A;  3AFC A;  4G56 B;  4OWR A;  5C2W B;  2I3T A;  2CE9 A;  4A0A B;  1JMX B;  2YNN A;  2P9I C;  4ZOY A;  4L3H D;  5H1M A;  3UVO A;  1B9X A;  3RN1 D;  5IT9 g;  1N6F A;  2B5M A;  4D0K A;  3PSC B;  2H9N A;  4J77 A;  1P22 A;  3UKR C;  2AGY A;  3EI4 B;  3VA6 A;  5FKQ A;  4GQ2 P;  4J78 A;  3FRX A;  4FWW A;  4J8G A;  2B4E A;  4ZOZ A;  4GMB A;  3SWS D;  4L3G D;  4A08 B;  4Z8L A;  3IIY A;  2IUV A;  4A7J A;  3I2N A;  2IWF A;  3I7N A;  4GQ1 A;  4CC9 A;  3PXW D;  3NVN A;  1SHY B;  4FB1 D;  2IUQ A;  3DM0 A;  4D6V A;  5HE3 B;  5AJA A;  4TZ4 A;  5EM2 B;  1XIP A;  3PVW B;  5CXB A;  1PBY B;  2GNQ A;  2YMU A;  1ERJ A;  5FQD A;  5JWZ A;  4GM3 A;  4JSN C;  5CXB B;  4J82 A;  4BUJ C;  5KDO B;  3FGB A;  4A0A A;  1N6D A;  3JZG A;  4OZU A;  5CYK B;  4QT8 A;  1YFQ A;  2OVP B;  2I0R A;  4N14 A;  1K8K C;  2YNO A;  4J79 A;  4O1Q D;  3J81 g;  3UVN A;  5TEF A;  3KRX B;  3OL2 A;  5K19 A;  4CY5 A;  2EBS A;  4CZX A;  1TYQ C;  4FHL A;  3RFH A;  3JRP A;  2CO0 A;  4CI2 A;  3IJ0 A;  4PXW A;  2BCJ B;  4E54 B;  3V9F A;  3UVK A;  4A08 A;  1L0Q A;  3JPX A;  4GZ8 A;  1GP2 B;  3GRE A;  4X61 B;  3EI1 B;  4X63 B;  3C9C A;  5B4W A;  2AH0 A;  2CN2 A;  3I8C A;  2Z2N A;  2QXV A;  3P4F A;  3I7L A;  4JD2 C;  3PSL A;  1Q47 A;  2H6K A;  2HES X;  3IIW A;  3KRW B;  4E5Z A;  2AGX A;  2OK6 A;  3UR4 A;  1RI6 A;  4YVD A;  1U4C A;  5FLX g;  1GG2 B;  4QQE A;  3IKO A;  2P9U C;  1K32 A;  3L4M D;  3RSE C;  4L1Q D;  3PXS D;  4J8B A;  4PSW B;  4JT5 C;  2AH1 A;  2H68 A;  5CXC A;  5IC7 A;  4U7A A;  3IJC A;  4A0B A;  3SFZ A;  4HDJ A;  3SBQ A;  4K3I D;  3ZWL B;  3JB9 L;  3RN0 D;  2QC5 A;  1NR0 A;  2HJ4 A;  2XYI A;  3SHF A;  3RFG A;  4EWR A;  4E54 A;  3SLE D;  2HKM A;  3CFS B;  4IMM A;  5AFU 3;  1OLZ A;  4ERQ A;  3F3F A;  2J56 H;  2HJB A;  2PM7 B;  3PE7 A;  4ERY A;  3AL9 A;  4PBZ A;  4FA5 D;  3PXT D;  2I0T A;  5IJ7 E;  4CI3 A;  5I5M A;  4ES0 A;  3VH0 A;  3SVW D;  4ESG A;  2PM9 B;  4J84 A;  3UVM A;  4CY3 A;  3CFV A;  3NVQ A;  3CIK B;  5HE1 B;  2H6N A;  3ORV D;  4A11 A;  1SQ9 A;  2HYE A;  5C9Z B;  5A2Q g;  2H6Q A;  4QL1 A;  4CZV A;  3DWL C;  5TF2 A;  5TEE A;  2P9S C;  2W18 A;  4CY2 A;  5EMK B;  5EMM B;  3OKT A;  4J86 A;  3OKY B;  2OVQ B;  4X3E A;  4ERZ A;  2OIZ A;  2CO0 C;  3EI3 A;  5K1C C;  3SBP A;  5GMK n;  5FA5 B;  1MDA H;  5HYN B;  3OKY A;  3ODT A;  4J81 A;  4NSX A;  4J87 A;  5EMJ B;  3A0F A;  3EI1 A;  1GXR A;  2H14 A;  4JSP C;  2YBA A;  3I89 A;  3HFQ A;  4GGA A;  5HE2 B;  2J57 G;  3SJL D;  2H9M A;  2I3S A;  4H5J A;  3N0D A;  3EWE A;  3V5W B;  3IJ1 A;  2Q7Q A;  5FKT A;  3V7D B;  2B5N A;  5GSA A;  4CY1 A;  3OL2 B;  3EU7 A;  4I79 A;  4K3J B;  2UZY B;  4O45 A;  1JJU B;  4ZN4 A;  4JSV C;  4FA9 D;  2J55 H;  4A11 B;  3EI2 A;  5FKS A;  2CNX A;  3AL8 B;  2P9L C;  2AGZ A;  5SXM A;  3EI4 A;  5CXC B;  4GQB B;  3EI2 B;  2GC7 A;  4J0X A;  4GM8 A;  3RLM D;  3JAM g;  3OKW A;  3BG0 A;  5H14 A;  5C2V B;  2YB8 B;  5EM2 A;  2AQ5 A;  2G99 A;  2BBK H;  1VYH C;  3I7P A;  1S4U X;  2O9K A;  3K26 A;  1TBG A;  3DXM C;  4UI9 R;  3RRM C;  3MKS B;  1B9Y A;  3I8E A;  4A09 B;  5EML B;  5FKR A;  2PBI B;  3J80 g;  2IAA A;  4CI1 A;  4A09 A;  5I5I A;  3AH8 B;  5GXH A;  3N0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...