4ESGA

X-ray structure of wdr5-mll1 win motif peptide binary complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transferase
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4esgA00
5HE1B 3SCYA 2YNOA 3FGBA 5IJ8E 5EMLB 3UVKA 2AGZA 3RLMD 4L1QD 4L3GD 5CXBB 4N14A 2XYIA 5AFU3 3SMRA 4A11A 4OWRA 5EMJB 5IJ7E 4J8BA 4K3JB 1U2VC 2H6KA 5THAA 4CY2A 3MMYA 2P9KC 5H17A 1GOTB 2IUQA 3F3GA 3AL8A 3N0EA 3OKWA 3EI3A 2HXCA 3GREA 2Z2NA 1XKSA 4FHLA 3J81g 4ERZA 3I7HA 4J87A 2OVQB 3BG1A 5EMMB 2QC5A 4GGCA 3PVWB 4E54B 5FA5B 5C2WB 1JOFA 3EG6A 3SXTD 4CZXA 4O45A 3FM0A 3JAMg 1PI6A 1JMXB 3RN0D 2CN2A 3JPXA 5SXMA 3IKOA 3JZGA 4J79A 1N6FA 3OKTA 3F3FA 4J82A 2GC4A 4BL0A 2H9NA 2B5LA 4J0XA 2HKMA 4BUJC 5FLXg 1S4UX 3ULEC 3C99A 3E0CA 1TYQC 4JSVC 4TZ4A 4ES0A 2AGXA 3EI4A 2AGLA 2O9KA 4FA4D 2OVRB 3SFZA 2H68A 3IIWA 4QL1A 3EI1A 2W18A 5HE0B 4XEIC 5IC7A 2PM6B 2QXVA 3J80g 1YFQA 3PSCB 4I79A 4CC9A 2HESX 5I5JA 3CFVA 4X61B 4GM3A 2B5MA 5EARA 4L3HD 2IUVA 3CFSB 2I0TA 2PM9A 2CNXA 3IJCA 5EM2A 4D0KA 3UVLA 3AH8B 3N0DA 2CE9A 5GSAA 4GMBA 3OL2A 1ERJA 4G56B 4EWRA 4J0WA 4ZN4A 3PVUB 1P22A 3C9CA 5FXYA 4JSPC 1A0RB 4X60B 3EU7A 4O1QD 1FWXA 2H47A 4ZOXA 4IA9A 1GP2B 3JB9L 3NVNA 4GQ1A 2OJYA 3I7NA 4JT5C 2B4EA 2P9PC 2Z2PA 5IGOA 5TEFA 5AJAA 3VGZA 4A0BA 3RMZD 4CY1A 1L0QA 5C2VB 5HYNB 3OTTA 5CYKB 3V7DB 1PGUA 2EBSA 2PM7B 4FA9D 1XIPA 3SLED 3BG0A 4JSXC 4FA5D 2XU7A 4A0AA 4GQ2P 4AEZA 4E54A 4MK0B 3A0FA 4QT8A 3KRXB 3K26A 2XL2A 3RRMC 3PXSD 4PBYA 1XHMA 2B5NA 4BH6A 2AGYA 2GNQA 4CZVA 2OVPB 3DSMA 1JJUB 3ORVD 4HDJA 3RFGA 1U4CA 1K32A 2P9SC 3DXMC 5EALA 3SBRA 3SJLD 5C9ZB 3OW8A 4UI9R 4A08A 1N6EA 2I0SA 1K8KC 2YMUA 4JT6C 3UR4A 4A2MA 2P9UC 3I8EA 4D6VA 2UZYB 2YNPA 2CN3A 4GGDA 4E5ZB 3AL8B 4FWWA 4IMMA 2H6NA 4X63B 4J77A 4J81A 1R5MA 3JROA 3EI3B 4X3EA 4A09B 2J57G 2H14A 3B7FA 4O3TB 4CI3A 2H9LA 4L9OA 5GXHA 4FB1D 2J55H 5K1CC 4ERQA 3L4MD 2G99A 4FAND 4Y7RA 1Q47A 3V5WB 1SQ9A 5CXCA 3F3PA 3SBPA 2HJ4A 3NVXA 3EI2A 2H9PA 4JXMA 5KDOB 3MKQA 4YVDA 4U7AA 1B9YA 4ERYA 4PSWB 3JZNA 2I3SA 4PBZA 4O9DA 2G9AA 4PNKB 1NEXB 3MXXA 1GXRA 4CI2A 1N6DA 3UVOA 3RN1D 4R7AB 3ZWLB 2GC7A 3I7LA 1JMZB 3OKYA 4U1EI 3FRXA 2P9IC 5AMSA 3UKUC 3KRWB 3SWSD 1SHYB 3JRPA 5H14A 2P9LC 3MKSB 3RSEC 4PXWA 3VH0A 4Y5RD 3AL9A 3IJ1A 2OK6A 2IUPA 4ZOVA 3JZHA 3IJ0A 3W15A 5FQDA 3EMHA 5B4WA 5CXBA 2HJBA 4GZ8A 2BBKH 3I8CA 2PBIB 4JD2C 2AH1A 5CYKA 3GFCA 5IT9g 2H13A 2IAAA 3L4OD 5EM2B 1QNIA 2Z2OA 2YB8B 5FKSA 5IGQA 4GM9A 2J56H 2BCJB 3OL2B 4CY3A 5A2Qg 3SN6B 4LGNA 4A2LA 4AOWA 3HFQA 1PBYB 3PSLA 1MDAH 2P9NC 4J86A 2YNNA 2YBAA 2CO0A 3I7KA 3V9FA 2H6QA 1GG2B 2CE8A 4CI1A 3BWSA 4Z8LA 4E5ZA 4A0BB 2CO0C 5EAPA 4LG9A 1RI6A 4A11B 4A09A 5FKTA 3IIYA 4J84A 2Q7QA 3UKRC 3UVMA 3DM0A 4ZOZA 4QQEA 1B9XA 2AQ5A 5FKQA 3C75H 4CZYA 4J78A 2XL3A 2TRCB 4A0AB 3I89A 3C5MA 4XYIA 2IURA 2MTAH 1OLZA 4K3ID 1MG3A 1PEVA 3PE7A 4J8GA 3SHFA 3CIKB 5FKRA 4H5IA 4NSXA 4PSXB 5TEEA 3K27A 2H9MA 2UZXB 3PXTD 4A08B 3MZKA 3I7OA 3VA6A 2AH0A 2H3XA 1OMWB 4A7JA 3I2NA 5GXIA 4FA1D 3DXKC 4CY5A 3U4YA 3SBQA 5EAMA 4GGAA 2HYEA 3EWEA 4ZOYA 3EI4B 4LG8A 1NR0A 2OIZA 2IWKA 2HKRA 3PXWD 4PC0A 2OK4A 4H5JA 5HE2B 5K19A 5CXCB 3EI1B 4ESGA 5JWZA 5GMKn 3EI2B 5HQGA 5I5IA 3DWLC 4XYHA 4FAVD 3RFHA 4KFMB 2IWFA 5TDHB 2I3TA 4J73A 2PM9B 4CI8A 4O3UB 2I0RA 3UVNA 1MG2A 5HE3B 1VYHC 5EMKB 3OKYB 3SVWD 5H1MA 5I5MA 4GM8A 4GQBB 4JSNC 1SQJA 1TBGA 3AFCA 3P4FA 3MZLA 2AGWA 3I7PA 3NVQA 4OZUA 3ODTA 4QRJA 5TF2A
chains in the Genus database with same CATH superfamily
5HE1B 3SCYA 1M1XA 2YNOA 3FGBA 5IJ8E 5EMLB 3UVKA 1T2XA 2AGZA 3RLMD 2HU5A 4L1QD 3IURA 4L3GD 5CXBB 4N14A 2XYIA 4BCCA 5AFU3 3SMRA 4A11A 4OWRA 5EMJB 3EQ9A 5IJ7E 1JTDB 4J8BA 4K3JB 1U2VC 2H6KA 1U8CA 5THAA 4CY2A 3MMYA 2P9KC 5H17A 4IRZA 1E8NA 1GOTB 2IUQA 3F3GA 3AL8A 2VDOA 4JHPC 3N0EA 3OKWA 3VI4A 3EI3A 2HXCA 3GREA 1UOQA 3NIFA 2Z2NA 1XKSA 2QZPA 4FHLA 3J81g 4ERZA 3I7HA 4J87A 2OVQB 3OF7A 3BG1A 5EMMB 2QC5A 1VZ2A 4GGCA 3PVWB 4E54B 5FA5B 5C2WB 1JOFA 3EG6A 3SXTD 4CZXA 4O45A 3FM0A 3JAMg 1PI6A 1JMXB 3RN0D 2CN2A 1H2XA 3JPXA 2VDQA 5SXMA 3IKOA 3JZGA 4DNWA 4J79A 1N6FA 3O4HA 3QI0A 3OKTA 3F3FA 4J82A 2GC4A 4BL0A 2H9NA 2B5LA 4J0XA 1VE6A 4NC4A 1YR2A 2HKMA 4BUJC 5FLXg 4WJKA 1S4UX 4G1MA 3ULEC 3C99A 5E6RA 3E0CA 4Z7QA 1TYQC 4JSVC 4TZ4A 4ES0A 2AGXA 1QFMA 3EI4A 2AGLA 2O9KA 3GC3B 2WQ8A 3GD1I 4FA4D 2OVRB 3SFZA 4JHNA 2H68A 3O4JA 3IIWA 4QL1A 3EI1A 2W18A 5HE0B 4XEIC 5IC7A 2PM6B 4O02A 2QXVA 4UM9A 4Z7NA 3J80g 4Z7OA 1YFQA 3PSCB 4I79A 4CC9A 2HESX 5I5JA 3CFVA 3IUJA 4X61B 4GM3A 2B5MA 5EARA 4L3HD 1GOHA 1O6GA 2IUVA 4QAMA 3CFSB 2I0TA 4MMXA 2PM9A 2CNXA 3IJCA 5EM2A 4D0KA 4AX4A 2XE4A 1O6FA 3ZDXA 2VDRA 3UVLA 3AH8B 3N0DA 4O2WA 2CE9A 5GSAA 4GMBA 5E6SA 3OL2A 1ERJA 2EIDA 4G56B 4AMZA 4EWRA 1VZ3A 1JV2A 4J0WA 4ZN4A 3PVUB 3IUNA 3MVDK 1P22A 3C9CA 5FXYA 2XDWA 4JSPC 1A0RB 4X60B 2VZ1A 2VDKA 3EU7A 4O1QD 1FWXA 2H47A 4ZOXA 4IA9A 1GP2B 3JB9L 3NVNA 4GQ1A 2OJYA 3I7NA 4JT5C 2B4EA 5M5RA 2P9PC 2Z2PA 3V4PA 5M5VA 5IGOA 3VI3A 5TEFA 5AJAA 3VGZA 4A0BA 3RMZD 4CY1A 1L0QA 1L5GA 2QR5A 5C2VB 5HYNB 3OTTA 2EIEA 5CYKB 3V7DB 1PGUA 3V4VA 2EBSA 2PM7B 4FA9D 1XIPA 3SLED 3BG0A 3O4IA 4JSXC 1VE7A 4FA5D 2XU7A 4A0AA 4GQ2P 4AEZA 4E54A 3IVMA 4MK0B 3A0FA 5FFGA 4QT8A 3KRXB 5M5SA 3K26A 2XL2A 3RRMC 3PXSD 4PBYA 5C92A 1XHMA 2B5NA 4BH6A 2AGYA 2GNQA 4CZVA 2OVPB 3DSMA 1JJUB 3ORVD 4HDJA 3RFGA 1U4CA 1K32A 2P9SC 3DXMC 5EALA 3SBRA 3SJLD 5C9ZB 3OW8A 4UI9R 5M61A 4A08A 1N6EA 2I0SA 1K8KC 2YMUA 4JT6C 3UR4A 3KCIA 4A2MA 2P9UC 3I8EA 4D6VA 3IULA 2UZYB 2YNPA 2CN3A 4GGDA 4E5ZB 3AL8B 4FWWA 4IMMA 2H6NA 4X63B 4J77A 4J81A 1R5MA 2VZ3A 3EI3B 3JROA 4X3EA 4D9SA 4A09B 2J57G 2H14A 3IUMA 3B7FA 4O3TB 4BCBA 4CI3A 2H9LA 4L9OA 5GXHA 4FB1D 2J55H 5K1CC 3T3PA 4ERQA 3EQ7A 3L4MD 2G99A 4FAND 4RE5A 4Y7RA 4DNVA 1Q47A 3V5WB 1SQ9A 5CXCA 3F3PA 3EQ8A 3SBPA 2HJ4A 3NVXA 3EI2A 2H9PA 4JXMA 5KDOB 3MKQA 3MUNA 3ZDZA 4YVDA 4U7AA 1B9YA 4ERYA 4BP8A 4PSWB 3JZNA 2I3SA 4PBZA 4O9DA 5M5UA 2G9AA 4PNKB 1NEXB 3MXXA 3IUQA 1GXRA 4CI2A 1N6DA 3ZE2A 3UVOA 3RN1D 4NAAA 2VDLA 4R7AB 3K71A 5HDBA 3ZWLB 2GC7A 3I7LA 1JMZB 3OKYA 4U1EI 3FRXA 2P9IC 5AMSA 4L1MA 3UKUC 3KRWB 3SWSD 1SHYB 3ZE0A 3JRPA 5H14A 2P9LC 3MKSB 3RSEC 3FCSA 4PXWA 1GOGA 3VH0A 4Y5RD 3AL9A 3IJ1A 2OK6A 4NENA 1GOFA 2IUPA 1A12A 4ZOVA 3JZHA 3IJ0A 3W15A 5FQDA 3EMHA 5B4WA 1C9LA 5CXBA 2EIBA 5M5TA 2HJBA 4GZ8A 2BBKH 3I8CA 2PBIB 4JD2C 2AH1A 4NBMA 5CYKA 3GFCA 2EICA 5IT9g 3DDUA 1TYEA 2H13A 2IAAA 3L4OD 5EM2B 1QNIA 2Z2OA 2YB8B 2HU8A 5FKSA 5IGQA 4GM9A 2J56H 2BCJB 3OL2B 4CY3A 5A2Qg 3SN6B 4LGNA 4A2LA 4AOWA 3HFQA 2XZGA 1PBYB 3PSLA 3K72A 1UOPA 4AMYA 1MDAH 3ZDYA 2P9NC 4J86A 2YNNA 4MMZA 2BKLA 2YBAA 5FFOA 4WK0A 2CO0A 3I7KA 3V9FA 2H6QA 1GG2B 2CE8A 4CI1A 3BWSA 4Z8LA 4E5ZA 4A0BB 2CO0C 5EAPA 4LG9A 1RI6A 4A11B 4A09A 5FKTA 1I2MB 3IIYA 2Q7QA 4J84A 3UKRC 1K3IA 3ZE1A 3UVMA 3DM0A 4ZOZA 4QQEA 4MMYA 1B9XA 3NIGA 2AQ5A 2VC2A 5FKQA 3C75H 4CZYA 4J78A 2XL3A 2VDMA 2TRCB 4A0AB 3I89A 3C5MA 4AN1A 1UTCA 3NIDA 4XYIA 2IURA 2MTAH 4RE6A 1OLZA 4K3ID 1MG3A 1PEVA 3PE7A 4J8GA 3SHFA 3CIKB 5FKRA 4H5IA 4NSXA 4PSXB 5TEEA 3K27A 2H9MA 2UZXB 3PXTD 2JKXA 3MUOA 3IJEA 3K6SA 4A08B 2VDNA 1H2WA 3MZKA 3O4GA 3I7OA 3VA6A 2AH0A 1H2YA 5E6UA 2H3XA 1OMWB 4UM8A 4A7JA 3I2NA 4G55A 5GXIA 4FA1D 3DXKC 4CY5A 3U4YA 3SBQA 5EAMA 4GGAA 3T3MA 3EWEA 2HYEA 3QHYB 4ZOYA 3EI4B 4LG8A 1NR0A 1BPOA 2OIZA 2IWKA 2HKRA 3PXWD 4PC0A 4DNUA 2HU7A 5C86A 4BP9A 2OK4A 4H5JA 5HE2B 5K19A 5CXCB 4AN0A 3EI1B 4ESGA 5JWZA 5GMKn 3EI2B 5HQGA 5I5IA 3DWLC 4XYHA 4FAVD 4WK2A 3RFHA 4KFMB 2IWFA 4BCDA 1UOOA 5TDHB 2I3TA 4J73A 4WK4A 2PM9B 4CI8A 4O3UB 2I0RA 3UVNA 1MG2A 5HE3B 1VYHC 5EMKB 3OKYB 3SVWD 5H1MA 5I5MA 1C9IA 2VDPA 4GM8A 4GQBB 1E5TA 1SQJA 4JSNC 1TBGA 3AFCA 3P4FA 3MZLA 1E8MA 1H2ZA 1QFSA 2AGWA 3FCUA 3I7PA 3NVQA 4OZUA 4G1EA 3ODTA 4QRJA 5TF2A
chains in the Genus database with same CATH topology
5HE1B 3SCYA 2YNOA 3FGBA 5IJ8E 5EMLB 3UVKA 2AGZA 3RLMD 4L1QD 4L3GD 5CXBB 4N14A 2XYIA 5AFU3 3SMRA 4A11A 4OWRA 5EMJB 5IJ7E 4J8BA 4K3JB 1U2VC 2H6KA 5THAA 4CY2A 3MMYA 2P9KC 5H17A 1GOTB 2IUQA 3F3GA 3AL8A 3N0EA 3OKWA 3EI3A 2HXCA 3GREA 2Z2NA 1XKSA 4FHLA 3J81g 4ERZA 3I7HA 4J87A 2OVQB 3BG1A 5EMMB 2QC5A 4GGCA 3PVWB 4E54B 5FA5B 5C2WB 1JOFA 3EG6A 3SXTD 4CZXA 4O45A 3FM0A 3JAMg 1PI6A 1JMXB 3RN0D 2CN2A 3JPXA 5SXMA 3IKOA 3JZGA 4J79A 1N6FA 3OKTA 3F3FA 4J82A 2GC4A 4BL0A 2H9NA 2B5LA 4J0XA 2HKMA 4BUJC 5FLXg 1S4UX 3ULEC 3C99A 3E0CA 1TYQC 4JSVC 4TZ4A 4ES0A 2AGXA 3EI4A 2AGLA 2O9KA 4FA4D 2OVRB 3SFZA 2H68A 3IIWA 4QL1A 3EI1A 2W18A 5HE0B 4XEIC 5IC7A 2PM6B 2QXVA 3J80g 1YFQA 3PSCB 4I79A 4CC9A 2HESX 5I5JA 3CFVA 4X61B 4GM3A 2B5MA 5EARA 4L3HD 2IUVA 3CFSB 2I0TA 2PM9A 2CNXA 3IJCA 5EM2A 4D0KA 3UVLA 3AH8B 3N0DA 2CE9A 5GSAA 4GMBA 3OL2A 1ERJA 4G56B 4EWRA 4J0WA 4ZN4A 3PVUB 1P22A 3C9CA 5FXYA 4JSPC 1A0RB 4X60B 3EU7A 4O1QD 1FWXA 2H47A 4ZOXA 4IA9A 1GP2B 3JB9L 3NVNA 4GQ1A 2OJYA 3I7NA 4JT5C 2B4EA 2P9PC 2Z2PA 5IGOA 5TEFA 5AJAA 3VGZA 4A0BA 3RMZD 4CY1A 1L0QA 5C2VB 5HYNB 3OTTA 5CYKB 3V7DB 1PGUA 2EBSA 2PM7B 4FA9D 1XIPA 3SLED 3BG0A 4JSXC 4FA5D 2XU7A 4A0AA 4GQ2P 4AEZA 4E54A 4MK0B 3A0FA 4QT8A 3KRXB 3K26A 2XL2A 3RRMC 3PXSD 4PBYA 1XHMA 2B5NA 4BH6A 2AGYA 2GNQA 4CZVA 2OVPB 3DSMA 1JJUB 3ORVD 4HDJA 3RFGA 1U4CA 1K32A 2P9SC 3DXMC 5EALA 3SBRA 3SJLD 5C9ZB 3OW8A 4UI9R 4A08A 1N6EA 2I0SA 1K8KC 2YMUA 4JT6C 3UR4A 4A2MA 2P9UC 3I8EA 4D6VA 2UZYB 2YNPA 2CN3A 4GGDA 4E5ZB 3AL8B 4FWWA 4IMMA 2H6NA 4X63B 4J77A 4J81A 1R5MA 3JROA 3EI3B 4X3EA 4A09B 2J57G 2H14A 3B7FA 4O3TB 4CI3A 2H9LA 4L9OA 5GXHA 4FB1D 2J55H 5K1CC 4ERQA 3L4MD 2G99A 4FAND 4Y7RA 1Q47A 3V5WB 1SQ9A 5CXCA 3F3PA 3SBPA 2HJ4A 3NVXA 3EI2A 2H9PA 4JXMA 5KDOB 3MKQA 4YVDA 4U7AA 1B9YA 4ERYA 4PSWB 3JZNA 2I3SA 4PBZA 4O9DA 2G9AA 4PNKB 1NEXB 3MXXA 1GXRA 4CI2A 1N6DA 3UVOA 3RN1D 4R7AB 3ZWLB 2GC7A 3I7LA 1JMZB 3OKYA 4U1EI 3FRXA 2P9IC 5AMSA 3UKUC 3KRWB 3SWSD 1SHYB 3JRPA 5H14A 2P9LC 3MKSB 3RSEC 4PXWA 3VH0A 4Y5RD 3AL9A 3IJ1A 2OK6A 2IUPA 4ZOVA 3JZHA 3IJ0A 3W15A 5FQDA 3EMHA 5B4WA 5CXBA 2HJBA 4GZ8A 2BBKH 3I8CA 2PBIB 4JD2C 2AH1A 5CYKA 3GFCA 5IT9g 2H13A 2IAAA 3L4OD 5EM2B 1QNIA 2Z2OA 2YB8B 5FKSA 5IGQA 4GM9A 2J56H 2BCJB 3OL2B 4CY3A 5A2Qg 3SN6B 4LGNA 4A2LA 4AOWA 3HFQA 1PBYB 3PSLA 1MDAH 2P9NC 4J86A 2YNNA 2YBAA 2CO0A 3I7KA 3V9FA 2H6QA 1GG2B 2CE8A 4CI1A 3BWSA 4Z8LA 4E5ZA 4A0BB 2CO0C 5EAPA 4LG9A 1RI6A 4A11B 4A09A 5FKTA 3IIYA 4J84A 2Q7QA 3UKRC 3UVMA 3DM0A 4ZOZA 4QQEA 1B9XA 2AQ5A 5FKQA 3C75H 4CZYA 4J78A 2XL3A 2TRCB 4A0AB 3I89A 3C5MA 4XYIA 2IURA 2MTAH 1OLZA 4K3ID 1MG3A 1PEVA 3PE7A 4J8GA 3SHFA 3CIKB 5FKRA 4H5IA 4NSXA 4PSXB 5TEEA 3K27A 2H9MA 2UZXB 3PXTD 4A08B 3MZKA 3I7OA 3VA6A 2AH0A 2H3XA 1OMWB 4A7JA 3I2NA 5GXIA 4FA1D 3DXKC 4CY5A 3U4YA 3SBQA 5EAMA 4GGAA 2HYEA 3EWEA 4ZOYA 3EI4B 4LG8A 1NR0A 2OIZA 2IWKA 2HKRA 3PXWD 4PC0A 2OK4A 4H5JA 5HE2B 5K19A 5CXCB 3EI1B 4ESGA 5JWZA 5GMKn 3EI2B 5HQGA 5I5IA 3DWLC 4XYHA 4FAVD 3RFHA 4KFMB 2IWFA 5TDHB 2I3TA 4J73A 2PM9B 4CI8A 4O3UB 2I0RA 3UVNA 1MG2A 5HE3B 1VYHC 5EMKB 3OKYB 3SVWD 5H1MA 5I5MA 4GM8A 4GQBB 4JSNC 1SQJA 1TBGA 3AFCA 3P4FA 3MZLA 2AGWA 3I7PA 3NVQA 4OZUA 3ODTA 4QRJA 5TF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE1 B;  3SCY A;  2YNO A;  3FGB A;  5IJ8 E;  5EML B;  3UVK A;  2AGZ A;  3RLM D;  4L1Q D;  4L3G D;  5CXB B;  4N14 A;  2XYI A;  5AFU 3;  3SMR A;  4A11 A;  4OWR A;  5EMJ B;  5IJ7 E;  4J8B A;  4K3J B;  1U2V C;  2H6K A;  5THA A;  4CY2 A;  3MMY A;  2P9K C;  5H17 A;  1GOT B;  2IUQ A;  3F3G A;  3AL8 A;  3N0E A;  3OKW A;  3EI3 A;  2HXC A;  3GRE A;  2Z2N A;  1XKS A;  4FHL A;  3J81 g;  4ERZ A;  3I7H A;  4J87 A;  2OVQ B;  3BG1 A;  5EMM B;  2QC5 A;  4GGC A;  3PVW B;  4E54 B;  5FA5 B;  5C2W B;  1JOF A;  3EG6 A;  3SXT D;  4CZX A;  4O45 A;  3FM0 A;  3JAM g;  1PI6 A;  1JMX B;  3RN0 D;  2CN2 A;  3JPX A;  5SXM A;  3IKO A;  3JZG A;  4J79 A;  1N6F A;  3OKT A;  3F3F A;  4J82 A;  2GC4 A;  4BL0 A;  2H9N A;  2B5L A;  4J0X A;  2HKM A;  4BUJ C;  5FLX g;  1S4U X;  3ULE C;  3C99 A;  3E0C A;  1TYQ C;  4JSV C;  4TZ4 A;  4ES0 A;  2AGX A;  3EI4 A;  2AGL A;  2O9K A;  4FA4 D;  2OVR B;  3SFZ A;  2H68 A;  3IIW A;  4QL1 A;  3EI1 A;  2W18 A;  5HE0 B;  4XEI C;  5IC7 A;  2PM6 B;  2QXV A;  3J80 g;  1YFQ A;  3PSC B;  4I79 A;  4CC9 A;  2HES X;  5I5J A;  3CFV A;  4X61 B;  4GM3 A;  2B5M A;  5EAR A;  4L3H D;  2IUV A;  3CFS B;  2I0T A;  2PM9 A;  2CNX A;  3IJC A;  5EM2 A;  4D0K A;  3UVL A;  3AH8 B;  3N0D A;  2CE9 A;  5GSA A;  4GMB A;  3OL2 A;  1ERJ A;  4G56 B;  4EWR A;  4J0W A;  4ZN4 A;  3PVU B;  1P22 A;  3C9C A;  5FXY A;  4JSP C;  1A0R B;  4X60 B;  3EU7 A;  4O1Q D;  1FWX A;  2H47 A;  4ZOX A;  4IA9 A;  1GP2 B;  3JB9 L;  3NVN A;  4GQ1 A;  2OJY A;  3I7N A;  4JT5 C;  2B4E A;  2P9P C;  2Z2P A;  5IGO A;  5TEF A;  5AJA A;  3VGZ A;  4A0B A;  3RMZ D;  4CY1 A;  1L0Q A;  5C2V B;  5HYN B;  3OTT A;  5CYK B;  3V7D B;  1PGU A;  2EBS A;  2PM7 B;  4FA9 D;  1XIP A;  3SLE D;  3BG0 A;  4JSX C;  4FA5 D;  2XU7 A;  4A0A A;  4GQ2 P;  4AEZ A;  4E54 A;  4MK0 B;  3A0F A;  4QT8 A;  3KRX B;  3K26 A;  2XL2 A;  3RRM C;  3PXS D;  4PBY A;  1XHM A;  2B5N A;  4BH6 A;  2AGY A;  2GNQ A;  4CZV A;  2OVP B;  3DSM A;  1JJU B;  3ORV D;  4HDJ A;  3RFG A;  1U4C A;  1K32 A;  2P9S C;  3DXM C;  5EAL A;  3SBR A;  3SJL D;  5C9Z B;  3OW8 A;  4UI9 R;  4A08 A;  1N6E A;  2I0S A;  1K8K C;  2YMU A;  4JT6 C;  3UR4 A;  4A2M A;  2P9U C;  3I8E A;  4D6V A;  2UZY B;  2YNP A;  2CN3 A;  4GGD A;  4E5Z B;  3AL8 B;  4FWW A;  4IMM A;  2H6N A;  4X63 B;  4J77 A;  4J81 A;  1R5M A;  3JRO A;  3EI3 B;  4X3E A;  4A09 B;  2J57 G;  2H14 A;  3B7F A;  4O3T B;  4CI3 A;  2H9L A;  4L9O A;  5GXH A;  4FB1 D;  2J55 H;  5K1C C;  4ERQ A;  3L4M D;  2G99 A;  4FAN D;  4Y7R A;  1Q47 A;  3V5W B;  1SQ9 A;  5CXC A;  3F3P A;  3SBP A;  2HJ4 A;  3NVX A;  3EI2 A;  2H9P A;  4JXM A;  5KDO B;  3MKQ A;  4YVD A;  4U7A A;  1B9Y A;  4ERY A;  4PSW B;  3JZN A;  2I3S A;  4PBZ A;  4O9D A;  2G9A A;  4PNK B;  1NEX B;  3MXX A;  1GXR A;  4CI2 A;  1N6D A;  3UVO A;  3RN1 D;  4R7A B;  3ZWL B;  2GC7 A;  3I7L A;  1JMZ B;  3OKY A;  4U1E I;  3FRX A;  2P9I C;  5AMS A;  3UKU C;  3KRW B;  3SWS D;  1SHY B;  3JRP A;  5H14 A;  2P9L C;  3MKS B;  3RSE C;  4PXW A;  3VH0 A;  4Y5R D;  3AL9 A;  3IJ1 A;  2OK6 A;  2IUP A;  4ZOV A;  3JZH A;  3IJ0 A;  3W15 A;  5FQD A;  3EMH A;  5B4W A;  5CXB A;  2HJB A;  4GZ8 A;  2BBK H;  3I8C A;  2PBI B;  4JD2 C;  2AH1 A;  5CYK A;  3GFC A;  5IT9 g;  2H13 A;  2IAA A;  3L4O D;  5EM2 B;  1QNI A;  2Z2O A;  2YB8 B;  5FKS A;  5IGQ A;  4GM9 A;  2J56 H;  2BCJ B;  3OL2 B;  4CY3 A;  5A2Q g;  3SN6 B;  4LGN A;  4A2L A;  4AOW A;  3HFQ A;  1PBY B;  3PSL A;  1MDA H;  2P9N C;  4J86 A;  2YNN A;  2YBA A;  2CO0 A;  3I7K A;  3V9F A;  2H6Q A;  1GG2 B;  2CE8 A;  4CI1 A;  3BWS A;  4Z8L A;  4E5Z A;  4A0B B;  2CO0 C;  5EAP A;  4LG9 A;  1RI6 A;  4A11 B;  4A09 A;  5FKT A;  3IIY A;  4J84 A;  2Q7Q A;  3UKR C;  3UVM A;  3DM0 A;  4ZOZ A;  4QQE A;  1B9X A;  2AQ5 A;  5FKQ A;  3C75 H;  4CZY A;  4J78 A;  2XL3 A;  2TRC B;  4A0A B;  3I89 A;  3C5M A;  4XYI A;  2IUR A;  2MTA H;  1OLZ A;  4K3I D;  1MG3 A;  1PEV A;  3PE7 A;  4J8G A;  3SHF A;  3CIK B;  5FKR A;  4H5I A;  4NSX A;  4PSX B;  5TEE A;  3K27 A;  2H9M A;  2UZX B;  3PXT D;  4A08 B;  3MZK A;  3I7O A;  3VA6 A;  2AH0 A;  2H3X A;  1OMW B;  4A7J A;  3I2N A;  5GXI A;  4FA1 D;  3DXK C;  4CY5 A;  3U4Y A;  3SBQ A;  5EAM A;  4GGA A;  2HYE A;  3EWE A;  4ZOY A;  3EI4 B;  4LG8 A;  1NR0 A;  2OIZ A;  2IWK A;  2HKR A;  3PXW D;  4PC0 A;  2OK4 A;  4H5J A;  5HE2 B;  5K19 A;  5CXC B;  3EI1 B;  4ESG A;  5JWZ A;  5GMK n;  3EI2 B;  5HQG A;  5I5I A;  3DWL C;  4XYH A;  4FAV D;  3RFH A;  4KFM B;  2IWF A;  5TDH B;  2I3T A;  4J73 A;  2PM9 B;  4CI8 A;  4O3U B;  2I0R A;  3UVN A;  1MG2 A;  5HE3 B;  1VYH C;  5EMK B;  3OKY B;  3SVW D;  5H1M A;  5I5M A;  4GM8 A;  4GQB B;  4JSN C;  1SQJ A;  1TBG A;  3AFC A;  3P4F A;  3MZL A;  2AGW A;  3I7P A;  3NVQ A;  4OZU A;  3ODT A;  4QRJ A;  5TF2 A; 
#chains in the Genus database with same CATH topology
 5HE1 B;  3SCY A;  1M1X A;  2YNO A;  3FGB A;  5IJ8 E;  5EML B;  3UVK A;  1T2X A;  2AGZ A;  3RLM D;  2HU5 A;  4L1Q D;  3IUR A;  4L3G D;  5CXB B;  4N14 A;  2XYI A;  4BCC A;  5AFU 3;  3SMR A;  4A11 A;  4OWR A;  5EMJ B;  3EQ9 A;  5IJ7 E;  1JTD B;  4J8B A;  4K3J B;  1U2V C;  2H6K A;  1U8C A;  5THA A;  4CY2 A;  3MMY A;  2P9K C;  5H17 A;  4IRZ A;  1E8N A;  1GOT B;  2IUQ A;  3F3G A;  3AL8 A;  2VDO A;  4JHP C;  3N0E A;  3OKW A;  3VI4 A;  3EI3 A;  2HXC A;  3GRE A;  1UOQ A;  3NIF A;  2Z2N A;  1XKS A;  2QZP A;  4FHL A;  3J81 g;  4ERZ A;  3I7H A;  4J87 A;  2OVQ B;  3OF7 A;  3BG1 A;  5EMM B;  2QC5 A;  1VZ2 A;  4GGC A;  3PVW B;  4E54 B;  5FA5 B;  5C2W B;  1JOF A;  3EG6 A;  3SXT D;  4CZX A;  4O45 A;  3FM0 A;  3JAM g;  1PI6 A;  1JMX B;  3RN0 D;  2CN2 A;  1H2X A;  3JPX A;  2VDQ A;  5SXM A;  3IKO A;  3JZG A;  4DNW A;  4J79 A;  1N6F A;  3O4H A;  3QI0 A;  3OKT A;  3F3F A;  4J82 A;  2GC4 A;  4BL0 A;  2H9N A;  2B5L A;  4J0X A;  1VE6 A;  4NC4 A;  1YR2 A;  2HKM A;  4BUJ C;  5FLX g;  4WJK A;  1S4U X;  4G1M A;  3ULE C;  3C99 A;  5E6R A;  3E0C A;  4Z7Q A;  1TYQ C;  4JSV C;  4TZ4 A;  4ES0 A;  2AGX A;  1QFM A;  3EI4 A;  2AGL A;  2O9K A;  3GC3 B;  2WQ8 A;  3GD1 I;  4FA4 D;  2OVR B;  3SFZ A;  4JHN A;  2H68 A;  3O4J A;  3IIW A;  4QL1 A;  3EI1 A;  2W18 A;  5HE0 B;  4XEI C;  5IC7 A;  2PM6 B;  4O02 A;  2QXV A;  4UM9 A;  4Z7N A;  3J80 g;  4Z7O A;  1YFQ A;  3PSC B;  4I79 A;  4CC9 A;  2HES X;  5I5J A;  3CFV A;  3IUJ A;  4X61 B;  4GM3 A;  2B5M A;  5EAR A;  4L3H D;  1GOH A;  1O6G A;  2IUV A;  4QAM A;  3CFS B;  2I0T A;  4MMX A;  2PM9 A;  2CNX A;  3IJC A;  5EM2 A;  4D0K A;  4AX4 A;  2XE4 A;  1O6F A;  3ZDX A;  2VDR A;  3UVL A;  3AH8 B;  3N0D A;  4O2W A;  2CE9 A;  5GSA A;  4GMB A;  5E6S A;  3OL2 A;  1ERJ A;  2EID A;  4G56 B;  4AMZ A;  4EWR A;  1VZ3 A;  1JV2 A;  4J0W A;  4ZN4 A;  3PVU B;  3IUN A;  3MVD K;  1P22 A;  3C9C A;  5FXY A;  2XDW A;  4JSP C;  1A0R B;  4X60 B;  2VZ1 A;  2VDK A;  3EU7 A;  4O1Q D;  1FWX A;  2H47 A;  4ZOX A;  4IA9 A;  1GP2 B;  3JB9 L;  3NVN A;  4GQ1 A;  2OJY A;  3I7N A;  4JT5 C;  2B4E A;  5M5R A;  2P9P C;  2Z2P A;  3V4P A;  5M5V A;  5IGO A;  3VI3 A;  5TEF A;  5AJA A;  3VGZ A;  4A0B A;  3RMZ D;  4CY1 A;  1L0Q A;  1L5G A;  2QR5 A;  5C2V B;  5HYN B;  3OTT A;  2EIE A;  5CYK B;  3V7D B;  1PGU A;  3V4V A;  2EBS A;  2PM7 B;  4FA9 D;  1XIP A;  3SLE D;  3BG0 A;  3O4I A;  4JSX C;  1VE7 A;  4FA5 D;  2XU7 A;  4A0A A;  4GQ2 P;  4AEZ A;  4E54 A;  3IVM A;  4MK0 B;  3A0F A;  5FFG A;  4QT8 A;  3KRX B;  5M5S A;  3K26 A;  2XL2 A;  3RRM C;  3PXS D;  4PBY A;  5C92 A;  1XHM A;  2B5N A;  4BH6 A;  2AGY A;  2GNQ A;  4CZV A;  2OVP B;  3DSM A;  1JJU B;  3ORV D;  4HDJ A;  3RFG A;  1U4C A;  1K32 A;  2P9S C;  3DXM C;  5EAL A;  3SBR A;  3SJL D;  5C9Z B;  3OW8 A;  4UI9 R;  5M61 A;  4A08 A;  1N6E A;  2I0S A;  1K8K C;  2YMU A;  4JT6 C;  3UR4 A;  3KCI A;  4A2M A;  2P9U C;  3I8E A;  4D6V A;  3IUL A;  2UZY B;  2YNP A;  2CN3 A;  4GGD A;  4E5Z B;  3AL8 B;  4FWW A;  4IMM A;  2H6N A;  4X63 B;  4J77 A;  4J81 A;  1R5M A;  2VZ3 A;  3EI3 B;  3JRO A;  4X3E A;  4D9S A;  4A09 B;  2J57 G;  2H14 A;  3IUM A;  3B7F A;  4O3T B;  4BCB A;  4CI3 A;  2H9L A;  4L9O A;  5GXH A;  4FB1 D;  2J55 H;  5K1C C;  3T3P A;  4ERQ A;  3EQ7 A;  3L4M D;  2G99 A;  4FAN D;  4RE5 A;  4Y7R A;  4DNV A;  1Q47 A;  3V5W B;  1SQ9 A;  5CXC A;  3F3P A;  3EQ8 A;  3SBP A;  2HJ4 A;  3NVX A;  3EI2 A;  2H9P A;  4JXM A;  5KDO B;  3MKQ A;  3MUN A;  3ZDZ A;  4YVD A;  4U7A A;  1B9Y A;  4ERY A;  4BP8 A;  4PSW B;  3JZN A;  2I3S A;  4PBZ A;  4O9D A;  5M5U A;  2G9A A;  4PNK B;  1NEX B;  3MXX A;  3IUQ A;  1GXR A;  4CI2 A;  1N6D A;  3ZE2 A;  3UVO A;  3RN1 D;  4NAA A;  2VDL A;  4R7A B;  3K71 A;  5HDB A;  3ZWL B;  2GC7 A;  3I7L A;  1JMZ B;  3OKY A;  4U1E I;  3FRX A;  2P9I C;  5AMS A;  4L1M A;  3UKU C;  3KRW B;  3SWS D;  1SHY B;  3ZE0 A;  3JRP A;  5H14 A;  2P9L C;  3MKS B;  3RSE C;  3FCS A;  4PXW A;  1GOG A;  3VH0 A;  4Y5R D;  3AL9 A;  3IJ1 A;  2OK6 A;  4NEN A;  1GOF A;  2IUP A;  1A12 A;  4ZOV A;  3JZH A;  3IJ0 A;  3W15 A;  5FQD A;  3EMH A;  5B4W A;  1C9L A;  5CXB A;  2EIB A;  5M5T A;  2HJB A;  4GZ8 A;  2BBK H;  3I8C A;  2PBI B;  4JD2 C;  2AH1 A;  4NBM A;  5CYK A;  3GFC A;  2EIC A;  5IT9 g;  3DDU A;  1TYE A;  2H13 A;  2IAA A;  3L4O D;  5EM2 B;  1QNI A;  2Z2O A;  2YB8 B;  2HU8 A;  5FKS A;  5IGQ A;  4GM9 A;  2J56 H;  2BCJ B;  3OL2 B;  4CY3 A;  5A2Q g;  3SN6 B;  4LGN A;  4A2L A;  4AOW A;  3HFQ A;  2XZG A;  1PBY B;  3PSL A;  3K72 A;  1UOP A;  4AMY A;  1MDA H;  3ZDY A;  2P9N C;  4J86 A;  2YNN A;  4MMZ A;  2BKL A;  2YBA A;  5FFO A;  4WK0 A;  2CO0 A;  3I7K A;  3V9F A;  2H6Q A;  1GG2 B;  2CE8 A;  4CI1 A;  3BWS A;  4Z8L A;  4E5Z A;  4A0B B;  2CO0 C;  5EAP A;  4LG9 A;  1RI6 A;  4A11 B;  4A09 A;  5FKT A;  1I2M B;  3IIY A;  2Q7Q A;  4J84 A;  3UKR C;  1K3I A;  3ZE1 A;  3UVM A;  3DM0 A;  4ZOZ A;  4QQE A;  4MMY A;  1B9X A;  3NIG A;  2AQ5 A;  2VC2 A;  5FKQ A;  3C75 H;  4CZY A;  4J78 A;  2XL3 A;  2VDM A;  2TRC B;  4A0A B;  3I89 A;  3C5M A;  4AN1 A;  1UTC A;  3NID A;  4XYI A;  2IUR A;  2MTA H;  4RE6 A;  1OLZ A;  4K3I D;  1MG3 A;  1PEV A;  3PE7 A;  4J8G A;  3SHF A;  3CIK B;  5FKR A;  4H5I A;  4NSX A;  4PSX B;  5TEE A;  3K27 A;  2H9M A;  2UZX B;  3PXT D;  2JKX A;  3MUO A;  3IJE A;  3K6S A;  4A08 B;  2VDN A;  1H2W A;  3MZK A;  3O4G A;  3I7O A;  3VA6 A;  2AH0 A;  1H2Y A;  5E6U A;  2H3X A;  1OMW B;  4UM8 A;  4A7J A;  3I2N A;  4G55 A;  5GXI A;  4FA1 D;  3DXK C;  4CY5 A;  3U4Y A;  3SBQ A;  5EAM A;  4GGA A;  3T3M A;  3EWE A;  2HYE A;  3QHY B;  4ZOY A;  3EI4 B;  4LG8 A;  1NR0 A;  1BPO A;  2OIZ A;  2IWK A;  2HKR A;  3PXW D;  4PC0 A;  4DNU A;  2HU7 A;  5C86 A;  4BP9 A;  2OK4 A;  4H5J A;  5HE2 B;  5K19 A;  5CXC B;  4AN0 A;  3EI1 B;  4ESG A;  5JWZ A;  5GMK n;  3EI2 B;  5HQG A;  5I5I A;  3DWL C;  4XYH A;  4FAV D;  4WK2 A;  3RFH A;  4KFM B;  2IWF A;  4BCD A;  1UOO A;  5TDH B;  2I3T A;  4J73 A;  4WK4 A;  2PM9 B;  4CI8 A;  4O3U B;  2I0R A;  3UVN A;  1MG2 A;  5HE3 B;  1VYH C;  5EMK B;  3OKY B;  3SVW D;  5H1M A;  5I5M A;  1C9I A;  2VDP A;  4GM8 A;  4GQB B;  1E5T A;  1SQJ A;  4JSN C;  1TBG A;  3AFC A;  3P4F A;  3MZL A;  1E8M A;  1H2Z A;  1QFS A;  2AGW A;  3FCU A;  3I7P A;  3NVQ A;  4OZU A;  4G1E A;  3ODT A;  4QRJ A;  5TF2 A; 
#chains in the Genus database with same CATH homology
 5HE1 B;  3SCY A;  2YNO A;  3FGB A;  5IJ8 E;  5EML B;  3UVK A;  2AGZ A;  3RLM D;  4L1Q D;  4L3G D;  5CXB B;  4N14 A;  2XYI A;  5AFU 3;  3SMR A;  4A11 A;  4OWR A;  5EMJ B;  5IJ7 E;  4J8B A;  4K3J B;  1U2V C;  2H6K A;  5THA A;  4CY2 A;  3MMY A;  2P9K C;  5H17 A;  1GOT B;  2IUQ A;  3F3G A;  3AL8 A;  3N0E A;  3OKW A;  3EI3 A;  2HXC A;  3GRE A;  2Z2N A;  1XKS A;  4FHL A;  3J81 g;  4ERZ A;  3I7H A;  4J87 A;  2OVQ B;  3BG1 A;  5EMM B;  2QC5 A;  4GGC A;  3PVW B;  4E54 B;  5FA5 B;  5C2W B;  1JOF A;  3EG6 A;  3SXT D;  4CZX A;  4O45 A;  3FM0 A;  3JAM g;  1PI6 A;  1JMX B;  3RN0 D;  2CN2 A;  3JPX A;  5SXM A;  3IKO A;  3JZG A;  4J79 A;  1N6F A;  3OKT A;  3F3F A;  4J82 A;  2GC4 A;  4BL0 A;  2H9N A;  2B5L A;  4J0X A;  2HKM A;  4BUJ C;  5FLX g;  1S4U X;  3ULE C;  3C99 A;  3E0C A;  1TYQ C;  4JSV C;  4TZ4 A;  4ES0 A;  2AGX A;  3EI4 A;  2AGL A;  2O9K A;  4FA4 D;  2OVR B;  3SFZ A;  2H68 A;  3IIW A;  4QL1 A;  3EI1 A;  2W18 A;  5HE0 B;  4XEI C;  5IC7 A;  2PM6 B;  2QXV A;  3J80 g;  1YFQ A;  3PSC B;  4I79 A;  4CC9 A;  2HES X;  5I5J A;  3CFV A;  4X61 B;  4GM3 A;  2B5M A;  5EAR A;  4L3H D;  2IUV A;  3CFS B;  2I0T A;  2PM9 A;  2CNX A;  3IJC A;  5EM2 A;  4D0K A;  3UVL A;  3AH8 B;  3N0D A;  2CE9 A;  5GSA A;  4GMB A;  3OL2 A;  1ERJ A;  4G56 B;  4EWR A;  4J0W A;  4ZN4 A;  3PVU B;  1P22 A;  3C9C A;  5FXY A;  4JSP C;  1A0R B;  4X60 B;  3EU7 A;  4O1Q D;  1FWX A;  2H47 A;  4ZOX A;  4IA9 A;  1GP2 B;  3JB9 L;  3NVN A;  4GQ1 A;  2OJY A;  3I7N A;  4JT5 C;  2B4E A;  2P9P C;  2Z2P A;  5IGO A;  5TEF A;  5AJA A;  3VGZ A;  4A0B A;  3RMZ D;  4CY1 A;  1L0Q A;  5C2V B;  5HYN B;  3OTT A;  5CYK B;  3V7D B;  1PGU A;  2EBS A;  2PM7 B;  4FA9 D;  1XIP A;  3SLE D;  3BG0 A;  4JSX C;  4FA5 D;  2XU7 A;  4A0A A;  4GQ2 P;  4AEZ A;  4E54 A;  4MK0 B;  3A0F A;  4QT8 A;  3KRX B;  3K26 A;  2XL2 A;  3RRM C;  3PXS D;  4PBY A;  1XHM A;  2B5N A;  4BH6 A;  2AGY A;  2GNQ A;  4CZV A;  2OVP B;  3DSM A;  1JJU B;  3ORV D;  4HDJ A;  3RFG A;  1U4C A;  1K32 A;  2P9S C;  3DXM C;  5EAL A;  3SBR A;  3SJL D;  5C9Z B;  3OW8 A;  4UI9 R;  4A08 A;  1N6E A;  2I0S A;  1K8K C;  2YMU A;  4JT6 C;  3UR4 A;  4A2M A;  2P9U C;  3I8E A;  4D6V A;  2UZY B;  2YNP A;  2CN3 A;  4GGD A;  4E5Z B;  3AL8 B;  4FWW A;  4IMM A;  2H6N A;  4X63 B;  4J77 A;  4J81 A;  1R5M A;  3JRO A;  3EI3 B;  4X3E A;  4A09 B;  2J57 G;  2H14 A;  3B7F A;  4O3T B;  4CI3 A;  2H9L A;  4L9O A;  5GXH A;  4FB1 D;  2J55 H;  5K1C C;  4ERQ A;  3L4M D;  2G99 A;  4FAN D;  4Y7R A;  1Q47 A;  3V5W B;  1SQ9 A;  5CXC A;  3F3P A;  3SBP A;  2HJ4 A;  3NVX A;  3EI2 A;  2H9P A;  4JXM A;  5KDO B;  3MKQ A;  4YVD A;  4U7A A;  1B9Y A;  4ERY A;  4PSW B;  3JZN A;  2I3S A;  4PBZ A;  4O9D A;  2G9A A;  4PNK B;  1NEX B;  3MXX A;  1GXR A;  4CI2 A;  1N6D A;  3UVO A;  3RN1 D;  4R7A B;  3ZWL B;  2GC7 A;  3I7L A;  1JMZ B;  3OKY A;  4U1E I;  3FRX A;  2P9I C;  5AMS A;  3UKU C;  3KRW B;  3SWS D;  1SHY B;  3JRP A;  5H14 A;  2P9L C;  3MKS B;  3RSE C;  4PXW A;  3VH0 A;  4Y5R D;  3AL9 A;  3IJ1 A;  2OK6 A;  2IUP A;  4ZOV A;  3JZH A;  3IJ0 A;  3W15 A;  5FQD A;  3EMH A;  5B4W A;  5CXB A;  2HJB A;  4GZ8 A;  2BBK H;  3I8C A;  2PBI B;  4JD2 C;  2AH1 A;  5CYK A;  3GFC A;  5IT9 g;  2H13 A;  2IAA A;  3L4O D;  5EM2 B;  1QNI A;  2Z2O A;  2YB8 B;  5FKS A;  5IGQ A;  4GM9 A;  2J56 H;  2BCJ B;  3OL2 B;  4CY3 A;  5A2Q g;  3SN6 B;  4LGN A;  4A2L A;  4AOW A;  3HFQ A;  1PBY B;  3PSL A;  1MDA H;  2P9N C;  4J86 A;  2YNN A;  2YBA A;  2CO0 A;  3I7K A;  3V9F A;  2H6Q A;  1GG2 B;  2CE8 A;  4CI1 A;  3BWS A;  4Z8L A;  4E5Z A;  4A0B B;  2CO0 C;  5EAP A;  4LG9 A;  1RI6 A;  4A11 B;  4A09 A;  5FKT A;  3IIY A;  4J84 A;  2Q7Q A;  3UKR C;  3UVM A;  3DM0 A;  4ZOZ A;  4QQE A;  1B9X A;  2AQ5 A;  5FKQ A;  3C75 H;  4CZY A;  4J78 A;  2XL3 A;  2TRC B;  4A0A B;  3I89 A;  3C5M A;  4XYI A;  2IUR A;  2MTA H;  1OLZ A;  4K3I D;  1MG3 A;  1PEV A;  3PE7 A;  4J8G A;  3SHF A;  3CIK B;  5FKR A;  4H5I A;  4NSX A;  4PSX B;  5TEE A;  3K27 A;  2H9M A;  2UZX B;  3PXT D;  4A08 B;  3MZK A;  3I7O A;  3VA6 A;  2AH0 A;  2H3X A;  1OMW B;  4A7J A;  3I2N A;  5GXI A;  4FA1 D;  3DXK C;  4CY5 A;  3U4Y A;  3SBQ A;  5EAM A;  4GGA A;  2HYE A;  3EWE A;  4ZOY A;  3EI4 B;  4LG8 A;  1NR0 A;  2OIZ A;  2IWK A;  2HKR A;  3PXW D;  4PC0 A;  2OK4 A;  4H5J A;  5HE2 B;  5K19 A;  5CXC B;  3EI1 B;  4ESG A;  5JWZ A;  5GMK n;  3EI2 B;  5HQG A;  5I5I A;  3DWL C;  4XYH A;  4FAV D;  3RFH A;  4KFM B;  2IWF A;  5TDH B;  2I3T A;  4J73 A;  2PM9 B;  4CI8 A;  4O3U B;  2I0R A;  3UVN A;  1MG2 A;  5HE3 B;  1VYH C;  5EMK B;  3OKY B;  3SVW D;  5H1M A;  5I5M A;  4GM8 A;  4GQB B;  4JSN C;  1SQJ A;  1TBG A;  3AFC A;  3P4F A;  3MZL A;  2AGW A;  3I7P A;  3NVQ A;  4OZU A;  3ODT A;  4QRJ A;  5TF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...