4ESGA

X-ray structure of wdr5-mll1 win motif peptide binary complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 104
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4esgA00
3OTTA 2OVRB 4U1EI 4U7AA 3PVUB 5KDOB 5H17A 1NR0A 3AFCA 5SXMA 3AL8B 2AGWA 4EWRA 2AH1A 2YNOA 3PXWD 4X60B 1JMZB 2I0SA 2B4EA 3I7NA 5GMKn 4J0XA 4L3HD 3AL9A 2QC5A 4J84A 5C2WB 4PBZA 3N0DA 5HE3B 5CXBB 2Z2NA 5IT9g 3UVOA 3P4FA 3EI3A 2AH0A 5CYKB 1Q47A 2IUPA 3EWEA 4XYHA 1K32A 4KFMB 5K19A 3C5MA 3MZKA 4G56B 3KRXB 3I7OA 3CFSB 3EI2A 3SCYA 3F3FA 3UVLA 3GREA 2J56H 2PM9A 3DXKC 5FXYA 3AH8B 1GG2B 1L0QA 5GXHA 3MZLA 1B9YA 2CNXA 3K27A 2XL2A 4A11B 1U2VC 2AGYA 4JT6C 3EU7A 3OW8A 4PC0A 4QQEA 1TYQC 1R5MA 2H14A 1NEXB 3UR4A 4E54A 2B5NA 4LGNA 4O9DA 5IJ8E 2P9NC 3JAMg 3OL2B 2G99A 1JJUB 4X63B 3JPXA 4O1QD 4JSVC 5TEEA 4L1QD 3IIYA 3MMYA 2H6KA 2OK4A 2YBAA 4J81A 4A0AB 5FKTA 3BG1A 4MK0B 4J87A 2XL3A 3VA6A 2XU7A 3IKOA 2CE8A 4IMMA 4A08A 3I7LA 2AGLA 4O45A 4H5JA 3J80g 4QT8A 4QRJA 1ERJA 2HJ4A 4ESGA 3W15A 4CZVA 4FA4D 4BH6A 4PSXB 5FKRA 4AOWA 4R7AB 2H9PA 3I8CA 3UKUC 3MKQA 3EI1A 4XYIA 3IJ1A 3SN6B 3N0EA 2PM6B 2YNPA 1SQJA 4YVDA 5IGOA 2HXCA 3RLMD 1B9XA 5I5MA 5C9ZB 2H6QA 4A0BB 2AGXA 5HE2B 4JSPC 2HKMA 2H6NA 4BL0A 3DXMC 2IAAA 4CZYA 2H9MA 3FM0A 3DWLC 3SMRA 3U4YA 3EI3B 1OLZA 4PSWB 4GZ8A 4JSNC 4OWRA 3IJCA 3ZWLB 4K3ID 1PGUA 5EM2A 4A09A 3EI4B 1P22A 2CE9A 3RSEC 4A7JA 2PM9B 3I7PA 1FWXA 3MKSB 4JSXC 3I7KA 3PE7A 5K1CC 4D0KA 5H1MA 4ZOYA 3F3GA 4UI9R 3RFGA 3RFHA 2BCJB 2OJYA 4XEIC 1RI6A 4CY2A 5EARA 3GFCA 2CN3A 3MXXA 2G9AA 4TZ4A 3SHFA 4PXWA 5FQDA 4I79A 4FB1D 2OIZA 2H9LA 4E54B 2I3SA 4NSXA 1SHYB 3FGBA 2UZYB 2IWFA 5CXCA 2UZXB 3NVXA 4J8BA 3OKYA 4ZOZA 3SLED 4J77A 3K26A 3VGZA 4CC9A 4FWWA 4N14A 4LG9A 3FRXA 4LG8A 3BG0A 3UVNA 1XKSA 4ERQA 3IIWA 2BBKH 1JOFA 4ZOVA 3V5WB 1YFQA 1PEVA 4JXMA 5EALA 2P9LC 2HKRA 4FHLA 5H14A 3EG6A 4FA5D 4J82A 4CI3A 4Z8LA 4A08B 2O9KA 2P9IC 3CFVA 5AMSA 4JT5C 4PBYA 4FAVD 3ULEC 3PVWB 3I89A 4GGCA 1N6DA 3KRWB 1N6EA 4J0WA 3F3PA 5GSAA 4HDJA 3I8EA 2I0RA 3B7FA 3C75H 2IUVA 4O3UB 3EI1B 5AFU3 1MG3A 4ZN4A 2B5LA 1K8KC 2H47A 3PSCB 3C9CA 1MDAH 2P9SC 4L9OA 5EMLB 5FLXg 2P9PC 3SBRA 3HFQA 2H9NA 4A2MA 3SVWD 4H5IA 4J73A 2Q7QA 2XYIA 3NVQA 5TF2A 5JWZA 4FAND 5EAMA 4J86A 4QL1A 2CO0A 3JRPA 4A09B 4J8GA 2IURA 4ERZA 2TRCB 2PM7B 5THAA 4GQBB 1PI6A 3IJ0A 3A0FA 4AEZA 3UVKA 2CO0C 3UVMA 3OKWA 3J81g 2H3XA 4E5ZA 3V7DB 4J79A 3EI2B 4O3TB 2P9UC 3E0CA 2Z2OA 3C99A 1S4UX 4J78A 5I5JA 2OVPB 5IJ7E 5B4WA 4GQ1A 2J57G 4GQ2P 1OMWB 3BWSA 5EMKB 5HQGA 2YB8B 5I5IA 3SBQA 2GC4A 4Y7RA 4A0BA 1GOTB 3AL8A 4ES0A 4Y5RD 5CXCB 3OKTA 5TDHB 4GGDA 3PXSD 4CI8A 5EMJB 2YNNA 3OKYB 3ODTA 2AQ5A 4GM3A 3DM0A 2PBIB 5HE0B 4GGAA 5HYNB 5C2VB 3EMHA 3DSMA 2I3TA 5CXBA 3SJLD 3UKRC 3RMZD 3V9FA 3EI4A 2IWKA 3JZGA 2B5MA 2MTAH 4CY3A 4JD2C 5CYKA 3I2NA 4FA1D 1XHMA 3SFZA 3RN1D 1N6FA 3JZHA 2W18A 4CZXA 1A0RB 4CY5A 5HE1B 1PBYB 3ORVD 4L3GD 2HESX 4ZOXA 3PSLA 2H68A 5FKSA 1TBGA 5IGQA 3PXTD 4X3EA 1QNIA 4A11A 2OVQB 3RN0D 1SQ9A 1XIPA 2OK6A 2GNQA 4X61B 2GC7A 3JROA 5EAPA 2P9KC 5TEFA 2Z2PA 1GXRA 3SXTD 2QXVA 3OL2A 5A2Qg 2HYEA 5FA5B 3L4OD 3VH0A 3CIKB 3RRMC 4CY1A 2EBSA 4CI1A 4PNKB 2AGZA 2J55H 3SWSD 4GM8A 4A2LA 3JZNA 2IUQA 3L4MD 2CN2A 4FA9D 4GM9A 3I7HA 4CI2A 3JB9L 1MG2A 3SBPA 1U4CA 4A0AA 4BUJC 1VYHC 4E5ZB 2I0TA 4K3JB 5FKQA 5GXIA 5EM2B 5EMMB 5IC7A 4GMBA 2H13A 2YMUA 1GP2B 3NVNA 4OZUA 1JMXB 4IA9A 2HJBA 4D6VA 4ERYA 5AJAA
chains in the Genus database with same CATH superfamily
3OTTA 2OVRB 4U1EI 4U7AA 3PVUB 5FFGA 5KDOB 5H17A 1NR0A 3AFCA 5SXMA 3AL8B 2AGWA 3NIFA 4EWRA 2AH1A 2YNOA 3PXWD 2VZ3A 4X60B 1JMZB 2I0SA 2B4EA 3I7NA 5GMKn 4J0XA 4L3HD 4G1MA 3AL9A 2EICA 2QC5A 4J84A 2EIBA 5C2WB 4PBZA 3K72A 3N0DA 5HE3B 5CXBB 2Z2NA 4MMXA 4WK4A 5IT9g 3QHYB 3UVOA 3P4FA 3IUJA 3EI3A 2QR5A 2AH0A 5CYKB 1Q47A 2IUPA 3EWEA 4XYHA 1K32A 4KFMB 5K19A 3C5MA 3MZKA 4G56B 3KRXB 3I7OA 3CFSB 4BCDA 1E5TA 3GD1I 3EI2A 1T2XA 3F3FA 3SCYA 3UVLA 3GREA 2J56H 2PM9A 3DXKC 1O6GA 5FXYA 3AH8B 4O2WA 1GG2B 1L0QA 2EIDA 1UTCA 3QI0A 1VE6A 5GXHA 3MZLA 1B9YA 2CNXA 3K27A 2XL2A 4A11B 1U2VC 2AGYA 4Z7NA 4JT6C 4BP8A 3EU7A 3OW8A 3IURA 4NAAA 4PC0A 4QQEA 1TYQC 1R5MA 2H14A 1NEXB 3UR4A 4E54A 2B5NA 4LGNA 4O9DA 5IJ8E 2P9NC 3JAMg 3OL2B 2G99A 1JJUB 4X63B 1L5GA 2HU8A 1UOQA 3JPXA 4O1QD 4JSVC 5TEEA 4L1QD 3IIYA 4RE5A 4BP9A 3MMYA 2H6KA 1VZ3A 2OK4A 3V4VA 2YBAA 4J81A 4AN0A 4A0AB 5FKTA 3DDUA 3BG1A 4NC4A 4MK0B 2BKLA 4J87A 2XL3A 3VA6A 2XU7A 3IKOA 2CE8A 4IMMA 4DNUA 4IRZA 3IUQA 4A08A 3I7LA 2AGLA 3O4JA 3IUNA 3O4IA 1K3IA 4O45A 3EQ7A 4H5JA 3MUOA 3J80g 4QT8A 4QRJA 1ERJA 2HJ4A 4ESGA 3W15A 4CZVA 4FA4D 4BH6A 4PSXB 5FKRA 4MMZA 3NIDA 4AOWA 1U8CA 4MMYA 4R7AB 2H9PA 3I8CA 3UKUC 5M5SA 5E6UA 3MKQA 3EI1A 1C9IA 4XYIA 3IJ1A 3SN6B 3N0EA 2PM6B 2YNPA 1SQJA 4YVDA 5IGOA 2HXCA 3RLMD 1B9XA 5I5MA 4L1MA 5C9ZB 3NIGA 2H6QA 4A0BB 2AGXA 2VDQA 5HE2B 4JSPC 1JV2A 2HKMA 2H6NA 4WJKA 4BL0A 2WQ8A 3DXMC 2IAAA 2XE4A 4CZYA 2H9MA 3FM0A 1M1XA 3DWLC 3SMRA 3U4YA 3EI3B 3K71A 1OLZA 4PSWB 4GZ8A 4G55A 4JSNC 4OWRA 4D9SA 3IJCA 1GOGA 3ZWLB 2VDKA 4K3ID 1PGUA 5EM2A 4A09A 3EI4B 1P22A 2CE9A 3RSEC 3ZDYA 4A7JA 2PM9B 3I7PA 1FWXA 4WK0A 3MKSB 4JSXC 3I7KA 3PE7A 5FFOA 5K1CC 4D0KA 5H1MA 4ZOYA 3F3GA 4UI9R 3RFGA 3RFHA 2BCJB 2OJYA 4XEIC 1RI6A 4AX4A 4CY2A 5EARA 4O02A 3GFCA 2CN3A 3MXXA 2G9AA 4TZ4A 3SHFA 3O4GA 4PXWA 5FQDA 4I79A 4FB1D 3K6SA 2OIZA 2H9LA 3IJEA 4E54B 1A12A 2I3SA 4JHPC 4NSXA 5HDBA 5M5VA 1SHYB 3FGBA 2UZYB 2IWFA 5CXCA 5M5TA 2UZXB 2VDMA 3NVXA 4J8BA 3OKYA 4ZOZA 3SLED 4J77A 3K26A 3VGZA 3FCUA 4CC9A 4DNVA 4FWWA 4LG9A 4N14A 3FRXA 4LG8A 3BG0A 3UVNA 4AN1A 1BPOA 1XKSA 3ZE2A 4ERQA 3IIWA 2BBKH 1JOFA 2VZ1A 4ZOVA 3V5WB 1YFQA 1PEVA 4JXMA 5EALA 2P9LC 3MVDK 2HKRA 4FHLA 1QFMA 2VDPA 5H14A 1UOOA 3EG6A 4FA5D 4J82A 4CI3A 4Z8LA 4A08B 2O9KA 2P9IC 3CFVA 1TYEA 5AMSA 4JT5C 4DNWA 4PBYA 4UM8A 4FAVD 3ULEC 3PVWB 3I89A 3VI4A 4GGCA 1N6DA 3KRWB 1O6FA 3OF7A 1VZ2A 1N6EA 4J0WA 3F3PA 5GSAA 4HDJA 3I8EA 2I0RA 3B7FA 2XDWA 3C75H 2IUVA 4O3UB 3EI1B 4QAMA 3ZDXA 3T3MA 5AFU3 2VDOA 1MG3A 2EIEA 4Z7QA 4ZN4A 3O4HA 2B5LA 3ZE0A 1K8KC 2H47A 3PSCB 3C9CA 1MDAH 2P9SC 4L9OA 5M5UA 5EMLB 3EQ8A 5FLXg 2P9PC 3SBRA 3HFQA 2H9NA 2XZGA 3KCIA 5E6SA 4A2MA 3SVWD 4H5IA 4J73A 2Q7QA 2XYIA 3NVQA 5TF2A 3ZE1A 5JWZA 4FAND 1YR2A 5EAMA 4J86A 4QL1A 2CO0A 3IUMA 3JRPA 4WK2A 5C86A 4A09B 4J8GA 2IURA 4ERZA 2TRCB 2PM7B 5THAA 4GQBB 1PI6A 3IJ0A 3A0FA 4AEZA 3UVKA 2CO0C 3UVMA 3OKWA 3J81g 2H3XA 3MUNA 4E5ZA 3V7DB 2JKXA 2VDNA 3IULA 4AMZA 4J79A 3EI2B 4O3TB 2P9UC 3VI3A 3E0CA 2Z2OA 3C99A 1S4UX 4J78A 5I5JA 2OVPB 5IJ7E 5B4WA 4GQ1A 2J57G 4GQ2P 1OMWB 3BWSA 5EMKB 5HQGA 2YB8B 5I5IA 4NENA 3SBQA 2GC4A 4Y7RA 4A0BA 1GOTB 3AL8A 4ES0A 4Y5RD 5CXCB 3OKTA 5TDHB 4GGDA 3PXSD 1H2XA 4CI8A 5EMJB 1I2MB 2YNNA 3OKYB 3ODTA 4RE6A 1C9LA 2AQ5A 4GM3A 4BCCA 3DM0A 2PBIB 5HE0B 4GGAA 5HYNB 5C2VB 4AMYA 3EMHA 3DSMA 2I3TA 3IVMA 5CXBA 3SJLD 3UKRC 3RMZD 3V9FA 3EI4A 2IWKA 3JZGA 2B5MA 4G1EA 2MTAH 4CY3A 4JD2C 5CYKA 3I2NA 4Z7OA 4FA1D 1JTDB 1GOHA 1XHMA 3SFZA 3RN1D 5M61A 1N6FA 3JZHA 2W18A 4CZXA 1A0RB 4CY5A 5HE1B 1PBYB 2VC2A 3ORVD 4L3GD 2HESX 4ZOXA 4UM9A 3PSLA 1H2ZA 2H68A 2HU7A 3T3PA 5FKSA 1TBGA 5IGQA 1H2YA 3PXTD 1VE7A 4X3EA 1QNIA 4A11A 2OVQB 3RN0D 1SQ9A 1H2WA 1XIPA 2OK6A 5M5RA 2GNQA 4X61B 2GC7A 3JROA 5EAPA 3GC3B 2P9KC 5TEFA 4NBMA 2Z2PA 1GXRA 3SXTD 2QXVA 3OL2A 5A2Qg 2HYEA 1GOFA 2VDRA 3EQ9A 5FA5B 3L4OD 3VH0A 3CIKB 3RRMC 4CY1A 2EBSA 4CI1A 4PNKB 2AGZA 2J55H 2QZPA 3SWSD 4GM8A 5E6RA 4A2LA 3JZNA 2IUQA 3L4MD 2CN2A 2HU5A 4FA9D 4GM9A 1QFSA 3I7HA 4CI2A 3JB9L 1MG2A 3SBPA 1U4CA 4A0AA 5C92A 4BUJC 1VYHC 4E5ZB 2I0TA 3FCSA 4JHNA 4K3JB 4BCBA 1UOPA 5FKQA 5EM2B 5GXIA 5EMMB 5IC7A 4GMBA 1E8NA 2H13A 2YMUA 1GP2B 3NVNA 2VDLA 4OZUA 3ZDZA 1E8MA 1JMXB 3V4PA 4IA9A 2HJBA 4D6VA 4ERYA 5AJAA
chains in the Genus database with same CATH topology
3OTTA 2OVRB 4U1EI 4U7AA 3PVUB 5KDOB 5H17A 1NR0A 3AFCA 5SXMA 3AL8B 2AGWA 4EWRA 2AH1A 2YNOA 3PXWD 4X60B 1JMZB 2I0SA 2B4EA 3I7NA 5GMKn 4J0XA 4L3HD 3AL9A 2QC5A 4J84A 5C2WB 4PBZA 3N0DA 5HE3B 5CXBB 2Z2NA 5IT9g 3UVOA 3P4FA 3EI3A 2AH0A 5CYKB 1Q47A 2IUPA 3EWEA 4XYHA 1K32A 4KFMB 5K19A 3C5MA 3MZKA 4G56B 3KRXB 3I7OA 3CFSB 3EI2A 3SCYA 3F3FA 3UVLA 3GREA 2J56H 2PM9A 3DXKC 5FXYA 3AH8B 1GG2B 1L0QA 5GXHA 3MZLA 1B9YA 2CNXA 3K27A 2XL2A 4A11B 1U2VC 2AGYA 4JT6C 3EU7A 3OW8A 4PC0A 4QQEA 1TYQC 1R5MA 2H14A 1NEXB 3UR4A 4E54A 2B5NA 4LGNA 4O9DA 5IJ8E 2P9NC 3JAMg 3OL2B 2G99A 1JJUB 4X63B 3JPXA 4O1QD 4JSVC 5TEEA 4L1QD 3IIYA 3MMYA 2H6KA 2OK4A 2YBAA 4J81A 4A0AB 5FKTA 3BG1A 4MK0B 4J87A 2XL3A 3VA6A 2XU7A 3IKOA 2CE8A 4IMMA 4A08A 3I7LA 2AGLA 4O45A 4H5JA 3J80g 4QT8A 4QRJA 1ERJA 2HJ4A 4ESGA 3W15A 4CZVA 4FA4D 4BH6A 4PSXB 5FKRA 4AOWA 4R7AB 2H9PA 3I8CA 3UKUC 3MKQA 3EI1A 4XYIA 3IJ1A 3SN6B 3N0EA 2PM6B 2YNPA 1SQJA 4YVDA 5IGOA 2HXCA 3RLMD 1B9XA 5I5MA 5C9ZB 2H6QA 4A0BB 2AGXA 5HE2B 4JSPC 2HKMA 2H6NA 4BL0A 3DXMC 2IAAA 4CZYA 2H9MA 3FM0A 3DWLC 3SMRA 3U4YA 3EI3B 1OLZA 4PSWB 4GZ8A 4JSNC 4OWRA 3IJCA 3ZWLB 4K3ID 1PGUA 5EM2A 4A09A 3EI4B 1P22A 2CE9A 3RSEC 4A7JA 2PM9B 3I7PA 1FWXA 3MKSB 4JSXC 3I7KA 3PE7A 5K1CC 4D0KA 5H1MA 4ZOYA 3F3GA 4UI9R 3RFGA 3RFHA 2BCJB 2OJYA 4XEIC 1RI6A 4CY2A 5EARA 3GFCA 2CN3A 3MXXA 2G9AA 4TZ4A 3SHFA 4PXWA 5FQDA 4I79A 4FB1D 2OIZA 2H9LA 4E54B 2I3SA 4NSXA 1SHYB 3FGBA 2UZYB 2IWFA 5CXCA 2UZXB 3NVXA 4J8BA 3OKYA 4ZOZA 3SLED 4J77A 3K26A 3VGZA 4CC9A 4FWWA 4N14A 4LG9A 3FRXA 4LG8A 3BG0A 3UVNA 1XKSA 4ERQA 3IIWA 2BBKH 1JOFA 4ZOVA 3V5WB 1YFQA 1PEVA 4JXMA 5EALA 2P9LC 2HKRA 4FHLA 5H14A 3EG6A 4FA5D 4J82A 4CI3A 4Z8LA 4A08B 2O9KA 2P9IC 3CFVA 5AMSA 4JT5C 4PBYA 4FAVD 3ULEC 3PVWB 3I89A 4GGCA 1N6DA 3KRWB 1N6EA 4J0WA 3F3PA 5GSAA 4HDJA 3I8EA 2I0RA 3B7FA 3C75H 2IUVA 4O3UB 3EI1B 5AFU3 1MG3A 4ZN4A 2B5LA 1K8KC 2H47A 3PSCB 3C9CA 1MDAH 2P9SC 4L9OA 5EMLB 5FLXg 2P9PC 3SBRA 3HFQA 2H9NA 4A2MA 3SVWD 4H5IA 4J73A 2Q7QA 2XYIA 3NVQA 5TF2A 5JWZA 4FAND 5EAMA 4J86A 4QL1A 2CO0A 3JRPA 4A09B 4J8GA 2IURA 4ERZA 2TRCB 2PM7B 5THAA 4GQBB 1PI6A 3IJ0A 3A0FA 4AEZA 3UVKA 2CO0C 3UVMA 3OKWA 3J81g 2H3XA 4E5ZA 3V7DB 4J79A 3EI2B 4O3TB 2P9UC 3E0CA 2Z2OA 3C99A 1S4UX 4J78A 5I5JA 2OVPB 5IJ7E 5B4WA 4GQ1A 2J57G 4GQ2P 1OMWB 3BWSA 5EMKB 5HQGA 2YB8B 5I5IA 3SBQA 2GC4A 4Y7RA 4A0BA 1GOTB 3AL8A 4ES0A 4Y5RD 5CXCB 3OKTA 5TDHB 4GGDA 3PXSD 4CI8A 5EMJB 2YNNA 3OKYB 3ODTA 2AQ5A 4GM3A 3DM0A 2PBIB 5HE0B 4GGAA 5HYNB 5C2VB 3EMHA 3DSMA 2I3TA 5CXBA 3SJLD 3UKRC 3RMZD 3V9FA 3EI4A 2IWKA 3JZGA 2B5MA 2MTAH 4CY3A 4JD2C 5CYKA 3I2NA 4FA1D 1XHMA 3SFZA 3RN1D 1N6FA 3JZHA 2W18A 4CZXA 1A0RB 4CY5A 5HE1B 1PBYB 3ORVD 4L3GD 2HESX 4ZOXA 3PSLA 2H68A 5FKSA 1TBGA 5IGQA 3PXTD 4X3EA 1QNIA 4A11A 2OVQB 3RN0D 1SQ9A 1XIPA 2OK6A 2GNQA 4X61B 2GC7A 3JROA 5EAPA 2P9KC 5TEFA 2Z2PA 1GXRA 3SXTD 2QXVA 3OL2A 5A2Qg 2HYEA 5FA5B 3L4OD 3VH0A 3CIKB 3RRMC 4CY1A 2EBSA 4CI1A 4PNKB 2AGZA 2J55H 3SWSD 4GM8A 4A2LA 3JZNA 2IUQA 3L4MD 2CN2A 4FA9D 4GM9A 3I7HA 4CI2A 3JB9L 1MG2A 3SBPA 1U4CA 4A0AA 4BUJC 1VYHC 4E5ZB 2I0TA 4K3JB 5FKQA 5GXIA 5EM2B 5EMMB 5IC7A 4GMBA 2H13A 2YMUA 1GP2B 3NVNA 4OZUA 1JMXB 4IA9A 2HJBA 4D6VA 4ERYA 5AJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTT A;  2OVR B;  4U1E I;  4U7A A;  3PVU B;  5KDO B;  5H17 A;  1NR0 A;  3AFC A;  5SXM A;  3AL8 B;  2AGW A;  4EWR A;  2AH1 A;  2YNO A;  3PXW D;  4X60 B;  1JMZ B;  2I0S A;  2B4E A;  3I7N A;  5GMK n;  4J0X A;  4L3H D;  3AL9 A;  2QC5 A;  4J84 A;  5C2W B;  4PBZ A;  3N0D A;  5HE3 B;  5CXB B;  2Z2N A;  5IT9 g;  3UVO A;  3P4F A;  3EI3 A;  2AH0 A;  5CYK B;  1Q47 A;  2IUP A;  3EWE A;  4XYH A;  1K32 A;  4KFM B;  5K19 A;  3C5M A;  3MZK A;  4G56 B;  3KRX B;  3I7O A;  3CFS B;  3EI2 A;  3SCY A;  3F3F A;  3UVL A;  3GRE A;  2J56 H;  2PM9 A;  3DXK C;  5FXY A;  3AH8 B;  1GG2 B;  1L0Q A;  5GXH A;  3MZL A;  1B9Y A;  2CNX A;  3K27 A;  2XL2 A;  4A11 B;  1U2V C;  2AGY A;  4JT6 C;  3EU7 A;  3OW8 A;  4PC0 A;  4QQE A;  1TYQ C;  1R5M A;  2H14 A;  1NEX B;  3UR4 A;  4E54 A;  2B5N A;  4LGN A;  4O9D A;  5IJ8 E;  2P9N C;  3JAM g;  3OL2 B;  2G99 A;  1JJU B;  4X63 B;  3JPX A;  4O1Q D;  4JSV C;  5TEE A;  4L1Q D;  3IIY A;  3MMY A;  2H6K A;  2OK4 A;  2YBA A;  4J81 A;  4A0A B;  5FKT A;  3BG1 A;  4MK0 B;  4J87 A;  2XL3 A;  3VA6 A;  2XU7 A;  3IKO A;  2CE8 A;  4IMM A;  4A08 A;  3I7L A;  2AGL A;  4O45 A;  4H5J A;  3J80 g;  4QT8 A;  4QRJ A;  1ERJ A;  2HJ4 A;  4ESG A;  3W15 A;  4CZV A;  4FA4 D;  4BH6 A;  4PSX B;  5FKR A;  4AOW A;  4R7A B;  2H9P A;  3I8C A;  3UKU C;  3MKQ A;  3EI1 A;  4XYI A;  3IJ1 A;  3SN6 B;  3N0E A;  2PM6 B;  2YNP A;  1SQJ A;  4YVD A;  5IGO A;  2HXC A;  3RLM D;  1B9X A;  5I5M A;  5C9Z B;  2H6Q A;  4A0B B;  2AGX A;  5HE2 B;  4JSP C;  2HKM A;  2H6N A;  4BL0 A;  3DXM C;  2IAA A;  4CZY A;  2H9M A;  3FM0 A;  3DWL C;  3SMR A;  3U4Y A;  3EI3 B;  1OLZ A;  4PSW B;  4GZ8 A;  4JSN C;  4OWR A;  3IJC A;  3ZWL B;  4K3I D;  1PGU A;  5EM2 A;  4A09 A;  3EI4 B;  1P22 A;  2CE9 A;  3RSE C;  4A7J A;  2PM9 B;  3I7P A;  1FWX A;  3MKS B;  4JSX C;  3I7K A;  3PE7 A;  5K1C C;  4D0K A;  5H1M A;  4ZOY A;  3F3G A;  4UI9 R;  3RFG A;  3RFH A;  2BCJ B;  2OJY A;  4XEI C;  1RI6 A;  4CY2 A;  5EAR A;  3GFC A;  2CN3 A;  3MXX A;  2G9A A;  4TZ4 A;  3SHF A;  4PXW A;  5FQD A;  4I79 A;  4FB1 D;  2OIZ A;  2H9L A;  4E54 B;  2I3S A;  4NSX A;  1SHY B;  3FGB A;  2UZY B;  2IWF A;  5CXC A;  2UZX B;  3NVX A;  4J8B A;  3OKY A;  4ZOZ A;  3SLE D;  4J77 A;  3K26 A;  3VGZ A;  4CC9 A;  4FWW A;  4N14 A;  4LG9 A;  3FRX A;  4LG8 A;  3BG0 A;  3UVN A;  1XKS A;  4ERQ A;  3IIW A;  2BBK H;  1JOF A;  4ZOV A;  3V5W B;  1YFQ A;  1PEV A;  4JXM A;  5EAL A;  2P9L C;  2HKR A;  4FHL A;  5H14 A;  3EG6 A;  4FA5 D;  4J82 A;  4CI3 A;  4Z8L A;  4A08 B;  2O9K A;  2P9I C;  3CFV A;  5AMS A;  4JT5 C;  4PBY A;  4FAV D;  3ULE C;  3PVW B;  3I89 A;  4GGC A;  1N6D A;  3KRW B;  1N6E A;  4J0W A;  3F3P A;  5GSA A;  4HDJ A;  3I8E A;  2I0R A;  3B7F A;  3C75 H;  2IUV A;  4O3U B;  3EI1 B;  5AFU 3;  1MG3 A;  4ZN4 A;  2B5L A;  1K8K C;  2H47 A;  3PSC B;  3C9C A;  1MDA H;  2P9S C;  4L9O A;  5EML B;  5FLX g;  2P9P C;  3SBR A;  3HFQ A;  2H9N A;  4A2M A;  3SVW D;  4H5I A;  4J73 A;  2Q7Q A;  2XYI A;  3NVQ A;  5TF2 A;  5JWZ A;  4FAN D;  5EAM A;  4J86 A;  4QL1 A;  2CO0 A;  3JRP A;  4A09 B;  4J8G A;  2IUR A;  4ERZ A;  2TRC B;  2PM7 B;  5THA A;  4GQB B;  1PI6 A;  3IJ0 A;  3A0F A;  4AEZ A;  3UVK A;  2CO0 C;  3UVM A;  3OKW A;  3J81 g;  2H3X A;  4E5Z A;  3V7D B;  4J79 A;  3EI2 B;  4O3T B;  2P9U C;  3E0C A;  2Z2O A;  3C99 A;  1S4U X;  4J78 A;  5I5J A;  2OVP B;  5IJ7 E;  5B4W A;  4GQ1 A;  2J57 G;  4GQ2 P;  1OMW B;  3BWS A;  5EMK B;  5HQG A;  2YB8 B;  5I5I A;  3SBQ A;  2GC4 A;  4Y7R A;  4A0B A;  1GOT B;  3AL8 A;  4ES0 A;  4Y5R D;  5CXC B;  3OKT A;  5TDH B;  4GGD A;  3PXS D;  4CI8 A;  5EMJ B;  2YNN A;  3OKY B;  3ODT A;  2AQ5 A;  4GM3 A;  3DM0 A;  2PBI B;  5HE0 B;  4GGA A;  5HYN B;  5C2V B;  3EMH A;  3DSM A;  2I3T A;  5CXB A;  3SJL D;  3UKR C;  3RMZ D;  3V9F A;  3EI4 A;  2IWK A;  3JZG A;  2B5M A;  2MTA H;  4CY3 A;  4JD2 C;  5CYK A;  3I2N A;  4FA1 D;  1XHM A;  3SFZ A;  3RN1 D;  1N6F A;  3JZH A;  2W18 A;  4CZX A;  1A0R B;  4CY5 A;  5HE1 B;  1PBY B;  3ORV D;  4L3G D;  2HES X;  4ZOX A;  3PSL A;  2H68 A;  5FKS A;  1TBG A;  5IGQ A;  3PXT D;  4X3E A;  1QNI A;  4A11 A;  2OVQ B;  3RN0 D;  1SQ9 A;  1XIP A;  2OK6 A;  2GNQ A;  4X61 B;  2GC7 A;  3JRO A;  5EAP A;  2P9K C;  5TEF A;  2Z2P A;  1GXR A;  3SXT D;  2QXV A;  3OL2 A;  5A2Q g;  2HYE A;  5FA5 B;  3L4O D;  3VH0 A;  3CIK B;  3RRM C;  4CY1 A;  2EBS A;  4CI1 A;  4PNK B;  2AGZ A;  2J55 H;  3SWS D;  4GM8 A;  4A2L A;  3JZN A;  2IUQ A;  3L4M D;  2CN2 A;  4FA9 D;  4GM9 A;  3I7H A;  4CI2 A;  3JB9 L;  1MG2 A;  3SBP A;  1U4C A;  4A0A A;  4BUJ C;  1VYH C;  4E5Z B;  2I0T A;  4K3J B;  5FKQ A;  5GXI A;  5EM2 B;  5EMM B;  5IC7 A;  4GMB A;  2H13 A;  2YMU A;  1GP2 B;  3NVN A;  4OZU A;  1JMX B;  4IA9 A;  2HJB A;  4D6V A;  4ERY A;  5AJA A; 
#chains in the Genus database with same CATH topology
 3OTT A;  2OVR B;  4U1E I;  4U7A A;  3PVU B;  5FFG A;  5KDO B;  5H17 A;  1NR0 A;  3AFC A;  5SXM A;  3AL8 B;  2AGW A;  3NIF A;  4EWR A;  2AH1 A;  2YNO A;  3PXW D;  2VZ3 A;  4X60 B;  1JMZ B;  2I0S A;  2B4E A;  3I7N A;  5GMK n;  4J0X A;  4L3H D;  4G1M A;  3AL9 A;  2EIC A;  2QC5 A;  4J84 A;  2EIB A;  5C2W B;  4PBZ A;  3K72 A;  3N0D A;  5HE3 B;  5CXB B;  2Z2N A;  4MMX A;  4WK4 A;  5IT9 g;  3QHY B;  3UVO A;  3P4F A;  3IUJ A;  3EI3 A;  2QR5 A;  2AH0 A;  5CYK B;  1Q47 A;  2IUP A;  3EWE A;  4XYH A;  1K32 A;  4KFM B;  5K19 A;  3C5M A;  3MZK A;  4G56 B;  3KRX B;  3I7O A;  3CFS B;  4BCD A;  1E5T A;  3GD1 I;  3EI2 A;  1T2X A;  3F3F A;  3SCY A;  3UVL A;  3GRE A;  2J56 H;  2PM9 A;  3DXK C;  1O6G A;  5FXY A;  3AH8 B;  4O2W A;  1GG2 B;  1L0Q A;  2EID A;  1UTC A;  3QI0 A;  1VE6 A;  5GXH A;  3MZL A;  1B9Y A;  2CNX A;  3K27 A;  2XL2 A;  4A11 B;  1U2V C;  2AGY A;  4Z7N A;  4JT6 C;  4BP8 A;  3EU7 A;  3OW8 A;  3IUR A;  4NAA A;  4PC0 A;  4QQE A;  1TYQ C;  1R5M A;  2H14 A;  1NEX B;  3UR4 A;  4E54 A;  2B5N A;  4LGN A;  4O9D A;  5IJ8 E;  2P9N C;  3JAM g;  3OL2 B;  2G99 A;  1JJU B;  4X63 B;  1L5G A;  2HU8 A;  1UOQ A;  3JPX A;  4O1Q D;  4JSV C;  5TEE A;  4L1Q D;  3IIY A;  4RE5 A;  4BP9 A;  3MMY A;  2H6K A;  1VZ3 A;  2OK4 A;  3V4V A;  2YBA A;  4J81 A;  4AN0 A;  4A0A B;  5FKT A;  3DDU A;  3BG1 A;  4NC4 A;  4MK0 B;  2BKL A;  4J87 A;  2XL3 A;  3VA6 A;  2XU7 A;  3IKO A;  2CE8 A;  4IMM A;  4DNU A;  4IRZ A;  3IUQ A;  4A08 A;  3I7L A;  2AGL A;  3O4J A;  3IUN A;  3O4I A;  1K3I A;  4O45 A;  3EQ7 A;  4H5J A;  3MUO A;  3J80 g;  4QT8 A;  4QRJ A;  1ERJ A;  2HJ4 A;  4ESG A;  3W15 A;  4CZV A;  4FA4 D;  4BH6 A;  4PSX B;  5FKR A;  4MMZ A;  3NID A;  4AOW A;  1U8C A;  4MMY A;  4R7A B;  2H9P A;  3I8C A;  3UKU C;  5M5S A;  5E6U A;  3MKQ A;  3EI1 A;  1C9I A;  4XYI A;  3IJ1 A;  3SN6 B;  3N0E A;  2PM6 B;  2YNP A;  1SQJ A;  4YVD A;  5IGO A;  2HXC A;  3RLM D;  1B9X A;  5I5M A;  4L1M A;  5C9Z B;  3NIG A;  2H6Q A;  4A0B B;  2AGX A;  2VDQ A;  5HE2 B;  4JSP C;  1JV2 A;  2HKM A;  2H6N A;  4WJK A;  4BL0 A;  2WQ8 A;  3DXM C;  2IAA A;  2XE4 A;  4CZY A;  2H9M A;  3FM0 A;  1M1X A;  3DWL C;  3SMR A;  3U4Y A;  3EI3 B;  3K71 A;  1OLZ A;  4PSW B;  4GZ8 A;  4G55 A;  4JSN C;  4OWR A;  4D9S A;  3IJC A;  1GOG A;  3ZWL B;  2VDK A;  4K3I D;  1PGU A;  5EM2 A;  4A09 A;  3EI4 B;  1P22 A;  2CE9 A;  3RSE C;  3ZDY A;  4A7J A;  2PM9 B;  3I7P A;  1FWX A;  4WK0 A;  3MKS B;  4JSX C;  3I7K A;  3PE7 A;  5FFO A;  5K1C C;  4D0K A;  5H1M A;  4ZOY A;  3F3G A;  4UI9 R;  3RFG A;  3RFH A;  2BCJ B;  2OJY A;  4XEI C;  1RI6 A;  4AX4 A;  4CY2 A;  5EAR A;  4O02 A;  3GFC A;  2CN3 A;  3MXX A;  2G9A A;  4TZ4 A;  3SHF A;  3O4G A;  4PXW A;  5FQD A;  4I79 A;  4FB1 D;  3K6S A;  2OIZ A;  2H9L A;  3IJE A;  4E54 B;  1A12 A;  2I3S A;  4JHP C;  4NSX A;  5HDB A;  5M5V A;  1SHY B;  3FGB A;  2UZY B;  2IWF A;  5CXC A;  5M5T A;  2UZX B;  2VDM A;  3NVX A;  4J8B A;  3OKY A;  4ZOZ A;  3SLE D;  4J77 A;  3K26 A;  3VGZ A;  3FCU A;  4CC9 A;  4DNV A;  4FWW A;  4LG9 A;  4N14 A;  3FRX A;  4LG8 A;  3BG0 A;  3UVN A;  4AN1 A;  1BPO A;  1XKS A;  3ZE2 A;  4ERQ A;  3IIW A;  2BBK H;  1JOF A;  2VZ1 A;  4ZOV A;  3V5W B;  1YFQ A;  1PEV A;  4JXM A;  5EAL A;  2P9L C;  3MVD K;  2HKR A;  4FHL A;  1QFM A;  2VDP A;  5H14 A;  1UOO A;  3EG6 A;  4FA5 D;  4J82 A;  4CI3 A;  4Z8L A;  4A08 B;  2O9K A;  2P9I C;  3CFV A;  1TYE A;  5AMS A;  4JT5 C;  4DNW A;  4PBY A;  4UM8 A;  4FAV D;  3ULE C;  3PVW B;  3I89 A;  3VI4 A;  4GGC A;  1N6D A;  3KRW B;  1O6F A;  3OF7 A;  1VZ2 A;  1N6E A;  4J0W A;  3F3P A;  5GSA A;  4HDJ A;  3I8E A;  2I0R A;  3B7F A;  2XDW A;  3C75 H;  2IUV A;  4O3U B;  3EI1 B;  4QAM A;  3ZDX A;  3T3M A;  5AFU 3;  2VDO A;  1MG3 A;  2EIE A;  4Z7Q A;  4ZN4 A;  3O4H A;  2B5L A;  3ZE0 A;  1K8K C;  2H47 A;  3PSC B;  3C9C A;  1MDA H;  2P9S C;  4L9O A;  5M5U A;  5EML B;  3EQ8 A;  5FLX g;  2P9P C;  3SBR A;  3HFQ A;  2H9N A;  2XZG A;  3KCI A;  5E6S A;  4A2M A;  3SVW D;  4H5I A;  4J73 A;  2Q7Q A;  2XYI A;  3NVQ A;  5TF2 A;  3ZE1 A;  5JWZ A;  4FAN D;  1YR2 A;  5EAM A;  4J86 A;  4QL1 A;  2CO0 A;  3IUM A;  3JRP A;  4WK2 A;  5C86 A;  4A09 B;  4J8G A;  2IUR A;  4ERZ A;  2TRC B;  2PM7 B;  5THA A;  4GQB B;  1PI6 A;  3IJ0 A;  3A0F A;  4AEZ A;  3UVK A;  2CO0 C;  3UVM A;  3OKW A;  3J81 g;  2H3X A;  3MUN A;  4E5Z A;  3V7D B;  2JKX A;  2VDN A;  3IUL A;  4AMZ A;  4J79 A;  3EI2 B;  4O3T B;  2P9U C;  3VI3 A;  3E0C A;  2Z2O A;  3C99 A;  1S4U X;  4J78 A;  5I5J A;  2OVP B;  5IJ7 E;  5B4W A;  4GQ1 A;  2J57 G;  4GQ2 P;  1OMW B;  3BWS A;  5EMK B;  5HQG A;  2YB8 B;  5I5I A;  4NEN A;  3SBQ A;  2GC4 A;  4Y7R A;  4A0B A;  1GOT B;  3AL8 A;  4ES0 A;  4Y5R D;  5CXC B;  3OKT A;  5TDH B;  4GGD A;  3PXS D;  1H2X A;  4CI8 A;  5EMJ B;  1I2M B;  2YNN A;  3OKY B;  3ODT A;  4RE6 A;  1C9L A;  2AQ5 A;  4GM3 A;  4BCC A;  3DM0 A;  2PBI B;  5HE0 B;  4GGA A;  5HYN B;  5C2V B;  4AMY A;  3EMH A;  3DSM A;  2I3T A;  3IVM A;  5CXB A;  3SJL D;  3UKR C;  3RMZ D;  3V9F A;  3EI4 A;  2IWK A;  3JZG A;  2B5M A;  4G1E A;  2MTA H;  4CY3 A;  4JD2 C;  5CYK A;  3I2N A;  4Z7O A;  4FA1 D;  1JTD B;  1GOH A;  1XHM A;  3SFZ A;  3RN1 D;  5M61 A;  1N6F A;  3JZH A;  2W18 A;  4CZX A;  1A0R B;  4CY5 A;  5HE1 B;  1PBY B;  2VC2 A;  3ORV D;  4L3G D;  2HES X;  4ZOX A;  4UM9 A;  3PSL A;  1H2Z A;  2H68 A;  2HU7 A;  3T3P A;  5FKS A;  1TBG A;  5IGQ A;  1H2Y A;  3PXT D;  1VE7 A;  4X3E A;  1QNI A;  4A11 A;  2OVQ B;  3RN0 D;  1SQ9 A;  1H2W A;  1XIP A;  2OK6 A;  5M5R A;  2GNQ A;  4X61 B;  2GC7 A;  3JRO A;  5EAP A;  3GC3 B;  2P9K C;  5TEF A;  4NBM A;  2Z2P A;  1GXR A;  3SXT D;  2QXV A;  3OL2 A;  5A2Q g;  2HYE A;  1GOF A;  2VDR A;  3EQ9 A;  5FA5 B;  3L4O D;  3VH0 A;  3CIK B;  3RRM C;  4CY1 A;  2EBS A;  4CI1 A;  4PNK B;  2AGZ A;  2J55 H;  2QZP A;  3SWS D;  4GM8 A;  5E6R A;  4A2L A;  3JZN A;  2IUQ A;  3L4M D;  2CN2 A;  2HU5 A;  4FA9 D;  4GM9 A;  1QFS A;  3I7H A;  4CI2 A;  3JB9 L;  1MG2 A;  3SBP A;  1U4C A;  4A0A A;  5C92 A;  4BUJ C;  1VYH C;  4E5Z B;  2I0T A;  3FCS A;  4JHN A;  4K3J B;  4BCB A;  1UOP A;  5FKQ A;  5EM2 B;  5GXI A;  5EMM B;  5IC7 A;  4GMB A;  1E8N A;  2H13 A;  2YMU A;  1GP2 B;  3NVN A;  2VDL A;  4OZU A;  3ZDZ A;  1E8M A;  1JMX B;  3V4P A;  4IA9 A;  2HJB A;  4D6V A;  4ERY A;  5AJA A; 
#chains in the Genus database with same CATH homology
 3OTT A;  2OVR B;  4U1E I;  4U7A A;  3PVU B;  5KDO B;  5H17 A;  1NR0 A;  3AFC A;  5SXM A;  3AL8 B;  2AGW A;  4EWR A;  2AH1 A;  2YNO A;  3PXW D;  4X60 B;  1JMZ B;  2I0S A;  2B4E A;  3I7N A;  5GMK n;  4J0X A;  4L3H D;  3AL9 A;  2QC5 A;  4J84 A;  5C2W B;  4PBZ A;  3N0D A;  5HE3 B;  5CXB B;  2Z2N A;  5IT9 g;  3UVO A;  3P4F A;  3EI3 A;  2AH0 A;  5CYK B;  1Q47 A;  2IUP A;  3EWE A;  4XYH A;  1K32 A;  4KFM B;  5K19 A;  3C5M A;  3MZK A;  4G56 B;  3KRX B;  3I7O A;  3CFS B;  3EI2 A;  3SCY A;  3F3F A;  3UVL A;  3GRE A;  2J56 H;  2PM9 A;  3DXK C;  5FXY A;  3AH8 B;  1GG2 B;  1L0Q A;  5GXH A;  3MZL A;  1B9Y A;  2CNX A;  3K27 A;  2XL2 A;  4A11 B;  1U2V C;  2AGY A;  4JT6 C;  3EU7 A;  3OW8 A;  4PC0 A;  4QQE A;  1TYQ C;  1R5M A;  2H14 A;  1NEX B;  3UR4 A;  4E54 A;  2B5N A;  4LGN A;  4O9D A;  5IJ8 E;  2P9N C;  3JAM g;  3OL2 B;  2G99 A;  1JJU B;  4X63 B;  3JPX A;  4O1Q D;  4JSV C;  5TEE A;  4L1Q D;  3IIY A;  3MMY A;  2H6K A;  2OK4 A;  2YBA A;  4J81 A;  4A0A B;  5FKT A;  3BG1 A;  4MK0 B;  4J87 A;  2XL3 A;  3VA6 A;  2XU7 A;  3IKO A;  2CE8 A;  4IMM A;  4A08 A;  3I7L A;  2AGL A;  4O45 A;  4H5J A;  3J80 g;  4QT8 A;  4QRJ A;  1ERJ A;  2HJ4 A;  4ESG A;  3W15 A;  4CZV A;  4FA4 D;  4BH6 A;  4PSX B;  5FKR A;  4AOW A;  4R7A B;  2H9P A;  3I8C A;  3UKU C;  3MKQ A;  3EI1 A;  4XYI A;  3IJ1 A;  3SN6 B;  3N0E A;  2PM6 B;  2YNP A;  1SQJ A;  4YVD A;  5IGO A;  2HXC A;  3RLM D;  1B9X A;  5I5M A;  5C9Z B;  2H6Q A;  4A0B B;  2AGX A;  5HE2 B;  4JSP C;  2HKM A;  2H6N A;  4BL0 A;  3DXM C;  2IAA A;  4CZY A;  2H9M A;  3FM0 A;  3DWL C;  3SMR A;  3U4Y A;  3EI3 B;  1OLZ A;  4PSW B;  4GZ8 A;  4JSN C;  4OWR A;  3IJC A;  3ZWL B;  4K3I D;  1PGU A;  5EM2 A;  4A09 A;  3EI4 B;  1P22 A;  2CE9 A;  3RSE C;  4A7J A;  2PM9 B;  3I7P A;  1FWX A;  3MKS B;  4JSX C;  3I7K A;  3PE7 A;  5K1C C;  4D0K A;  5H1M A;  4ZOY A;  3F3G A;  4UI9 R;  3RFG A;  3RFH A;  2BCJ B;  2OJY A;  4XEI C;  1RI6 A;  4CY2 A;  5EAR A;  3GFC A;  2CN3 A;  3MXX A;  2G9A A;  4TZ4 A;  3SHF A;  4PXW A;  5FQD A;  4I79 A;  4FB1 D;  2OIZ A;  2H9L A;  4E54 B;  2I3S A;  4NSX A;  1SHY B;  3FGB A;  2UZY B;  2IWF A;  5CXC A;  2UZX B;  3NVX A;  4J8B A;  3OKY A;  4ZOZ A;  3SLE D;  4J77 A;  3K26 A;  3VGZ A;  4CC9 A;  4FWW A;  4N14 A;  4LG9 A;  3FRX A;  4LG8 A;  3BG0 A;  3UVN A;  1XKS A;  4ERQ A;  3IIW A;  2BBK H;  1JOF A;  4ZOV A;  3V5W B;  1YFQ A;  1PEV A;  4JXM A;  5EAL A;  2P9L C;  2HKR A;  4FHL A;  5H14 A;  3EG6 A;  4FA5 D;  4J82 A;  4CI3 A;  4Z8L A;  4A08 B;  2O9K A;  2P9I C;  3CFV A;  5AMS A;  4JT5 C;  4PBY A;  4FAV D;  3ULE C;  3PVW B;  3I89 A;  4GGC A;  1N6D A;  3KRW B;  1N6E A;  4J0W A;  3F3P A;  5GSA A;  4HDJ A;  3I8E A;  2I0R A;  3B7F A;  3C75 H;  2IUV A;  4O3U B;  3EI1 B;  5AFU 3;  1MG3 A;  4ZN4 A;  2B5L A;  1K8K C;  2H47 A;  3PSC B;  3C9C A;  1MDA H;  2P9S C;  4L9O A;  5EML B;  5FLX g;  2P9P C;  3SBR A;  3HFQ A;  2H9N A;  4A2M A;  3SVW D;  4H5I A;  4J73 A;  2Q7Q A;  2XYI A;  3NVQ A;  5TF2 A;  5JWZ A;  4FAN D;  5EAM A;  4J86 A;  4QL1 A;  2CO0 A;  3JRP A;  4A09 B;  4J8G A;  2IUR A;  4ERZ A;  2TRC B;  2PM7 B;  5THA A;  4GQB B;  1PI6 A;  3IJ0 A;  3A0F A;  4AEZ A;  3UVK A;  2CO0 C;  3UVM A;  3OKW A;  3J81 g;  2H3X A;  4E5Z A;  3V7D B;  4J79 A;  3EI2 B;  4O3T B;  2P9U C;  3E0C A;  2Z2O A;  3C99 A;  1S4U X;  4J78 A;  5I5J A;  2OVP B;  5IJ7 E;  5B4W A;  4GQ1 A;  2J57 G;  4GQ2 P;  1OMW B;  3BWS A;  5EMK B;  5HQG A;  2YB8 B;  5I5I A;  3SBQ A;  2GC4 A;  4Y7R A;  4A0B A;  1GOT B;  3AL8 A;  4ES0 A;  4Y5R D;  5CXC B;  3OKT A;  5TDH B;  4GGD A;  3PXS D;  4CI8 A;  5EMJ B;  2YNN A;  3OKY B;  3ODT A;  2AQ5 A;  4GM3 A;  3DM0 A;  2PBI B;  5HE0 B;  4GGA A;  5HYN B;  5C2V B;  3EMH A;  3DSM A;  2I3T A;  5CXB A;  3SJL D;  3UKR C;  3RMZ D;  3V9F A;  3EI4 A;  2IWK A;  3JZG A;  2B5M A;  2MTA H;  4CY3 A;  4JD2 C;  5CYK A;  3I2N A;  4FA1 D;  1XHM A;  3SFZ A;  3RN1 D;  1N6F A;  3JZH A;  2W18 A;  4CZX A;  1A0R B;  4CY5 A;  5HE1 B;  1PBY B;  3ORV D;  4L3G D;  2HES X;  4ZOX A;  3PSL A;  2H68 A;  5FKS A;  1TBG A;  5IGQ A;  3PXT D;  4X3E A;  1QNI A;  4A11 A;  2OVQ B;  3RN0 D;  1SQ9 A;  1XIP A;  2OK6 A;  2GNQ A;  4X61 B;  2GC7 A;  3JRO A;  5EAP A;  2P9K C;  5TEF A;  2Z2P A;  1GXR A;  3SXT D;  2QXV A;  3OL2 A;  5A2Q g;  2HYE A;  5FA5 B;  3L4O D;  3VH0 A;  3CIK B;  3RRM C;  4CY1 A;  2EBS A;  4CI1 A;  4PNK B;  2AGZ A;  2J55 H;  3SWS D;  4GM8 A;  4A2L A;  3JZN A;  2IUQ A;  3L4M D;  2CN2 A;  4FA9 D;  4GM9 A;  3I7H A;  4CI2 A;  3JB9 L;  1MG2 A;  3SBP A;  1U4C A;  4A0A A;  4BUJ C;  1VYH C;  4E5Z B;  2I0T A;  4K3J B;  5FKQ A;  5GXI A;  5EM2 B;  5EMM B;  5IC7 A;  4GMB A;  2H13 A;  2YMU A;  1GP2 B;  3NVN A;  4OZU A;  1JMX B;  4IA9 A;  2HJB A;  4D6V A;  4ERY A;  5AJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...