4ESGA

X-ray structure of wdr5-mll1 win motif peptide binary complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
molecule keywords WD repeat-containing protein 5
total genus 104
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4esgA00
4XYHA 3UKRC 3MZKA 2EBSA 4A7JA 4UI9R 3RN0D 3NVXA 3RSEC 3RN1D 2I3SA 1TBGA 2TRCB 2W18A 3C99A 4ZOXA 1XHMA 4JSXC 2G99A 5GXIA 2HESX 3RLMD 4PXWA 1QNIA 4J84A 4A09A 5AFU3 3UR4A 4J8GA 2G9AA 4Z8LA 4J79A 4X60B 3JB9L 4Y7RA 3MMYA 3B7FA 4CI1A 3JZNA 3DSMA 1JJUB 3UVOA 2QXVA 3ZWLB 1L0QA 5EMLB 3AFCA 3J80g 3JRPA 1FWXA 2J56H 4J86A 1GOTB 3JPXA 4J0XA 4XEIC 1N6DA 3N0DA 4PC0A 3K26A 2CO0A 5EM2B 3RMZD 3OW8A 4O3UB 3C75H 4U7AA 3JAMg 2AGYA 4J81A 2AGZA 2CNXA 5H17A 2OIZA 4AEZA 4GM9A 3EG6A 4PSWB 4L3HD 3EU7A 3AH8B 3FM0A 4D0KA 5IC7A 4GQ2P 3EI2B 3SFZA 4CC9A 4O9DA 4FHLA 2OJYA 4NSXA 3AL8B 2YNNA 3I7NA 5FQDA 3IJ0A 3I8EA 3JROA 3DWLC 2OVQB 3DXMC 1ERJA 4GQBB 3RFGA 2OK4A 4ERZA 3PXWD 4FB1D 1NEXB 3MXXA 1JMZB 3ODTA 3I7OA 3UVMA 2XU7A 4BH6A 2P9KC 1GG2B 5THAA 3L4MD 3CFSB 2AH1A 4CZVA 1OLZA 3FRXA 4GZ8A 4X3EA 2PBIB 4H5JA 3UVKA 4H5IA 4O1QD 3JZHA 4J73A 1Q47A 3FGBA 5EARA 2B4EA 4BUJC 4QQEA 1A0RB 4J87A 3J81g 4A0BB 4FWWA 2I0RA 1SHYB 3IIYA 1P22A 2P9SC 2P9NC 3JZGA 2GNQA 3CIKB 3EWEA 3SVWD 3DXKC 4A08B 2H3XA 2P9LC 1K32A 2HJBA 2GC7A 4Y5RD 2MTAH 3V7DB 3BG1A 4A2LA 5H14A 3IJCA 3IKOA 3EI3B 4PBYA 3NVNA 5GMKn 2UZXB 2HYEA 5HE1B 5AMSA 4U1EI 3OKWA 2IUQA 4J8BA 4ERQA 5GSAA 3IJ1A 3EI4B 3RFHA 5AJAA 3UVNA 3SJLD 3ULEC 4CI8A 3MKSB 4TZ4A 2B5LA 2H14A 4BL0A 5CXBA 4OZUA 3C9CA 4A2MA 3A0FA 5IJ8E 2OK6A 3P4FA 2IAAA 4A11A 3PVUB 1PGUA 2YMUA 4IMMA 5EMJB 2YBAA 1YFQA 1XKSA 3F3GA 1JMXB 4JD2C 4JT6C 2HJ4A 3SMRA 4PNKB 2XL2A 3I7PA 2H9MA 2IUVA 4A11B 1B9XA 5C2VB 1N6FA 4J77A 4FAVD 3I8CA 4AOWA 3BG0A 4QL1A 4A0BA 2BBKH 3VH0A 5GXHA 3I7KA 3PXSD 2H68A 3EI2A 4GGDA 2HXCA 3EI4A 4CY2A 4J78A 3AL8A 4X61B 3EI1B 4PBZA 2IWFA 4A08A 5K19A 5TEFA 4G56B 3PXTD 3SBPA 3PE7A 2H47A 3CFVA 3ORVD 4FAND 3F3FA 4QRJA 3EI1A 2Z2NA 5FKTA 3VA6A 3I2NA 2IWKA 4EWRA 5I5MA 4CI3A 4IA9A 4CZYA 3KRXB 5IGQA 2YNPA 4MK0B 1MDAH 5CXCA 4QT8A 1TYQC 2PM7B 2Z2PA 2IURA 5SXMA 4ZOVA 3I7HA 4CY1A 2P9PC 5A2Qg 2H6QA 5CXBB 5HE0B 2XL3A 4N14A 5I5JA 1B9YA 4ESGA 2I0SA 2CE8A 2PM6B 2J57G 1OMWB 2P9UC 3AL9A 1PEVA 5FA5B 3SCYA 3L4OD 4ZOYA 5TEEA 3PSCB 3SWSD 4JT5C 2AGLA 3PSLA 5K1CC 3OL2A 1GP2B 3V9FA 3OKTA 5IT9g 3OKYB 3DM0A 4PSXB 2P9IC 5KDOB 2B5MA 2CN3A 5IGOA 3SBQA 3OL2B 1MG3A 5CXCB 2UZYB 4ZOZA 2CE9A 4GQ1A 3OKYA 5CYKA 4KFMB 3V5WB 1RI6A 3EI3A 3GFCA 4GGCA 2BCJB 4J0WA 4E54B 4YVDA 2AQ5A 2CN2A 5HYNB 1NR0A 2AH0A 2PM9B 3U4YA 2HKMA 3BWSA 5CYKB 5EMKB 5TF2A 5FXYA 5IJ7E 1R5MA 3I7LA 2OVPB 2AGXA 5TDHB 4LG9A 1N6EA 4A0AB 4LG8A 1MG2A 5HE3B 4O3TB 2GC4A 2QC5A 4GGAA 3I89A 3F3PA 5FKQA 4L1QD 2J55H 3SXTD 5H1MA 1JOFA 5B4WA 4I79A 3EMHA 4D6VA 2O9KA 2H13A 3RRMC 4ES0A 1U2VC 2H6KA 1GXRA 3E0CA 2B5NA 4E5ZA 4JSNC 2AGWA 4ZN4A 4LGNA 5FLXg 2YNOA 3UKUC 1SQJA 4K3ID 2I3TA 3VGZA 3MZLA 2PM9A 4E5ZB 1S4UX 4FA5D 4CY5A 5C2WB 4OWRA 2H9PA 4GMBA 4FA9D 4O45A 4FA4D 4R7AB 2Z2OA 5FKSA 2H6NA 4L9OA 5EAPA 3MKQA 3SLED 2H9LA 2XYIA 4CI2A 1U4CA 1SQ9A 3UVLA 4E54A 2HKRA 1PBYB 2H9NA 3KRWB 1PI6A 4JSVC 3OTTA 5HQGA 4A09B 2OVRB 5JWZA 5I5IA 4L3GD 4CY3A 3GREA 4GM3A 4HDJA 3W15A 1XIPA 4K3JB 2I0TA 4JXMA 5C9ZB 3SBRA 2IUPA 4ERYA 5HE2B 2CO0C 3K27A 4A0AA 5EAMA 5EMMB 3N0EA 1VYHC 5FKRA 4X63B 3HFQA 4J82A 4XYIA 3PVWB 4CZXA 3C5MA 3IIWA 3NVQA 1K8KC 4FA1D 3SN6B 5EALA 2YB8B 5EM2A 4GM8A 3SHFA 2Q7QA 4JSPC
chains in the Genus database with same CATH superfamily
4XYHA 3UKRC 3MZKA 2EBSA 1H2XA 4A7JA 4UI9R 2VDQA 3RN0D 3QI0A 3NVXA 3RSEC 2XE4A 3RN1D 5C86A 3ZDYA 3ZDZA 2I3SA 1TBGA 1U8CA 2TRCB 2W18A 3C99A 3FCSA 4L1MA 4ZOXA 1XHMA 4Z7OA 4JSXC 2G99A 5GXIA 2HESX 3RLMD 4PXWA 2XDWA 1QNIA 4J84A 4A09A 5AFU3 3UR4A 4J8GA 2G9AA 4Z8LA 4J79A 4X60B 5FFOA 3JB9L 4Y7RA 3MMYA 3B7FA 2HU8A 3IUQA 3KCIA 4CI1A 3JZNA 3DSMA 1JJUB 3UVOA 2QXVA 3ZWLB 1L0QA 1GOGA 5EMLB 1GOFA 1UTCA 3AFCA 3J80g 3JRPA 3O4GA 1FWXA 2J56H 4J86A 4WJKA 3O4HA 5HDBA 1GOTB 5FFGA 3JPXA 4J0XA 4XEIC 1N6DA 3N0DA 4PC0A 3K26A 4BP8A 2CO0A 5EM2B 3RMZD 3OW8A 4AX4A 4O3UB 3C75H 4D9SA 4U7AA 4AN1A 3JAMg 4JHNA 2AGYA 4J81A 2AGZA 2CNXA 2HU5A 5H17A 2OIZA 4AEZA 4GM9A 3EG6A 4PSWB 4L3HD 1H2ZA 3AH8B 3EU7A 3VI4A 3FM0A 4D0KA 5IC7A 4GQ2P 3EI2B 3SFZA 4CC9A 4O9DA 4BCDA 1UOPA 4FHLA 4DNUA 2OJYA 4NAAA 4NSXA 3AL8B 1YR2A 2YNNA 3I7NA 5FQDA 3ZE2A 4AMZA 3IJ0A 3I8EA 3JROA 3DWLC 2OVQB 3DXMC 2VDKA 1ERJA 4GQBB 3RFGA 2OK4A 4ERZA 1UOQA 3PXWD 3QHYB 4NC4A 3K71A 4FB1D 1NEXB 3MXXA 1JMZB 1JV2A 3ODTA 3I7OA 3UVMA 2XU7A 4BH6A 2P9KC 1GG2B 5THAA 3MVDK 3L4MD 3CFSB 1VE7A 2AH1A 4CZVA 1OLZA 2EICA 3FRXA 4GZ8A 4X3EA 2PBIB 4H5JA 2VDPA 2BKLA 3UVKA 4H5IA 4O1QD 3JZHA 4J73A 1Q47A 2EIEA 3FGBA 5EARA 2B4EA 4BUJC 1BPOA 4QQEA 1A0RB 4J87A 3J81g 4A0BB 1VZ3A 4FWWA 2I0RA 3V4PA 1SHYB 3IIYA 1P22A 2P9SC 2P9NC 2EIDA 3JZGA 2GNQA 3CIKB 2JKXA 3EWEA 3SVWD 3DXKC 4A08B 2H3XA 2P9LC 1K32A 2HJBA 3IJEA 2GC7A 4Y5RD 4G55A 1E5TA 1TYEA 2MTAH 3V7DB 4G1MA 3BG1A 4A2LA 4MMXA 5C92A 1H2YA 1I2MB 5H14A 3IJCA 3IKOA 3NIDA 3V4VA 1O6GA 4NENA 3EI3B 3K72A 4PBYA 3NVNA 5GMKn 2UZXB 2HYEA 5HE1B 5AMSA 4U1EI 3OKWA 2IUQA 4J8BA 3MUNA 4ERQA 5GSAA 1JTDB 3IJ1A 3EI4B 3RFHA 5AJAA 4UM8A 3UVNA 4Z7QA 3SJLD 3ULEC 4QAMA 4CI8A 3MKSB 1H2WA 4TZ4A 2B5LA 3ZDXA 2H14A 1E8NA 2XZGA 2VC2A 4BL0A 1L5GA 5CXBA 4OZUA 3T3MA 4JHPC 3C9CA 4A2MA 3A0FA 5IJ8E 2VDMA 2OK6A 3P4FA 2IAAA 4A11A 3PVUB 1PGUA 2WQ8A 2YMUA 4IMMA 4RE6A 5EMJB 2YBAA 1YFQA 1XKSA 3F3GA 1JMXB 4JD2C 4JT6C 4NBMA 2HJ4A 3SMRA 4PNKB 2XL2A 3O4JA 3I7PA 4O2WA 2H9MA 2IUVA 4MMZA 4A11B 1B9XA 5C2VB 4WK2A 1N6FA 4J77A 2VDLA 4Z7NA 1C9LA 4WK4A 4FAVD 3I8CA 4AOWA 3BG0A 4QL1A 4A0BA 2BBKH 2EIBA 3VH0A 5GXHA 3I7KA 1K3IA 3PXSD 2H68A 3EI2A 4G1EA 4GGDA 2HXCA 3EI4A 4CY2A 5M5UA 4J78A 3AL8A 4X61B 1T2XA 3EI1B 4PBZA 2IWFA 4A08A 3NIFA 5K19A 5TEFA 3IUMA 1VZ2A 5M5VA 4G56B 3PXTD 3SBPA 3PE7A 2H47A 3CFVA 3ORVD 3DDUA 4FAND 3F3FA 4QRJA 3EI1A 2Z2NA 5FKTA 3VA6A 3I2NA 2IWKA 4EWRA 5I5MA 4CI3A 4IA9A 4CZYA 3KRXB 5IGQA 2YNPA 4MK0B 1MDAH 5CXCA 4QT8A 3IUJA 1TYQC 2PM7B 2Z2PA 2IURA 5SXMA 1M1XA 4ZOVA 1VE6A 3ZE0A 3I7HA 4MMYA 1QFMA 5M61A 2P9PC 4CY1A 5A2Qg 2H6QA 5CXBB 5HE0B 2XL3A 4N14A 5I5JA 1B9YA 3IULA 4ESGA 2I0SA 2CE8A 2PM6B 5M5SA 2J57G 1OMWB 2P9UC 3AL9A 1PEVA 5FA5B 4BP9A 4UM9A 3SCYA 1GOHA 3L4OD 4ZOYA 5TEEA 3PSCB 3SWSD 4AN0A 4JT5C 2AGLA 3PSLA 1UOOA 3OL2A 5K1CC 1GP2B 3V9FA 3OKTA 5IT9g 3OKYB 3NIGA 3DM0A 4PSXB 3ZE1A 2P9IC 5KDOB 2VZ3A 2B5MA 2CN3A 5IGOA 3SBQA 3OL2B 1MG3A 5CXCB 2UZYB 4ZOZA 2CE9A 4GQ1A 3OKYA 5CYKA 4KFMB 3V5WB 1RI6A 3EI3A 3GFCA 4GGCA 2BCJB 4RE5A 4J0WA 4E54B 4YVDA 2AQ5A 2CN2A 5HYNB 1NR0A 1O6FA 2AH0A 2PM9B 3U4YA 2HKMA 3BWSA 5CYKB 3IUNA 3K6SA 5EMKB 5TF2A 5FXYA 5IJ7E 1R5MA 3I7LA 2OVPB 2AGXA 5TDHB 4LG9A 1N6EA 1E8MA 4A0AB 4LG8A 1MG2A 5HE3B 4O3TB 2GC4A 3IURA 2QC5A 4GGAA 3I89A 3F3PA 5FKQA 4L1QD 2J55H 3SXTD 5H1MA 4AMYA 1JOFA 5B4WA 4I79A 3T3PA 3EMHA 4D6VA 2O9KA 2H13A 3RRMC 4ES0A 1U2VC 3EQ7A 1GXRA 2H6KA 5E6RA 3E0CA 2B5NA 4E5ZA 4JSNC 4O02A 2AGWA 4ZN4A 4LGNA 5FLXg 2YNOA 3UKUC 1SQJA 3EQ8A 4K3ID 2I3TA 3FCUA 3VGZA 3MZLA 2VZ1A 2PM9A 5E6UA 2VDRA 4E5ZB 1S4UX 4FA5D 4CY5A 2VDOA 5C2WB 4OWRA 1A12A 2H9PA 4GMBA 4FA9D 4O45A 4FA4D 4R7AB 2Z2OA 2QZPA 5FKSA 3GD1I 2H6NA 4L9OA 1QFSA 5EAPA 4WK0A 3MKQA 3SLED 3VI3A 3EQ9A 2H9LA 2XYIA 4CI2A 3OF7A 1C9IA 4DNVA 1U4CA 1SQ9A 3UVLA 4BCBA 4E54A 2HKRA 1PBYB 2H9NA 2VDNA 3GC3B 1PI6A 3KRWB 4JSVC 5M5RA 5E6SA 3OTTA 5HQGA 4A09B 2OVRB 5JWZA 2HU7A 3O4IA 4L3GD 3GREA 4GM3A 4CY3A 5I5IA 4HDJA 3W15A 1XIPA 4K3JB 2I0TA 4JXMA 5C9ZB 3MUOA 3SBRA 2IUPA 4ERYA 4BCCA 5M5TA 5HE2B 2CO0C 3K27A 4DNWA 4A0AA 5EAMA 5EMMB 3N0EA 1VYHC 5FKRA 4X63B 3HFQA 4J82A 4XYIA 3PVWB 4CZXA 2QR5A 3C5MA 3IIWA 3NVQA 1K8KC 4FA1D 3SN6B 5EALA 2YB8B 5EM2A 4GM8A 3SHFA 2Q7QA 4IRZA 3IVMA 4JSPC
chains in the Genus database with same CATH topology
4XYHA 3UKRC 3MZKA 2EBSA 4A7JA 4UI9R 3RN0D 3NVXA 3RSEC 3RN1D 2I3SA 1TBGA 2TRCB 2W18A 3C99A 4ZOXA 1XHMA 4JSXC 2G99A 5GXIA 2HESX 3RLMD 4PXWA 1QNIA 4J84A 4A09A 5AFU3 3UR4A 4J8GA 2G9AA 4Z8LA 4J79A 4X60B 3JB9L 4Y7RA 3MMYA 3B7FA 4CI1A 3JZNA 3DSMA 1JJUB 3UVOA 2QXVA 3ZWLB 1L0QA 5EMLB 3AFCA 3J80g 3JRPA 1FWXA 2J56H 4J86A 1GOTB 3JPXA 4J0XA 4XEIC 1N6DA 3N0DA 4PC0A 3K26A 2CO0A 5EM2B 3RMZD 3OW8A 4O3UB 3C75H 4U7AA 3JAMg 2AGYA 4J81A 2AGZA 2CNXA 5H17A 2OIZA 4AEZA 4GM9A 3EG6A 4PSWB 4L3HD 3EU7A 3AH8B 3FM0A 4D0KA 5IC7A 4GQ2P 3EI2B 3SFZA 4CC9A 4O9DA 4FHLA 2OJYA 4NSXA 3AL8B 2YNNA 3I7NA 5FQDA 3IJ0A 3I8EA 3JROA 3DWLC 2OVQB 3DXMC 1ERJA 4GQBB 3RFGA 2OK4A 4ERZA 3PXWD 4FB1D 1NEXB 3MXXA 1JMZB 3ODTA 3I7OA 3UVMA 2XU7A 4BH6A 2P9KC 1GG2B 5THAA 3L4MD 3CFSB 2AH1A 4CZVA 1OLZA 3FRXA 4GZ8A 4X3EA 2PBIB 4H5JA 3UVKA 4H5IA 4O1QD 3JZHA 4J73A 1Q47A 3FGBA 5EARA 2B4EA 4BUJC 4QQEA 1A0RB 4J87A 3J81g 4A0BB 4FWWA 2I0RA 1SHYB 3IIYA 1P22A 2P9SC 2P9NC 3JZGA 2GNQA 3CIKB 3EWEA 3SVWD 3DXKC 4A08B 2H3XA 2P9LC 1K32A 2HJBA 2GC7A 4Y5RD 2MTAH 3V7DB 3BG1A 4A2LA 5H14A 3IJCA 3IKOA 3EI3B 4PBYA 3NVNA 5GMKn 2UZXB 2HYEA 5HE1B 5AMSA 4U1EI 3OKWA 2IUQA 4J8BA 4ERQA 5GSAA 3IJ1A 3EI4B 3RFHA 5AJAA 3UVNA 3SJLD 3ULEC 4CI8A 3MKSB 4TZ4A 2B5LA 2H14A 4BL0A 5CXBA 4OZUA 3C9CA 4A2MA 3A0FA 5IJ8E 2OK6A 3P4FA 2IAAA 4A11A 3PVUB 1PGUA 2YMUA 4IMMA 5EMJB 2YBAA 1YFQA 1XKSA 3F3GA 1JMXB 4JD2C 4JT6C 2HJ4A 3SMRA 4PNKB 2XL2A 3I7PA 2H9MA 2IUVA 4A11B 1B9XA 5C2VB 1N6FA 4J77A 4FAVD 3I8CA 4AOWA 3BG0A 4QL1A 4A0BA 2BBKH 3VH0A 5GXHA 3I7KA 3PXSD 2H68A 3EI2A 4GGDA 2HXCA 3EI4A 4CY2A 4J78A 3AL8A 4X61B 3EI1B 4PBZA 2IWFA 4A08A 5K19A 5TEFA 4G56B 3PXTD 3SBPA 3PE7A 2H47A 3CFVA 3ORVD 4FAND 3F3FA 4QRJA 3EI1A 2Z2NA 5FKTA 3VA6A 3I2NA 2IWKA 4EWRA 5I5MA 4CI3A 4IA9A 4CZYA 3KRXB 5IGQA 2YNPA 4MK0B 1MDAH 5CXCA 4QT8A 1TYQC 2PM7B 2Z2PA 2IURA 5SXMA 4ZOVA 3I7HA 4CY1A 2P9PC 5A2Qg 2H6QA 5CXBB 5HE0B 2XL3A 4N14A 5I5JA 1B9YA 4ESGA 2I0SA 2CE8A 2PM6B 2J57G 1OMWB 2P9UC 3AL9A 1PEVA 5FA5B 3SCYA 3L4OD 4ZOYA 5TEEA 3PSCB 3SWSD 4JT5C 2AGLA 3PSLA 5K1CC 3OL2A 1GP2B 3V9FA 3OKTA 5IT9g 3OKYB 3DM0A 4PSXB 2P9IC 5KDOB 2B5MA 2CN3A 5IGOA 3SBQA 3OL2B 1MG3A 5CXCB 2UZYB 4ZOZA 2CE9A 4GQ1A 3OKYA 5CYKA 4KFMB 3V5WB 1RI6A 3EI3A 3GFCA 4GGCA 2BCJB 4J0WA 4E54B 4YVDA 2AQ5A 2CN2A 5HYNB 1NR0A 2AH0A 2PM9B 3U4YA 2HKMA 3BWSA 5CYKB 5EMKB 5TF2A 5FXYA 5IJ7E 1R5MA 3I7LA 2OVPB 2AGXA 5TDHB 4LG9A 1N6EA 4A0AB 4LG8A 1MG2A 5HE3B 4O3TB 2GC4A 2QC5A 4GGAA 3I89A 3F3PA 5FKQA 4L1QD 2J55H 3SXTD 5H1MA 1JOFA 5B4WA 4I79A 3EMHA 4D6VA 2O9KA 2H13A 3RRMC 4ES0A 1U2VC 2H6KA 1GXRA 3E0CA 2B5NA 4E5ZA 4JSNC 2AGWA 4ZN4A 4LGNA 5FLXg 2YNOA 3UKUC 1SQJA 4K3ID 2I3TA 3VGZA 3MZLA 2PM9A 4E5ZB 1S4UX 4FA5D 4CY5A 5C2WB 4OWRA 2H9PA 4GMBA 4FA9D 4O45A 4FA4D 4R7AB 2Z2OA 5FKSA 2H6NA 4L9OA 5EAPA 3MKQA 3SLED 2H9LA 2XYIA 4CI2A 1U4CA 1SQ9A 3UVLA 4E54A 2HKRA 1PBYB 2H9NA 3KRWB 1PI6A 4JSVC 3OTTA 5HQGA 4A09B 2OVRB 5JWZA 5I5IA 4L3GD 4CY3A 3GREA 4GM3A 4HDJA 3W15A 1XIPA 4K3JB 2I0TA 4JXMA 5C9ZB 3SBRA 2IUPA 4ERYA 5HE2B 2CO0C 3K27A 4A0AA 5EAMA 5EMMB 3N0EA 1VYHC 5FKRA 4X63B 3HFQA 4J82A 4XYIA 3PVWB 4CZXA 3C5MA 3IIWA 3NVQA 1K8KC 4FA1D 3SN6B 5EALA 2YB8B 5EM2A 4GM8A 3SHFA 2Q7QA 4JSPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYH A;  3UKR C;  3MZK A;  2EBS A;  4A7J A;  4UI9 R;  3RN0 D;  3NVX A;  3RSE C;  3RN1 D;  2I3S A;  1TBG A;  2TRC B;  2W18 A;  3C99 A;  4ZOX A;  1XHM A;  4JSX C;  2G99 A;  5GXI A;  2HES X;  3RLM D;  4PXW A;  1QNI A;  4J84 A;  4A09 A;  5AFU 3;  3UR4 A;  4J8G A;  2G9A A;  4Z8L A;  4J79 A;  4X60 B;  3JB9 L;  4Y7R A;  3MMY A;  3B7F A;  4CI1 A;  3JZN A;  3DSM A;  1JJU B;  3UVO A;  2QXV A;  3ZWL B;  1L0Q A;  5EML B;  3AFC A;  3J80 g;  3JRP A;  1FWX A;  2J56 H;  4J86 A;  1GOT B;  3JPX A;  4J0X A;  4XEI C;  1N6D A;  3N0D A;  4PC0 A;  3K26 A;  2CO0 A;  5EM2 B;  3RMZ D;  3OW8 A;  4O3U B;  3C75 H;  4U7A A;  3JAM g;  2AGY A;  4J81 A;  2AGZ A;  2CNX A;  5H17 A;  2OIZ A;  4AEZ A;  4GM9 A;  3EG6 A;  4PSW B;  4L3H D;  3EU7 A;  3AH8 B;  3FM0 A;  4D0K A;  5IC7 A;  4GQ2 P;  3EI2 B;  3SFZ A;  4CC9 A;  4O9D A;  4FHL A;  2OJY A;  4NSX A;  3AL8 B;  2YNN A;  3I7N A;  5FQD A;  3IJ0 A;  3I8E A;  3JRO A;  3DWL C;  2OVQ B;  3DXM C;  1ERJ A;  4GQB B;  3RFG A;  2OK4 A;  4ERZ A;  3PXW D;  4FB1 D;  1NEX B;  3MXX A;  1JMZ B;  3ODT A;  3I7O A;  3UVM A;  2XU7 A;  4BH6 A;  2P9K C;  1GG2 B;  5THA A;  3L4M D;  3CFS B;  2AH1 A;  4CZV A;  1OLZ A;  3FRX A;  4GZ8 A;  4X3E A;  2PBI B;  4H5J A;  3UVK A;  4H5I A;  4O1Q D;  3JZH A;  4J73 A;  1Q47 A;  3FGB A;  5EAR A;  2B4E A;  4BUJ C;  4QQE A;  1A0R B;  4J87 A;  3J81 g;  4A0B B;  4FWW A;  2I0R A;  1SHY B;  3IIY A;  1P22 A;  2P9S C;  2P9N C;  3JZG A;  2GNQ A;  3CIK B;  3EWE A;  3SVW D;  3DXK C;  4A08 B;  2H3X A;  2P9L C;  1K32 A;  2HJB A;  2GC7 A;  4Y5R D;  2MTA H;  3V7D B;  3BG1 A;  4A2L A;  5H14 A;  3IJC A;  3IKO A;  3EI3 B;  4PBY A;  3NVN A;  5GMK n;  2UZX B;  2HYE A;  5HE1 B;  5AMS A;  4U1E I;  3OKW A;  2IUQ A;  4J8B A;  4ERQ A;  5GSA A;  3IJ1 A;  3EI4 B;  3RFH A;  5AJA A;  3UVN A;  3SJL D;  3ULE C;  4CI8 A;  3MKS B;  4TZ4 A;  2B5L A;  2H14 A;  4BL0 A;  5CXB A;  4OZU A;  3C9C A;  4A2M A;  3A0F A;  5IJ8 E;  2OK6 A;  3P4F A;  2IAA A;  4A11 A;  3PVU B;  1PGU A;  2YMU A;  4IMM A;  5EMJ B;  2YBA A;  1YFQ A;  1XKS A;  3F3G A;  1JMX B;  4JD2 C;  4JT6 C;  2HJ4 A;  3SMR A;  4PNK B;  2XL2 A;  3I7P A;  2H9M A;  2IUV A;  4A11 B;  1B9X A;  5C2V B;  1N6F A;  4J77 A;  4FAV D;  3I8C A;  4AOW A;  3BG0 A;  4QL1 A;  4A0B A;  2BBK H;  3VH0 A;  5GXH A;  3I7K A;  3PXS D;  2H68 A;  3EI2 A;  4GGD A;  2HXC A;  3EI4 A;  4CY2 A;  4J78 A;  3AL8 A;  4X61 B;  3EI1 B;  4PBZ A;  2IWF A;  4A08 A;  5K19 A;  5TEF A;  4G56 B;  3PXT D;  3SBP A;  3PE7 A;  2H47 A;  3CFV A;  3ORV D;  4FAN D;  3F3F A;  4QRJ A;  3EI1 A;  2Z2N A;  5FKT A;  3VA6 A;  3I2N A;  2IWK A;  4EWR A;  5I5M A;  4CI3 A;  4IA9 A;  4CZY A;  3KRX B;  5IGQ A;  2YNP A;  4MK0 B;  1MDA H;  5CXC A;  4QT8 A;  1TYQ C;  2PM7 B;  2Z2P A;  2IUR A;  5SXM A;  4ZOV A;  3I7H A;  4CY1 A;  2P9P C;  5A2Q g;  2H6Q A;  5CXB B;  5HE0 B;  2XL3 A;  4N14 A;  5I5J A;  1B9Y A;  4ESG A;  2I0S A;  2CE8 A;  2PM6 B;  2J57 G;  1OMW B;  2P9U C;  3AL9 A;  1PEV A;  5FA5 B;  3SCY A;  3L4O D;  4ZOY A;  5TEE A;  3PSC B;  3SWS D;  4JT5 C;  2AGL A;  3PSL A;  5K1C C;  3OL2 A;  1GP2 B;  3V9F A;  3OKT A;  5IT9 g;  3OKY B;  3DM0 A;  4PSX B;  2P9I C;  5KDO B;  2B5M A;  2CN3 A;  5IGO A;  3SBQ A;  3OL2 B;  1MG3 A;  5CXC B;  2UZY B;  4ZOZ A;  2CE9 A;  4GQ1 A;  3OKY A;  5CYK A;  4KFM B;  3V5W B;  1RI6 A;  3EI3 A;  3GFC A;  4GGC A;  2BCJ B;  4J0W A;  4E54 B;  4YVD A;  2AQ5 A;  2CN2 A;  5HYN B;  1NR0 A;  2AH0 A;  2PM9 B;  3U4Y A;  2HKM A;  3BWS A;  5CYK B;  5EMK B;  5TF2 A;  5FXY A;  5IJ7 E;  1R5M A;  3I7L A;  2OVP B;  2AGX A;  5TDH B;  4LG9 A;  1N6E A;  4A0A B;  4LG8 A;  1MG2 A;  5HE3 B;  4O3T B;  2GC4 A;  2QC5 A;  4GGA A;  3I89 A;  3F3P A;  5FKQ A;  4L1Q D;  2J55 H;  3SXT D;  5H1M A;  1JOF A;  5B4W A;  4I79 A;  3EMH A;  4D6V A;  2O9K A;  2H13 A;  3RRM C;  4ES0 A;  1U2V C;  2H6K A;  1GXR A;  3E0C A;  2B5N A;  4E5Z A;  4JSN C;  2AGW A;  4ZN4 A;  4LGN A;  5FLX g;  2YNO A;  3UKU C;  1SQJ A;  4K3I D;  2I3T A;  3VGZ A;  3MZL A;  2PM9 A;  4E5Z B;  1S4U X;  4FA5 D;  4CY5 A;  5C2W B;  4OWR A;  2H9P A;  4GMB A;  4FA9 D;  4O45 A;  4FA4 D;  4R7A B;  2Z2O A;  5FKS A;  2H6N A;  4L9O A;  5EAP A;  3MKQ A;  3SLE D;  2H9L A;  2XYI A;  4CI2 A;  1U4C A;  1SQ9 A;  3UVL A;  4E54 A;  2HKR A;  1PBY B;  2H9N A;  3KRW B;  1PI6 A;  4JSV C;  3OTT A;  5HQG A;  4A09 B;  2OVR B;  5JWZ A;  5I5I A;  4L3G D;  4CY3 A;  3GRE A;  4GM3 A;  4HDJ A;  3W15 A;  1XIP A;  4K3J B;  2I0T A;  4JXM A;  5C9Z B;  3SBR A;  2IUP A;  4ERY A;  5HE2 B;  2CO0 C;  3K27 A;  4A0A A;  5EAM A;  5EMM B;  3N0E A;  1VYH C;  5FKR A;  4X63 B;  3HFQ A;  4J82 A;  4XYI A;  3PVW B;  4CZX A;  3C5M A;  3IIW A;  3NVQ A;  1K8K C;  4FA1 D;  3SN6 B;  5EAL A;  2YB8 B;  5EM2 A;  4GM8 A;  3SHF A;  2Q7Q A;  4JSP C; 
#chains in the Genus database with same CATH topology
 4XYH A;  3UKR C;  3MZK A;  2EBS A;  1H2X A;  4A7J A;  4UI9 R;  2VDQ A;  3RN0 D;  3QI0 A;  3NVX A;  3RSE C;  2XE4 A;  3RN1 D;  5C86 A;  3ZDY A;  3ZDZ A;  2I3S A;  1TBG A;  1U8C A;  2TRC B;  2W18 A;  3C99 A;  3FCS A;  4L1M A;  4ZOX A;  1XHM A;  4Z7O A;  4JSX C;  2G99 A;  5GXI A;  2HES X;  3RLM D;  4PXW A;  2XDW A;  1QNI A;  4J84 A;  4A09 A;  5AFU 3;  3UR4 A;  4J8G A;  2G9A A;  4Z8L A;  4J79 A;  4X60 B;  5FFO A;  3JB9 L;  4Y7R A;  3MMY A;  3B7F A;  2HU8 A;  3IUQ A;  3KCI A;  4CI1 A;  3JZN A;  3DSM A;  1JJU B;  3UVO A;  2QXV A;  3ZWL B;  1L0Q A;  1GOG A;  5EML B;  1GOF A;  1UTC A;  3AFC A;  3J80 g;  3JRP A;  3O4G A;  1FWX A;  2J56 H;  4J86 A;  4WJK A;  3O4H A;  5HDB A;  1GOT B;  5FFG A;  3JPX A;  4J0X A;  4XEI C;  1N6D A;  3N0D A;  4PC0 A;  3K26 A;  4BP8 A;  2CO0 A;  5EM2 B;  3RMZ D;  3OW8 A;  4AX4 A;  4O3U B;  3C75 H;  4D9S A;  4U7A A;  4AN1 A;  3JAM g;  4JHN A;  2AGY A;  4J81 A;  2AGZ A;  2CNX A;  2HU5 A;  5H17 A;  2OIZ A;  4AEZ A;  4GM9 A;  3EG6 A;  4PSW B;  4L3H D;  1H2Z A;  3AH8 B;  3EU7 A;  3VI4 A;  3FM0 A;  4D0K A;  5IC7 A;  4GQ2 P;  3EI2 B;  3SFZ A;  4CC9 A;  4O9D A;  4BCD A;  1UOP A;  4FHL A;  4DNU A;  2OJY A;  4NAA A;  4NSX A;  3AL8 B;  1YR2 A;  2YNN A;  3I7N A;  5FQD A;  3ZE2 A;  4AMZ A;  3IJ0 A;  3I8E A;  3JRO A;  3DWL C;  2OVQ B;  3DXM C;  2VDK A;  1ERJ A;  4GQB B;  3RFG A;  2OK4 A;  4ERZ A;  1UOQ A;  3PXW D;  3QHY B;  4NC4 A;  3K71 A;  4FB1 D;  1NEX B;  3MXX A;  1JMZ B;  1JV2 A;  3ODT A;  3I7O A;  3UVM A;  2XU7 A;  4BH6 A;  2P9K C;  1GG2 B;  5THA A;  3MVD K;  3L4M D;  3CFS B;  1VE7 A;  2AH1 A;  4CZV A;  1OLZ A;  2EIC A;  3FRX A;  4GZ8 A;  4X3E A;  2PBI B;  4H5J A;  2VDP A;  2BKL A;  3UVK A;  4H5I A;  4O1Q D;  3JZH A;  4J73 A;  1Q47 A;  2EIE A;  3FGB A;  5EAR A;  2B4E A;  4BUJ C;  1BPO A;  4QQE A;  1A0R B;  4J87 A;  3J81 g;  4A0B B;  1VZ3 A;  4FWW A;  2I0R A;  3V4P A;  1SHY B;  3IIY A;  1P22 A;  2P9S C;  2P9N C;  2EID A;  3JZG A;  2GNQ A;  3CIK B;  2JKX A;  3EWE A;  3SVW D;  3DXK C;  4A08 B;  2H3X A;  2P9L C;  1K32 A;  2HJB A;  3IJE A;  2GC7 A;  4Y5R D;  4G55 A;  1E5T A;  1TYE A;  2MTA H;  3V7D B;  4G1M A;  3BG1 A;  4A2L A;  4MMX A;  5C92 A;  1H2Y A;  1I2M B;  5H14 A;  3IJC A;  3IKO A;  3NID A;  3V4V A;  1O6G A;  4NEN A;  3EI3 B;  3K72 A;  4PBY A;  3NVN A;  5GMK n;  2UZX B;  2HYE A;  5HE1 B;  5AMS A;  4U1E I;  3OKW A;  2IUQ A;  4J8B A;  3MUN A;  4ERQ A;  5GSA A;  1JTD B;  3IJ1 A;  3EI4 B;  3RFH A;  5AJA A;  4UM8 A;  3UVN A;  4Z7Q A;  3SJL D;  3ULE C;  4QAM A;  4CI8 A;  3MKS B;  1H2W A;  4TZ4 A;  2B5L A;  3ZDX A;  2H14 A;  1E8N A;  2XZG A;  2VC2 A;  4BL0 A;  1L5G A;  5CXB A;  4OZU A;  3T3M A;  4JHP C;  3C9C A;  4A2M A;  3A0F A;  5IJ8 E;  2VDM A;  2OK6 A;  3P4F A;  2IAA A;  4A11 A;  3PVU B;  1PGU A;  2WQ8 A;  2YMU A;  4IMM A;  4RE6 A;  5EMJ B;  2YBA A;  1YFQ A;  1XKS A;  3F3G A;  1JMX B;  4JD2 C;  4JT6 C;  4NBM A;  2HJ4 A;  3SMR A;  4PNK B;  2XL2 A;  3O4J A;  3I7P A;  4O2W A;  2H9M A;  2IUV A;  4MMZ A;  4A11 B;  1B9X A;  5C2V B;  4WK2 A;  1N6F A;  4J77 A;  2VDL A;  4Z7N A;  1C9L A;  4WK4 A;  4FAV D;  3I8C A;  4AOW A;  3BG0 A;  4QL1 A;  4A0B A;  2BBK H;  2EIB A;  3VH0 A;  5GXH A;  3I7K A;  1K3I A;  3PXS D;  2H68 A;  3EI2 A;  4G1E A;  4GGD A;  2HXC A;  3EI4 A;  4CY2 A;  5M5U A;  4J78 A;  3AL8 A;  4X61 B;  1T2X A;  3EI1 B;  4PBZ A;  2IWF A;  4A08 A;  3NIF A;  5K19 A;  5TEF A;  3IUM A;  1VZ2 A;  5M5V A;  4G56 B;  3PXT D;  3SBP A;  3PE7 A;  2H47 A;  3CFV A;  3ORV D;  3DDU A;  4FAN D;  3F3F A;  4QRJ A;  3EI1 A;  2Z2N A;  5FKT A;  3VA6 A;  3I2N A;  2IWK A;  4EWR A;  5I5M A;  4CI3 A;  4IA9 A;  4CZY A;  3KRX B;  5IGQ A;  2YNP A;  4MK0 B;  1MDA H;  5CXC A;  4QT8 A;  3IUJ A;  1TYQ C;  2PM7 B;  2Z2P A;  2IUR A;  5SXM A;  1M1X A;  4ZOV A;  1VE6 A;  3ZE0 A;  3I7H A;  4MMY A;  1QFM A;  5M61 A;  2P9P C;  4CY1 A;  5A2Q g;  2H6Q A;  5CXB B;  5HE0 B;  2XL3 A;  4N14 A;  5I5J A;  1B9Y A;  3IUL A;  4ESG A;  2I0S A;  2CE8 A;  2PM6 B;  5M5S A;  2J57 G;  1OMW B;  2P9U C;  3AL9 A;  1PEV A;  5FA5 B;  4BP9 A;  4UM9 A;  3SCY A;  1GOH A;  3L4O D;  4ZOY A;  5TEE A;  3PSC B;  3SWS D;  4AN0 A;  4JT5 C;  2AGL A;  3PSL A;  1UOO A;  3OL2 A;  5K1C C;  1GP2 B;  3V9F A;  3OKT A;  5IT9 g;  3OKY B;  3NIG A;  3DM0 A;  4PSX B;  3ZE1 A;  2P9I C;  5KDO B;  2VZ3 A;  2B5M A;  2CN3 A;  5IGO A;  3SBQ A;  3OL2 B;  1MG3 A;  5CXC B;  2UZY B;  4ZOZ A;  2CE9 A;  4GQ1 A;  3OKY A;  5CYK A;  4KFM B;  3V5W B;  1RI6 A;  3EI3 A;  3GFC A;  4GGC A;  2BCJ B;  4RE5 A;  4J0W A;  4E54 B;  4YVD A;  2AQ5 A;  2CN2 A;  5HYN B;  1NR0 A;  1O6F A;  2AH0 A;  2PM9 B;  3U4Y A;  2HKM A;  3BWS A;  5CYK B;  3IUN A;  3K6S A;  5EMK B;  5TF2 A;  5FXY A;  5IJ7 E;  1R5M A;  3I7L A;  2OVP B;  2AGX A;  5TDH B;  4LG9 A;  1N6E A;  1E8M A;  4A0A B;  4LG8 A;  1MG2 A;  5HE3 B;  4O3T B;  2GC4 A;  3IUR A;  2QC5 A;  4GGA A;  3I89 A;  3F3P A;  5FKQ A;  4L1Q D;  2J55 H;  3SXT D;  5H1M A;  4AMY A;  1JOF A;  5B4W A;  4I79 A;  3T3P A;  3EMH A;  4D6V A;  2O9K A;  2H13 A;  3RRM C;  4ES0 A;  1U2V C;  3EQ7 A;  1GXR A;  2H6K A;  5E6R A;  3E0C A;  2B5N A;  4E5Z A;  4JSN C;  4O02 A;  2AGW A;  4ZN4 A;  4LGN A;  5FLX g;  2YNO A;  3UKU C;  1SQJ A;  3EQ8 A;  4K3I D;  2I3T A;  3FCU A;  3VGZ A;  3MZL A;  2VZ1 A;  2PM9 A;  5E6U A;  2VDR A;  4E5Z B;  1S4U X;  4FA5 D;  4CY5 A;  2VDO A;  5C2W B;  4OWR A;  1A12 A;  2H9P A;  4GMB A;  4FA9 D;  4O45 A;  4FA4 D;  4R7A B;  2Z2O A;  2QZP A;  5FKS A;  3GD1 I;  2H6N A;  4L9O A;  1QFS A;  5EAP A;  4WK0 A;  3MKQ A;  3SLE D;  3VI3 A;  3EQ9 A;  2H9L A;  2XYI A;  4CI2 A;  3OF7 A;  1C9I A;  4DNV A;  1U4C A;  1SQ9 A;  3UVL A;  4BCB A;  4E54 A;  2HKR A;  1PBY B;  2H9N A;  2VDN A;  3GC3 B;  1PI6 A;  3KRW B;  4JSV C;  5M5R A;  5E6S A;  3OTT A;  5HQG A;  4A09 B;  2OVR B;  5JWZ A;  2HU7 A;  3O4I A;  4L3G D;  3GRE A;  4GM3 A;  4CY3 A;  5I5I A;  4HDJ A;  3W15 A;  1XIP A;  4K3J B;  2I0T A;  4JXM A;  5C9Z B;  3MUO A;  3SBR A;  2IUP A;  4ERY A;  4BCC A;  5M5T A;  5HE2 B;  2CO0 C;  3K27 A;  4DNW A;  4A0A A;  5EAM A;  5EMM B;  3N0E A;  1VYH C;  5FKR A;  4X63 B;  3HFQ A;  4J82 A;  4XYI A;  3PVW B;  4CZX A;  2QR5 A;  3C5M A;  3IIW A;  3NVQ A;  1K8K C;  4FA1 D;  3SN6 B;  5EAL A;  2YB8 B;  5EM2 A;  4GM8 A;  3SHF A;  2Q7Q A;  4IRZ A;  3IVM A;  4JSP C; 
#chains in the Genus database with same CATH homology
 4XYH A;  3UKR C;  3MZK A;  2EBS A;  4A7J A;  4UI9 R;  3RN0 D;  3NVX A;  3RSE C;  3RN1 D;  2I3S A;  1TBG A;  2TRC B;  2W18 A;  3C99 A;  4ZOX A;  1XHM A;  4JSX C;  2G99 A;  5GXI A;  2HES X;  3RLM D;  4PXW A;  1QNI A;  4J84 A;  4A09 A;  5AFU 3;  3UR4 A;  4J8G A;  2G9A A;  4Z8L A;  4J79 A;  4X60 B;  3JB9 L;  4Y7R A;  3MMY A;  3B7F A;  4CI1 A;  3JZN A;  3DSM A;  1JJU B;  3UVO A;  2QXV A;  3ZWL B;  1L0Q A;  5EML B;  3AFC A;  3J80 g;  3JRP A;  1FWX A;  2J56 H;  4J86 A;  1GOT B;  3JPX A;  4J0X A;  4XEI C;  1N6D A;  3N0D A;  4PC0 A;  3K26 A;  2CO0 A;  5EM2 B;  3RMZ D;  3OW8 A;  4O3U B;  3C75 H;  4U7A A;  3JAM g;  2AGY A;  4J81 A;  2AGZ A;  2CNX A;  5H17 A;  2OIZ A;  4AEZ A;  4GM9 A;  3EG6 A;  4PSW B;  4L3H D;  3EU7 A;  3AH8 B;  3FM0 A;  4D0K A;  5IC7 A;  4GQ2 P;  3EI2 B;  3SFZ A;  4CC9 A;  4O9D A;  4FHL A;  2OJY A;  4NSX A;  3AL8 B;  2YNN A;  3I7N A;  5FQD A;  3IJ0 A;  3I8E A;  3JRO A;  3DWL C;  2OVQ B;  3DXM C;  1ERJ A;  4GQB B;  3RFG A;  2OK4 A;  4ERZ A;  3PXW D;  4FB1 D;  1NEX B;  3MXX A;  1JMZ B;  3ODT A;  3I7O A;  3UVM A;  2XU7 A;  4BH6 A;  2P9K C;  1GG2 B;  5THA A;  3L4M D;  3CFS B;  2AH1 A;  4CZV A;  1OLZ A;  3FRX A;  4GZ8 A;  4X3E A;  2PBI B;  4H5J A;  3UVK A;  4H5I A;  4O1Q D;  3JZH A;  4J73 A;  1Q47 A;  3FGB A;  5EAR A;  2B4E A;  4BUJ C;  4QQE A;  1A0R B;  4J87 A;  3J81 g;  4A0B B;  4FWW A;  2I0R A;  1SHY B;  3IIY A;  1P22 A;  2P9S C;  2P9N C;  3JZG A;  2GNQ A;  3CIK B;  3EWE A;  3SVW D;  3DXK C;  4A08 B;  2H3X A;  2P9L C;  1K32 A;  2HJB A;  2GC7 A;  4Y5R D;  2MTA H;  3V7D B;  3BG1 A;  4A2L A;  5H14 A;  3IJC A;  3IKO A;  3EI3 B;  4PBY A;  3NVN A;  5GMK n;  2UZX B;  2HYE A;  5HE1 B;  5AMS A;  4U1E I;  3OKW A;  2IUQ A;  4J8B A;  4ERQ A;  5GSA A;  3IJ1 A;  3EI4 B;  3RFH A;  5AJA A;  3UVN A;  3SJL D;  3ULE C;  4CI8 A;  3MKS B;  4TZ4 A;  2B5L A;  2H14 A;  4BL0 A;  5CXB A;  4OZU A;  3C9C A;  4A2M A;  3A0F A;  5IJ8 E;  2OK6 A;  3P4F A;  2IAA A;  4A11 A;  3PVU B;  1PGU A;  2YMU A;  4IMM A;  5EMJ B;  2YBA A;  1YFQ A;  1XKS A;  3F3G A;  1JMX B;  4JD2 C;  4JT6 C;  2HJ4 A;  3SMR A;  4PNK B;  2XL2 A;  3I7P A;  2H9M A;  2IUV A;  4A11 B;  1B9X A;  5C2V B;  1N6F A;  4J77 A;  4FAV D;  3I8C A;  4AOW A;  3BG0 A;  4QL1 A;  4A0B A;  2BBK H;  3VH0 A;  5GXH A;  3I7K A;  3PXS D;  2H68 A;  3EI2 A;  4GGD A;  2HXC A;  3EI4 A;  4CY2 A;  4J78 A;  3AL8 A;  4X61 B;  3EI1 B;  4PBZ A;  2IWF A;  4A08 A;  5K19 A;  5TEF A;  4G56 B;  3PXT D;  3SBP A;  3PE7 A;  2H47 A;  3CFV A;  3ORV D;  4FAN D;  3F3F A;  4QRJ A;  3EI1 A;  2Z2N A;  5FKT A;  3VA6 A;  3I2N A;  2IWK A;  4EWR A;  5I5M A;  4CI3 A;  4IA9 A;  4CZY A;  3KRX B;  5IGQ A;  2YNP A;  4MK0 B;  1MDA H;  5CXC A;  4QT8 A;  1TYQ C;  2PM7 B;  2Z2P A;  2IUR A;  5SXM A;  4ZOV A;  3I7H A;  4CY1 A;  2P9P C;  5A2Q g;  2H6Q A;  5CXB B;  5HE0 B;  2XL3 A;  4N14 A;  5I5J A;  1B9Y A;  4ESG A;  2I0S A;  2CE8 A;  2PM6 B;  2J57 G;  1OMW B;  2P9U C;  3AL9 A;  1PEV A;  5FA5 B;  3SCY A;  3L4O D;  4ZOY A;  5TEE A;  3PSC B;  3SWS D;  4JT5 C;  2AGL A;  3PSL A;  5K1C C;  3OL2 A;  1GP2 B;  3V9F A;  3OKT A;  5IT9 g;  3OKY B;  3DM0 A;  4PSX B;  2P9I C;  5KDO B;  2B5M A;  2CN3 A;  5IGO A;  3SBQ A;  3OL2 B;  1MG3 A;  5CXC B;  2UZY B;  4ZOZ A;  2CE9 A;  4GQ1 A;  3OKY A;  5CYK A;  4KFM B;  3V5W B;  1RI6 A;  3EI3 A;  3GFC A;  4GGC A;  2BCJ B;  4J0W A;  4E54 B;  4YVD A;  2AQ5 A;  2CN2 A;  5HYN B;  1NR0 A;  2AH0 A;  2PM9 B;  3U4Y A;  2HKM A;  3BWS A;  5CYK B;  5EMK B;  5TF2 A;  5FXY A;  5IJ7 E;  1R5M A;  3I7L A;  2OVP B;  2AGX A;  5TDH B;  4LG9 A;  1N6E A;  4A0A B;  4LG8 A;  1MG2 A;  5HE3 B;  4O3T B;  2GC4 A;  2QC5 A;  4GGA A;  3I89 A;  3F3P A;  5FKQ A;  4L1Q D;  2J55 H;  3SXT D;  5H1M A;  1JOF A;  5B4W A;  4I79 A;  3EMH A;  4D6V A;  2O9K A;  2H13 A;  3RRM C;  4ES0 A;  1U2V C;  2H6K A;  1GXR A;  3E0C A;  2B5N A;  4E5Z A;  4JSN C;  2AGW A;  4ZN4 A;  4LGN A;  5FLX g;  2YNO A;  3UKU C;  1SQJ A;  4K3I D;  2I3T A;  3VGZ A;  3MZL A;  2PM9 A;  4E5Z B;  1S4U X;  4FA5 D;  4CY5 A;  5C2W B;  4OWR A;  2H9P A;  4GMB A;  4FA9 D;  4O45 A;  4FA4 D;  4R7A B;  2Z2O A;  5FKS A;  2H6N A;  4L9O A;  5EAP A;  3MKQ A;  3SLE D;  2H9L A;  2XYI A;  4CI2 A;  1U4C A;  1SQ9 A;  3UVL A;  4E54 A;  2HKR A;  1PBY B;  2H9N A;  3KRW B;  1PI6 A;  4JSV C;  3OTT A;  5HQG A;  4A09 B;  2OVR B;  5JWZ A;  5I5I A;  4L3G D;  4CY3 A;  3GRE A;  4GM3 A;  4HDJ A;  3W15 A;  1XIP A;  4K3J B;  2I0T A;  4JXM A;  5C9Z B;  3SBR A;  2IUP A;  4ERY A;  5HE2 B;  2CO0 C;  3K27 A;  4A0A A;  5EAM A;  5EMM B;  3N0E A;  1VYH C;  5FKR A;  4X63 B;  3HFQ A;  4J82 A;  4XYI A;  3PVW B;  4CZX A;  3C5M A;  3IIW A;  3NVQ A;  1K8K C;  4FA1 D;  3SN6 B;  5EAL A;  2YB8 B;  5EM2 A;  4GM8 A;  3SHF A;  2Q7Q A;  4JSP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...