4ESGA

X-ray structure of wdr5-mll1 win motif peptide binary complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 104
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4esgA00
2CN3A 5FKRA 4J86A 3OKWA 1U2VC 2I3SA 4ZOYA 1TBGA 5TEFA 4J81A 4GQ2P 5AJAA 3I89A 3MKSB 2H6NA 3I2NA 2W18A 2XYIA 3DM0A 3F3PA 4OWRA 4PNKB 4J8BA 2AGXA 4X60B 3SJLD 4KFMB 5CXBA 3MXXA 3BG1A 4XYHA 3NVXA 4J8GA 2J56H 3JZHA 3AH8B 3RMZD 2J55H 3JRPA 2I0RA 5FXYA 4A11B 4GMBA 4A11A 3E0CA 4EWRA 2GC7A 1K32A 3PSLA 5EARA 2HYEA 4BUJC 4JSXC 2YNPA 5C2VB 3EI4B 3GREA 2CO0A 4I79A 3EI4A 4CZVA 5H14A 1JMXB 5EM2B 2P9NC 5EM2A 1U4CA 5IGQA 3EI1B 5FLXg 1RI6A 4IMMA 4J0WA 4R7AB 2OK4A 3GFCA 3DXMC 1P22A 5HQGA 5FA5B 5EMKB 4X63B 4A0BB 3PVWB 4CI3A 5A2Qg 1N6FA 3F3GA 3JZNA 3I7OA 5I5MA 3IJ0A 3OW8A 2CE8A 4GM9A 3SFZA 5HYNB 4U7AA 2Z2NA 3EU7A 1S4UX 1MG2A 3B7FA 4CZYA 4PXWA 3SMRA 2H6QA 2H9MA 2P9SC 4ZOVA 4MK0B 3EWEA 4QQEA 4GQ1A 4J84A 3AL8B 2XL2A 4UI9R 3JROA 2I0SA 4JT5C 3JZGA 2H14A 2PM6B 2UZYB 3DSMA 4Z8LA 2OK6A 4J82A 2OIZA 4FAVD 3DWLC 3IJCA 2I3TA 5EAMA 3ODTA 3C99A 1Q47A 4H5JA 3BWSA 2B4EA 3FM0A 2TRCB 4IA9A 4HDJA 5TEEA 4L3GD 5IJ7E 2OVPB 4A2LA 5HE0B 1SHYB 3EMHA 4NSXA 4AOWA 2YMUA 1PEVA 3OKTA 1QNIA 2EBSA 2CE9A 3BG0A 2H47A 4A7JA 3KRXB 3I7LA 1VYHC 1NEXB 1FWXA 4GQBB 5GXIA 2I0TA 3V5WB 4FA5D 4OZUA 3DXKC 5TDHB 3JAMg 4CI1A 3N0EA 3I7KA 2BBKH 5TF2A 1A0RB 3VA6A 1JJUB 3I8EA 3MKQA 3PSCB 5CXBB 1TYQC 3UKRC 2G99A 2IUVA 5GSAA 2AH1A 1ERJA 4L1QD 3I8CA 3ZWLB 1MDAH 3A0FA 5CYKB 4A09B 4CY3A 2H9NA 5CYKA 1YFQA 4A09A 3P4FA 3OL2B 4ZN4A 3OL2A 4ERYA 4BH6A 1JOFA 3PE7A 3RN0D 2IURA 3J80g 4G56B 4GZ8A 3V7DB 2B5NA 4GGAA 2IUQA 4JT6C 4CI2A 1GP2B 3RFHA 2G9AA 3SWSD 3UR4A 4FB1D 2P9IC 4ESGA 4Y7RA 3L4OD 4PSWB 3F3FA 4FWWA 1N6DA 2P9UC 2IAAA 4H5IA 2P9LC 3IKOA 2AH0A 2QXVA 5IGOA 3U4YA 4JD2C 3I7PA 5C2WB 5IC7A 5HE2B 3PXSD 4J78A 4U1EI 3K27A 2PM7B 3V9FA 5HE1B 2AGLA 4N14A 5FQDA 1GOTB 1MG3A 4PBZA 4QT8A 4A0AA 3N0DA 4QL1A 3C9CA 3SBPA 5CXCB 5CXCA 4E54A 3EG6A 3I7HA 4ZOXA 5I5IA 1GG2B 5IT9g 4FHLA 3RFGA 3RRMC 2AQ5A 2P9PC 2H13A 5K19A 2J57G 4O1QD 4JSNC 4LG8A 1B9YA 3CFSB 2H9PA 4CY1A 4YVDA 2HKMA 4J87A 3UVMA 4FA1D 3RSEC 3NVNA 3MZKA 3FGBA 5EALA 5HE3B 3UVKA 2CO0C 2UZXB 3IIWA 2HJBA 4E5ZA 3RLMD 3SBRA 2P9KC 2OJYA 4PBYA 5JWZA 2HJ4A 4CZXA 1XIPA 2HESX 3UVNA 3HFQA 2Q7QA 4O9DA 1PGUA 1PI6A 4D6VA 4FA4D 3SCYA 5EMJB 1K8KC 2BCJB 4ERQA 2YB8B 4O3TB 5H1MA 2Z2PA 5IJ8E 3SXTD 4L9OA 5H17A 4D0KA 4PSXB 4CI8A 2YNOA 2PBIB 5SXMA 3PXWD 3K26A 3L4MD 2HKRA 4GGCA 1B9XA 5AMSA 4CC9A 4TZ4A 2XL3A 2PM9B 2PM9A 1PBYB 4AEZA 1OLZA 3OKYB 5FKSA 2MTAH 2AGYA 3KRWB 3OKYA 3SHFA 1GXRA 1L0QA 4PC0A 2O9KA 2IWFA 3EI3B 3EI3A 4JSPC 2IUPA 4J79A 3W15A 3C75H 3JPXA 4X3EA 3NVQA 3CIKB 4LG9A 4GGDA 5EMMB 4JXMA 3IJ1A 2AGWA 4CY2A 2H3XA 4J77A 5THAA 4ES0A 3C5MA 4Y5RD 3SBQA 4LGNA 5GXHA 3J81g 3UKUC 3UVOA 3EI1A 3UVLA 1SQ9A 3MZLA 5EMLB 3PVUB 4CY5A 4XYIA 2GNQA 5I5JA 3IIYA 4A0BA 2YNNA 3AFCA 5AFU3 4FA9D 4A0AB 2H68A 2HXCA 3VGZA 1N6EA 4A08B 3OTTA 4A08A 4JSVC 3RN1D 3ULEC 3PXTD 4E54B 5FKTA 3I7NA 1JMZB 4K3JB 4FAND 2YBAA 3SLED 4L3HD 2CNXA 3JB9L 4O3UB 4J73A 3AL8A 1NR0A 3EI2B 3EI2A 3VH0A 4GM3A 2B5LA 4ZOZA 3ORVD 4O45A 5C9ZB 2H6KA 3MMYA 2IWKA 2CN2A 4GM8A 1R5MA 4QRJA 2OVQB 5FKQA 5B4WA 3SN6B 2AGZA 4BL0A 4K3ID 2Z2OA 5EAPA 4J0XA 4A2MA 5GMKn 4E5ZB 4XEIC 3AL9A 1OMWB 1XKSA 2B5MA 2GC4A 1SQJA 2XU7A 2H9LA 4ERZA 3CFVA 4X61B 5K1CC 3SVWD 2QC5A 1XHMA 3FRXA 5KDOB 2OVRB
chains in the Genus database with same CATH superfamily
2CN3A 5FKRA 4J86A 3OKWA 1U2VC 2I3SA 4ZOYA 1TBGA 5TEFA 3OF7A 4UM8A 4J81A 3EQ7A 4GQ2P 5AJAA 2EIEA 3I89A 3MKSB 4RE6A 4AMYA 2H6NA 3I2NA 2W18A 2XYIA 3DM0A 3O4IA 3F3PA 4OWRA 1C9LA 4PNKB 1L5GA 4J8BA 4UM9A 2AGXA 4X60B 3SJLD 4KFMB 5CXBA 3MXXA 2VC2A 3BG1A 4XYHA 3NVXA 4J8GA 2J56H 3JZHA 1UTCA 3AH8B 4MMXA 3RMZD 2J55H 3JRPA 2EIDA 2I0RA 3IULA 4GMBA 5FXYA 4A11B 4A11A 3E0CA 4EWRA 2GC7A 1K32A 3PSLA 5EARA 2QZPA 2HYEA 4WK2A 4BUJC 4JSXC 2YNPA 5C2VB 1VZ2A 3EI4B 3GREA 2CO0A 4I79A 2VZ3A 3EI4A 5E6UA 3IUJA 5H14A 4CZVA 1JMXB 5EM2B 2P9NC 3MUOA 5EM2A 1U4CA 5IGQA 3EI1B 5FLXg 1UOPA 3K71A 1RI6A 4IMMA 4J0WA 4R7AB 2XDWA 2OK4A 4O02A 3GFCA 3DXMC 1P22A 5HQGA 5FA5B 4QAMA 5EMKB 4X63B 4A0BB 3PVWB 4CI3A 2HU5A 5A2Qg 1N6FA 3F3GA 3JZNA 3I7OA 4DNUA 5I5MA 3IJ0A 3MVDK 3OW8A 1YR2A 2CE8A 4GM9A 5E6RA 3SFZA 3V4PA 5HYNB 4U7AA 2Z2NA 1VE6A 1VE7A 3EU7A 1S4UX 1MG2A 3B7FA 4CZYA 4PXWA 3SMRA 2H6QA 2H9MA 2P9SC 4ZOVA 4MK0B 3EWEA 4QQEA 4GQ1A 4J84A 3AL8B 3QI0A 2XL2A 4UI9R 2XZGA 3JROA 2I0SA 4JT5C 3JZGA 2H14A 2PM6B 2UZYB 1QFSA 4JHPC 3DSMA 4Z8LA 2OK6A 2QR5A 4J82A 2OIZA 4FAVD 3DWLC 3IJCA 2VDPA 2I3TA 5EAMA 3ODTA 4Z7NA 3C99A 4NC4A 1Q47A 4H5JA 3BWSA 2B4EA 3FM0A 3ZE0A 3VI3A 2TRCB 4IA9A 4HDJA 5TEEA 3O4GA 4L3GD 1C9IA 5IJ7E 2OVPB 4A2LA 5HE0B 1SHYB 3EMHA 4NSXA 1A12A 4IRZA 4AOWA 2YMUA 1PEVA 1GOHA 3OKTA 1QNIA 2EBSA 5M61A 2CE9A 3BG0A 5M5VA 2H47A 4A7JA 3KRXB 3ZDXA 3I7LA 1VYHC 1BPOA 1JTDB 3EQ9A 4AN1A 1NEXB 1FWXA 4GQBB 5GXIA 4JHNA 2I0TA 3V5WB 4FA5D 4WK0A 2HU7A 4OZUA 3DXKC 5TDHB 3IUNA 3JAMg 4CI1A 3N0EA 3I7KA 5M5UA 2BBKH 5TF2A 1A0RB 3VA6A 1JJUB 3I8EA 3MKQA 3PSCB 5CXBB 1TYQC 3UKRC 2G99A 2IUVA 5GSAA 2AH1A 1ERJA 4L1QD 1GOGA 3I8CA 4G1MA 3ZWLB 1H2WA 1MDAH 3A0FA 5CYKB 4A09B 4CY3A 2H9NA 5CYKA 1YFQA 4A09A 3P4FA 3OL2B 4ZN4A 3OL2A 4ERYA 3IUMA 4BH6A 1JOFA 2BKLA 3PE7A 3RN0D 3ZDYA 4D9SA 2IURA 3J80g 4G56B 4GZ8A 1UOQA 3V7DB 1TYEA 4MMZA 2B5NA 4GGAA 2IUQA 4JT6C 4CI2A 1GP2B 4BCDA 3RFHA 2G9AA 3SWSD 3UR4A 2XE4A 4FB1D 2P9IC 4ESGA 4Y7RA 3O4JA 3L4OD 4PSWB 3F3FA 4FWWA 4L1MA 2EICA 1N6DA 1JV2A 2P9UC 2IAAA 4H5IA 3DDUA 2P9LC 5M5TA 3IKOA 2AH0A 2QXVA 4Z7QA 5IGOA 1UOOA 3U4YA 4JD2C 3I7PA 4WJKA 5C2WB 5IC7A 5HE2B 3PXSD 4J78A 4U1EI 3K27A 1E8NA 4BCBA 2PM7B 5E6SA 3V9FA 5HE1B 3ZE1A 2AGLA 1M1XA 4N14A 5FQDA 1GOTB 1MG3A 4PBZA 4QT8A 3IUQA 4A0AA 3N0DA 3ZDZA 4AMZA 4QL1A 1GOFA 3C9CA 3VI4A 3SBPA 5CXCB 5CXCA 4E54A 3EG6A 3I7HA 4ZOXA 1K3IA 5I5IA 1GG2B 5IT9g 4FHLA 3RFGA 3RRMC 2AQ5A 3FCSA 3NIGA 2P9PC 2H13A 2VDRA 5K19A 2J57G 1QFMA 4O1QD 5M5RA 4JSNC 3KCIA 2VDOA 4LG8A 1B9YA 3CFSB 3T3MA 2H9PA 4CY1A 4YVDA 2HKMA 5HDBA 2VZ1A 3T3PA 4J87A 4NAAA 3UVMA 4FA1D 3RSEC 3NVNA 3MZKA 3FGBA 3K6SA 5EALA 2EIBA 1I2MB 5HE3B 3UVKA 2CO0C 2UZXB 3IIWA 2HJBA 5C86A 4E5ZA 3RLMD 3SBRA 2P9KC 2OJYA 4PBYA 5JWZA 4AN0A 2HJ4A 3MUNA 4CZXA 1XIPA 2HESX 3UVNA 3HFQA 2Q7QA 4O9DA 2VDQA 1PGUA 1PI6A 4D6VA 4FA4D 3NIFA 3O4HA 3SCYA 5EMJB 4BP8A 1K8KC 2BCJB 4ERQA 3IURA 2YB8B 4O3TB 5H1MA 2Z2PA 5IJ8E 3SXTD 4L9OA 5H17A 4D0KA 4PSXB 4BCCA 4CI8A 4BP9A 2YNOA 1O6FA 2PBIB 5SXMA 3PXWD 3K26A 3L4MD 2HKRA 4GGCA 1B9XA 1VZ3A 5AMSA 4CC9A 2VDNA 4TZ4A 4DNWA 1H2ZA 2XL3A 2PM9B 2PM9A 1PBYB 4AEZA 1OLZA 3OKYB 5FKSA 2MTAH 2AGYA 3KRWB 3OKYA 3SHFA 1GXRA 1L0QA 3ZE2A 4PC0A 2O9KA 2IWFA 3EI3B 3EI3A 4JSPC 2IUPA 4J79A 3W15A 4RE5A 3C75H 3JPXA 4X3EA 3NVQA 4NENA 3CIKB 4LG9A 4GGDA 5EMMB 4JXMA 1E5TA 3IJ1A 3K72A 4AX4A 4NBMA 5M5SA 3NIDA 2AGWA 4CY2A 2H3XA 4J77A 5THAA 4ES0A 3C5MA 4Y5RD 3SBQA 4LGNA 5GXHA 2WQ8A 3J81g 5C92A 3UKUC 3UVOA 3EI1A 3UVLA 1SQ9A 3MZLA 5EMLB 3PVUB 4CY5A 2VDKA 4XYIA 2GNQA 5I5JA 3IIYA 3V4VA 4A0BA 2YNNA 3AFCA 5AFU3 3IVMA 4FA9D 2VDMA 3EQ8A 4A0AB 2H68A 2HXCA 3VGZA 1N6EA 4A08B 3OTTA 4A08A 5FFOA 4JSVC 3RN1D 3ULEC 3PXTD 3GC3B 4G1EA 4E54B 5FKTA 1E8MA 3I7NA 3FCUA 1JMZB 4K3JB 4FAND 2YBAA 3SLED 4L3HD 2CNXA 3JB9L 4WK4A 4O3UB 4J73A 3AL8A 1NR0A 4G55A 3EI2B 3EI2A 3VH0A 4GM3A 3IJEA 2B5LA 4ZOZA 3ORVD 4O45A 5C9ZB 2H6KA 3MMYA 2IWKA 3QHYB 2CN2A 4GM8A 1O6GA 1R5MA 4MMYA 4QRJA 2OVQB 4Z7OA 5FKQA 2HU8A 5FFGA 5B4WA 3SN6B 2AGZA 4BL0A 4K3ID 2JKXA 2Z2OA 1U8CA 5EAPA 3GD1I 4J0XA 4A2MA 5GMKn 4E5ZB 4XEIC 3AL9A 1OMWB 1XKSA 2B5MA 2GC4A 1SQJA 2XU7A 2H9LA 4ERZA 1H2YA 3CFVA 4X61B 2VDLA 5K1CC 3SVWD 4O2WA 1T2XA 1H2XA 2QC5A 1XHMA 3FRXA 4DNVA 5KDOB 2OVRB
chains in the Genus database with same CATH topology
2CN3A 5FKRA 4J86A 3OKWA 1U2VC 2I3SA 4ZOYA 1TBGA 5TEFA 4J81A 4GQ2P 5AJAA 3I89A 3MKSB 2H6NA 3I2NA 2W18A 2XYIA 3DM0A 3F3PA 4OWRA 4PNKB 4J8BA 2AGXA 4X60B 3SJLD 4KFMB 5CXBA 3MXXA 3BG1A 4XYHA 3NVXA 4J8GA 2J56H 3JZHA 3AH8B 3RMZD 2J55H 3JRPA 2I0RA 5FXYA 4A11B 4GMBA 4A11A 3E0CA 4EWRA 2GC7A 1K32A 3PSLA 5EARA 2HYEA 4BUJC 4JSXC 2YNPA 5C2VB 3EI4B 3GREA 2CO0A 4I79A 3EI4A 4CZVA 5H14A 1JMXB 5EM2B 2P9NC 5EM2A 1U4CA 5IGQA 3EI1B 5FLXg 1RI6A 4IMMA 4J0WA 4R7AB 2OK4A 3GFCA 3DXMC 1P22A 5HQGA 5FA5B 5EMKB 4X63B 4A0BB 3PVWB 4CI3A 5A2Qg 1N6FA 3F3GA 3JZNA 3I7OA 5I5MA 3IJ0A 3OW8A 2CE8A 4GM9A 3SFZA 5HYNB 4U7AA 2Z2NA 3EU7A 1S4UX 1MG2A 3B7FA 4CZYA 4PXWA 3SMRA 2H6QA 2H9MA 2P9SC 4ZOVA 4MK0B 3EWEA 4QQEA 4GQ1A 4J84A 3AL8B 2XL2A 4UI9R 3JROA 2I0SA 4JT5C 3JZGA 2H14A 2PM6B 2UZYB 3DSMA 4Z8LA 2OK6A 4J82A 2OIZA 4FAVD 3DWLC 3IJCA 2I3TA 5EAMA 3ODTA 3C99A 1Q47A 4H5JA 3BWSA 2B4EA 3FM0A 2TRCB 4IA9A 4HDJA 5TEEA 4L3GD 5IJ7E 2OVPB 4A2LA 5HE0B 1SHYB 3EMHA 4NSXA 4AOWA 2YMUA 1PEVA 3OKTA 1QNIA 2EBSA 2CE9A 3BG0A 2H47A 4A7JA 3KRXB 3I7LA 1VYHC 1NEXB 1FWXA 4GQBB 5GXIA 2I0TA 3V5WB 4FA5D 4OZUA 3DXKC 5TDHB 3JAMg 4CI1A 3N0EA 3I7KA 2BBKH 5TF2A 1A0RB 3VA6A 1JJUB 3I8EA 3MKQA 3PSCB 5CXBB 1TYQC 3UKRC 2G99A 2IUVA 5GSAA 2AH1A 1ERJA 4L1QD 3I8CA 3ZWLB 1MDAH 3A0FA 5CYKB 4A09B 4CY3A 2H9NA 5CYKA 1YFQA 4A09A 3P4FA 3OL2B 4ZN4A 3OL2A 4ERYA 4BH6A 1JOFA 3PE7A 3RN0D 2IURA 3J80g 4G56B 4GZ8A 3V7DB 2B5NA 4GGAA 2IUQA 4JT6C 4CI2A 1GP2B 3RFHA 2G9AA 3SWSD 3UR4A 4FB1D 2P9IC 4ESGA 4Y7RA 3L4OD 4PSWB 3F3FA 4FWWA 1N6DA 2P9UC 2IAAA 4H5IA 2P9LC 3IKOA 2AH0A 2QXVA 5IGOA 3U4YA 4JD2C 3I7PA 5C2WB 5IC7A 5HE2B 3PXSD 4J78A 4U1EI 3K27A 2PM7B 3V9FA 5HE1B 2AGLA 4N14A 5FQDA 1GOTB 1MG3A 4PBZA 4QT8A 4A0AA 3N0DA 4QL1A 3C9CA 3SBPA 5CXCB 5CXCA 4E54A 3EG6A 3I7HA 4ZOXA 5I5IA 1GG2B 5IT9g 4FHLA 3RFGA 3RRMC 2AQ5A 2P9PC 2H13A 5K19A 2J57G 4O1QD 4JSNC 4LG8A 1B9YA 3CFSB 2H9PA 4CY1A 4YVDA 2HKMA 4J87A 3UVMA 4FA1D 3RSEC 3NVNA 3MZKA 3FGBA 5EALA 5HE3B 3UVKA 2CO0C 2UZXB 3IIWA 2HJBA 4E5ZA 3RLMD 3SBRA 2P9KC 2OJYA 4PBYA 5JWZA 2HJ4A 4CZXA 1XIPA 2HESX 3UVNA 3HFQA 2Q7QA 4O9DA 1PGUA 1PI6A 4D6VA 4FA4D 3SCYA 5EMJB 1K8KC 2BCJB 4ERQA 2YB8B 4O3TB 5H1MA 2Z2PA 5IJ8E 3SXTD 4L9OA 5H17A 4D0KA 4PSXB 4CI8A 2YNOA 2PBIB 5SXMA 3PXWD 3K26A 3L4MD 2HKRA 4GGCA 1B9XA 5AMSA 4CC9A 4TZ4A 2XL3A 2PM9B 2PM9A 1PBYB 4AEZA 1OLZA 3OKYB 5FKSA 2MTAH 2AGYA 3KRWB 3OKYA 3SHFA 1GXRA 1L0QA 4PC0A 2O9KA 2IWFA 3EI3B 3EI3A 4JSPC 2IUPA 4J79A 3W15A 3C75H 3JPXA 4X3EA 3NVQA 3CIKB 4LG9A 4GGDA 5EMMB 4JXMA 3IJ1A 2AGWA 4CY2A 2H3XA 4J77A 5THAA 4ES0A 3C5MA 4Y5RD 3SBQA 4LGNA 5GXHA 3J81g 3UKUC 3UVOA 3EI1A 3UVLA 1SQ9A 3MZLA 5EMLB 3PVUB 4CY5A 4XYIA 2GNQA 5I5JA 3IIYA 4A0BA 2YNNA 3AFCA 5AFU3 4FA9D 4A0AB 2H68A 2HXCA 3VGZA 1N6EA 4A08B 3OTTA 4A08A 4JSVC 3RN1D 3ULEC 3PXTD 4E54B 5FKTA 3I7NA 1JMZB 4K3JB 4FAND 2YBAA 3SLED 4L3HD 2CNXA 3JB9L 4O3UB 4J73A 3AL8A 1NR0A 3EI2B 3EI2A 3VH0A 4GM3A 2B5LA 4ZOZA 3ORVD 4O45A 5C9ZB 2H6KA 3MMYA 2IWKA 2CN2A 4GM8A 1R5MA 4QRJA 2OVQB 5FKQA 5B4WA 3SN6B 2AGZA 4BL0A 4K3ID 2Z2OA 5EAPA 4J0XA 4A2MA 5GMKn 4E5ZB 4XEIC 3AL9A 1OMWB 1XKSA 2B5MA 2GC4A 1SQJA 2XU7A 2H9LA 4ERZA 3CFVA 4X61B 5K1CC 3SVWD 2QC5A 1XHMA 3FRXA 5KDOB 2OVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CN3 A;  5FKR A;  4J86 A;  3OKW A;  1U2V C;  2I3S A;  4ZOY A;  1TBG A;  5TEF A;  4J81 A;  4GQ2 P;  5AJA A;  3I89 A;  3MKS B;  2H6N A;  3I2N A;  2W18 A;  2XYI A;  3DM0 A;  3F3P A;  4OWR A;  4PNK B;  4J8B A;  2AGX A;  4X60 B;  3SJL D;  4KFM B;  5CXB A;  3MXX A;  3BG1 A;  4XYH A;  3NVX A;  4J8G A;  2J56 H;  3JZH A;  3AH8 B;  3RMZ D;  2J55 H;  3JRP A;  2I0R A;  5FXY A;  4A11 B;  4GMB A;  4A11 A;  3E0C A;  4EWR A;  2GC7 A;  1K32 A;  3PSL A;  5EAR A;  2HYE A;  4BUJ C;  4JSX C;  2YNP A;  5C2V B;  3EI4 B;  3GRE A;  2CO0 A;  4I79 A;  3EI4 A;  4CZV A;  5H14 A;  1JMX B;  5EM2 B;  2P9N C;  5EM2 A;  1U4C A;  5IGQ A;  3EI1 B;  5FLX g;  1RI6 A;  4IMM A;  4J0W A;  4R7A B;  2OK4 A;  3GFC A;  3DXM C;  1P22 A;  5HQG A;  5FA5 B;  5EMK B;  4X63 B;  4A0B B;  3PVW B;  4CI3 A;  5A2Q g;  1N6F A;  3F3G A;  3JZN A;  3I7O A;  5I5M A;  3IJ0 A;  3OW8 A;  2CE8 A;  4GM9 A;  3SFZ A;  5HYN B;  4U7A A;  2Z2N A;  3EU7 A;  1S4U X;  1MG2 A;  3B7F A;  4CZY A;  4PXW A;  3SMR A;  2H6Q A;  2H9M A;  2P9S C;  4ZOV A;  4MK0 B;  3EWE A;  4QQE A;  4GQ1 A;  4J84 A;  3AL8 B;  2XL2 A;  4UI9 R;  3JRO A;  2I0S A;  4JT5 C;  3JZG A;  2H14 A;  2PM6 B;  2UZY B;  3DSM A;  4Z8L A;  2OK6 A;  4J82 A;  2OIZ A;  4FAV D;  3DWL C;  3IJC A;  2I3T A;  5EAM A;  3ODT A;  3C99 A;  1Q47 A;  4H5J A;  3BWS A;  2B4E A;  3FM0 A;  2TRC B;  4IA9 A;  4HDJ A;  5TEE A;  4L3G D;  5IJ7 E;  2OVP B;  4A2L A;  5HE0 B;  1SHY B;  3EMH A;  4NSX A;  4AOW A;  2YMU A;  1PEV A;  3OKT A;  1QNI A;  2EBS A;  2CE9 A;  3BG0 A;  2H47 A;  4A7J A;  3KRX B;  3I7L A;  1VYH C;  1NEX B;  1FWX A;  4GQB B;  5GXI A;  2I0T A;  3V5W B;  4FA5 D;  4OZU A;  3DXK C;  5TDH B;  3JAM g;  4CI1 A;  3N0E A;  3I7K A;  2BBK H;  5TF2 A;  1A0R B;  3VA6 A;  1JJU B;  3I8E A;  3MKQ A;  3PSC B;  5CXB B;  1TYQ C;  3UKR C;  2G99 A;  2IUV A;  5GSA A;  2AH1 A;  1ERJ A;  4L1Q D;  3I8C A;  3ZWL B;  1MDA H;  3A0F A;  5CYK B;  4A09 B;  4CY3 A;  2H9N A;  5CYK A;  1YFQ A;  4A09 A;  3P4F A;  3OL2 B;  4ZN4 A;  3OL2 A;  4ERY A;  4BH6 A;  1JOF A;  3PE7 A;  3RN0 D;  2IUR A;  3J80 g;  4G56 B;  4GZ8 A;  3V7D B;  2B5N A;  4GGA A;  2IUQ A;  4JT6 C;  4CI2 A;  1GP2 B;  3RFH A;  2G9A A;  3SWS D;  3UR4 A;  4FB1 D;  2P9I C;  4ESG A;  4Y7R A;  3L4O D;  4PSW B;  3F3F A;  4FWW A;  1N6D A;  2P9U C;  2IAA A;  4H5I A;  2P9L C;  3IKO A;  2AH0 A;  2QXV A;  5IGO A;  3U4Y A;  4JD2 C;  3I7P A;  5C2W B;  5IC7 A;  5HE2 B;  3PXS D;  4J78 A;  4U1E I;  3K27 A;  2PM7 B;  3V9F A;  5HE1 B;  2AGL A;  4N14 A;  5FQD A;  1GOT B;  1MG3 A;  4PBZ A;  4QT8 A;  4A0A A;  3N0D A;  4QL1 A;  3C9C A;  3SBP A;  5CXC B;  5CXC A;  4E54 A;  3EG6 A;  3I7H A;  4ZOX A;  5I5I A;  1GG2 B;  5IT9 g;  4FHL A;  3RFG A;  3RRM C;  2AQ5 A;  2P9P C;  2H13 A;  5K19 A;  2J57 G;  4O1Q D;  4JSN C;  4LG8 A;  1B9Y A;  3CFS B;  2H9P A;  4CY1 A;  4YVD A;  2HKM A;  4J87 A;  3UVM A;  4FA1 D;  3RSE C;  3NVN A;  3MZK A;  3FGB A;  5EAL A;  5HE3 B;  3UVK A;  2CO0 C;  2UZX B;  3IIW A;  2HJB A;  4E5Z A;  3RLM D;  3SBR A;  2P9K C;  2OJY A;  4PBY A;  5JWZ A;  2HJ4 A;  4CZX A;  1XIP A;  2HES X;  3UVN A;  3HFQ A;  2Q7Q A;  4O9D A;  1PGU A;  1PI6 A;  4D6V A;  4FA4 D;  3SCY A;  5EMJ B;  1K8K C;  2BCJ B;  4ERQ A;  2YB8 B;  4O3T B;  5H1M A;  2Z2P A;  5IJ8 E;  3SXT D;  4L9O A;  5H17 A;  4D0K A;  4PSX B;  4CI8 A;  2YNO A;  2PBI B;  5SXM A;  3PXW D;  3K26 A;  3L4M D;  2HKR A;  4GGC A;  1B9X A;  5AMS A;  4CC9 A;  4TZ4 A;  2XL3 A;  2PM9 B;  2PM9 A;  1PBY B;  4AEZ A;  1OLZ A;  3OKY B;  5FKS A;  2MTA H;  2AGY A;  3KRW B;  3OKY A;  3SHF A;  1GXR A;  1L0Q A;  4PC0 A;  2O9K A;  2IWF A;  3EI3 B;  3EI3 A;  4JSP C;  2IUP A;  4J79 A;  3W15 A;  3C75 H;  3JPX A;  4X3E A;  3NVQ A;  3CIK B;  4LG9 A;  4GGD A;  5EMM B;  4JXM A;  3IJ1 A;  2AGW A;  4CY2 A;  2H3X A;  4J77 A;  5THA A;  4ES0 A;  3C5M A;  4Y5R D;  3SBQ A;  4LGN A;  5GXH A;  3J81 g;  3UKU C;  3UVO A;  3EI1 A;  3UVL A;  1SQ9 A;  3MZL A;  5EML B;  3PVU B;  4CY5 A;  4XYI A;  2GNQ A;  5I5J A;  3IIY A;  4A0B A;  2YNN A;  3AFC A;  5AFU 3;  4FA9 D;  4A0A B;  2H68 A;  2HXC A;  3VGZ A;  1N6E A;  4A08 B;  3OTT A;  4A08 A;  4JSV C;  3RN1 D;  3ULE C;  3PXT D;  4E54 B;  5FKT A;  3I7N A;  1JMZ B;  4K3J B;  4FAN D;  2YBA A;  3SLE D;  4L3H D;  2CNX A;  3JB9 L;  4O3U B;  4J73 A;  3AL8 A;  1NR0 A;  3EI2 B;  3EI2 A;  3VH0 A;  4GM3 A;  2B5L A;  4ZOZ A;  3ORV D;  4O45 A;  5C9Z B;  2H6K A;  3MMY A;  2IWK A;  2CN2 A;  4GM8 A;  1R5M A;  4QRJ A;  2OVQ B;  5FKQ A;  5B4W A;  3SN6 B;  2AGZ A;  4BL0 A;  4K3I D;  2Z2O A;  5EAP A;  4J0X A;  4A2M A;  5GMK n;  4E5Z B;  4XEI C;  3AL9 A;  1OMW B;  1XKS A;  2B5M A;  2GC4 A;  1SQJ A;  2XU7 A;  2H9L A;  4ERZ A;  3CFV A;  4X61 B;  5K1C C;  3SVW D;  2QC5 A;  1XHM A;  3FRX A;  5KDO B;  2OVR B; 
#chains in the Genus database with same CATH topology
 2CN3 A;  5FKR A;  4J86 A;  3OKW A;  1U2V C;  2I3S A;  4ZOY A;  1TBG A;  5TEF A;  3OF7 A;  4UM8 A;  4J81 A;  3EQ7 A;  4GQ2 P;  5AJA A;  2EIE A;  3I89 A;  3MKS B;  4RE6 A;  4AMY A;  2H6N A;  3I2N A;  2W18 A;  2XYI A;  3DM0 A;  3O4I A;  3F3P A;  4OWR A;  1C9L A;  4PNK B;  1L5G A;  4J8B A;  4UM9 A;  2AGX A;  4X60 B;  3SJL D;  4KFM B;  5CXB A;  3MXX A;  2VC2 A;  3BG1 A;  4XYH A;  3NVX A;  4J8G A;  2J56 H;  3JZH A;  1UTC A;  3AH8 B;  4MMX A;  3RMZ D;  2J55 H;  3JRP A;  2EID A;  2I0R A;  3IUL A;  4GMB A;  5FXY A;  4A11 B;  4A11 A;  3E0C A;  4EWR A;  2GC7 A;  1K32 A;  3PSL A;  5EAR A;  2QZP A;  2HYE A;  4WK2 A;  4BUJ C;  4JSX C;  2YNP A;  5C2V B;  1VZ2 A;  3EI4 B;  3GRE A;  2CO0 A;  4I79 A;  2VZ3 A;  3EI4 A;  5E6U A;  3IUJ A;  5H14 A;  4CZV A;  1JMX B;  5EM2 B;  2P9N C;  3MUO A;  5EM2 A;  1U4C A;  5IGQ A;  3EI1 B;  5FLX g;  1UOP A;  3K71 A;  1RI6 A;  4IMM A;  4J0W A;  4R7A B;  2XDW A;  2OK4 A;  4O02 A;  3GFC A;  3DXM C;  1P22 A;  5HQG A;  5FA5 B;  4QAM A;  5EMK B;  4X63 B;  4A0B B;  3PVW B;  4CI3 A;  2HU5 A;  5A2Q g;  1N6F A;  3F3G A;  3JZN A;  3I7O A;  4DNU A;  5I5M A;  3IJ0 A;  3MVD K;  3OW8 A;  1YR2 A;  2CE8 A;  4GM9 A;  5E6R A;  3SFZ A;  3V4P A;  5HYN B;  4U7A A;  2Z2N A;  1VE6 A;  1VE7 A;  3EU7 A;  1S4U X;  1MG2 A;  3B7F A;  4CZY A;  4PXW A;  3SMR A;  2H6Q A;  2H9M A;  2P9S C;  4ZOV A;  4MK0 B;  3EWE A;  4QQE A;  4GQ1 A;  4J84 A;  3AL8 B;  3QI0 A;  2XL2 A;  4UI9 R;  2XZG A;  3JRO A;  2I0S A;  4JT5 C;  3JZG A;  2H14 A;  2PM6 B;  2UZY B;  1QFS A;  4JHP C;  3DSM A;  4Z8L A;  2OK6 A;  2QR5 A;  4J82 A;  2OIZ A;  4FAV D;  3DWL C;  3IJC A;  2VDP A;  2I3T A;  5EAM A;  3ODT A;  4Z7N A;  3C99 A;  4NC4 A;  1Q47 A;  4H5J A;  3BWS A;  2B4E A;  3FM0 A;  3ZE0 A;  3VI3 A;  2TRC B;  4IA9 A;  4HDJ A;  5TEE A;  3O4G A;  4L3G D;  1C9I A;  5IJ7 E;  2OVP B;  4A2L A;  5HE0 B;  1SHY B;  3EMH A;  4NSX A;  1A12 A;  4IRZ A;  4AOW A;  2YMU A;  1PEV A;  1GOH A;  3OKT A;  1QNI A;  2EBS A;  5M61 A;  2CE9 A;  3BG0 A;  5M5V A;  2H47 A;  4A7J A;  3KRX B;  3ZDX A;  3I7L A;  1VYH C;  1BPO A;  1JTD B;  3EQ9 A;  4AN1 A;  1NEX B;  1FWX A;  4GQB B;  5GXI A;  4JHN A;  2I0T A;  3V5W B;  4FA5 D;  4WK0 A;  2HU7 A;  4OZU A;  3DXK C;  5TDH B;  3IUN A;  3JAM g;  4CI1 A;  3N0E A;  3I7K A;  5M5U A;  2BBK H;  5TF2 A;  1A0R B;  3VA6 A;  1JJU B;  3I8E A;  3MKQ A;  3PSC B;  5CXB B;  1TYQ C;  3UKR C;  2G99 A;  2IUV A;  5GSA A;  2AH1 A;  1ERJ A;  4L1Q D;  1GOG A;  3I8C A;  4G1M A;  3ZWL B;  1H2W A;  1MDA H;  3A0F A;  5CYK B;  4A09 B;  4CY3 A;  2H9N A;  5CYK A;  1YFQ A;  4A09 A;  3P4F A;  3OL2 B;  4ZN4 A;  3OL2 A;  4ERY A;  3IUM A;  4BH6 A;  1JOF A;  2BKL A;  3PE7 A;  3RN0 D;  3ZDY A;  4D9S A;  2IUR A;  3J80 g;  4G56 B;  4GZ8 A;  1UOQ A;  3V7D B;  1TYE A;  4MMZ A;  2B5N A;  4GGA A;  2IUQ A;  4JT6 C;  4CI2 A;  1GP2 B;  4BCD A;  3RFH A;  2G9A A;  3SWS D;  3UR4 A;  2XE4 A;  4FB1 D;  2P9I C;  4ESG A;  4Y7R A;  3O4J A;  3L4O D;  4PSW B;  3F3F A;  4FWW A;  4L1M A;  2EIC A;  1N6D A;  1JV2 A;  2P9U C;  2IAA A;  4H5I A;  3DDU A;  2P9L C;  5M5T A;  3IKO A;  2AH0 A;  2QXV A;  4Z7Q A;  5IGO A;  1UOO A;  3U4Y A;  4JD2 C;  3I7P A;  4WJK A;  5C2W B;  5IC7 A;  5HE2 B;  3PXS D;  4J78 A;  4U1E I;  3K27 A;  1E8N A;  4BCB A;  2PM7 B;  5E6S A;  3V9F A;  5HE1 B;  3ZE1 A;  2AGL A;  1M1X A;  4N14 A;  5FQD A;  1GOT B;  1MG3 A;  4PBZ A;  4QT8 A;  3IUQ A;  4A0A A;  3N0D A;  3ZDZ A;  4AMZ A;  4QL1 A;  1GOF A;  3C9C A;  3VI4 A;  3SBP A;  5CXC B;  5CXC A;  4E54 A;  3EG6 A;  3I7H A;  4ZOX A;  1K3I A;  5I5I A;  1GG2 B;  5IT9 g;  4FHL A;  3RFG A;  3RRM C;  2AQ5 A;  3FCS A;  3NIG A;  2P9P C;  2H13 A;  2VDR A;  5K19 A;  2J57 G;  1QFM A;  4O1Q D;  5M5R A;  4JSN C;  3KCI A;  2VDO A;  4LG8 A;  1B9Y A;  3CFS B;  3T3M A;  2H9P A;  4CY1 A;  4YVD A;  2HKM A;  5HDB A;  2VZ1 A;  3T3P A;  4J87 A;  4NAA A;  3UVM A;  4FA1 D;  3RSE C;  3NVN A;  3MZK A;  3FGB A;  3K6S A;  5EAL A;  2EIB A;  1I2M B;  5HE3 B;  3UVK A;  2CO0 C;  2UZX B;  3IIW A;  2HJB A;  5C86 A;  4E5Z A;  3RLM D;  3SBR A;  2P9K C;  2OJY A;  4PBY A;  5JWZ A;  4AN0 A;  2HJ4 A;  3MUN A;  4CZX A;  1XIP A;  2HES X;  3UVN A;  3HFQ A;  2Q7Q A;  4O9D A;  2VDQ A;  1PGU A;  1PI6 A;  4D6V A;  4FA4 D;  3NIF A;  3O4H A;  3SCY A;  5EMJ B;  4BP8 A;  1K8K C;  2BCJ B;  4ERQ A;  3IUR A;  2YB8 B;  4O3T B;  5H1M A;  2Z2P A;  5IJ8 E;  3SXT D;  4L9O A;  5H17 A;  4D0K A;  4PSX B;  4BCC A;  4CI8 A;  4BP9 A;  2YNO A;  1O6F A;  2PBI B;  5SXM A;  3PXW D;  3K26 A;  3L4M D;  2HKR A;  4GGC A;  1B9X A;  1VZ3 A;  5AMS A;  4CC9 A;  2VDN A;  4TZ4 A;  4DNW A;  1H2Z A;  2XL3 A;  2PM9 B;  2PM9 A;  1PBY B;  4AEZ A;  1OLZ A;  3OKY B;  5FKS A;  2MTA H;  2AGY A;  3KRW B;  3OKY A;  3SHF A;  1GXR A;  1L0Q A;  3ZE2 A;  4PC0 A;  2O9K A;  2IWF A;  3EI3 B;  3EI3 A;  4JSP C;  2IUP A;  4J79 A;  3W15 A;  4RE5 A;  3C75 H;  3JPX A;  4X3E A;  3NVQ A;  4NEN A;  3CIK B;  4LG9 A;  4GGD A;  5EMM B;  4JXM A;  1E5T A;  3IJ1 A;  3K72 A;  4AX4 A;  4NBM A;  5M5S A;  3NID A;  2AGW A;  4CY2 A;  2H3X A;  4J77 A;  5THA A;  4ES0 A;  3C5M A;  4Y5R D;  3SBQ A;  4LGN A;  5GXH A;  2WQ8 A;  3J81 g;  5C92 A;  3UKU C;  3UVO A;  3EI1 A;  3UVL A;  1SQ9 A;  3MZL A;  5EML B;  3PVU B;  4CY5 A;  2VDK A;  4XYI A;  2GNQ A;  5I5J A;  3IIY A;  3V4V A;  4A0B A;  2YNN A;  3AFC A;  5AFU 3;  3IVM A;  4FA9 D;  2VDM A;  3EQ8 A;  4A0A B;  2H68 A;  2HXC A;  3VGZ A;  1N6E A;  4A08 B;  3OTT A;  4A08 A;  5FFO A;  4JSV C;  3RN1 D;  3ULE C;  3PXT D;  3GC3 B;  4G1E A;  4E54 B;  5FKT A;  1E8M A;  3I7N A;  3FCU A;  1JMZ B;  4K3J B;  4FAN D;  2YBA A;  3SLE D;  4L3H D;  2CNX A;  3JB9 L;  4WK4 A;  4O3U B;  4J73 A;  3AL8 A;  1NR0 A;  4G55 A;  3EI2 B;  3EI2 A;  3VH0 A;  4GM3 A;  3IJE A;  2B5L A;  4ZOZ A;  3ORV D;  4O45 A;  5C9Z B;  2H6K A;  3MMY A;  2IWK A;  3QHY B;  2CN2 A;  4GM8 A;  1O6G A;  1R5M A;  4MMY A;  4QRJ A;  2OVQ B;  4Z7O A;  5FKQ A;  2HU8 A;  5FFG A;  5B4W A;  3SN6 B;  2AGZ A;  4BL0 A;  4K3I D;  2JKX A;  2Z2O A;  1U8C A;  5EAP A;  3GD1 I;  4J0X A;  4A2M A;  5GMK n;  4E5Z B;  4XEI C;  3AL9 A;  1OMW B;  1XKS A;  2B5M A;  2GC4 A;  1SQJ A;  2XU7 A;  2H9L A;  4ERZ A;  1H2Y A;  3CFV A;  4X61 B;  2VDL A;  5K1C C;  3SVW D;  4O2W A;  1T2X A;  1H2X A;  2QC5 A;  1XHM A;  3FRX A;  4DNV A;  5KDO B;  2OVR B; 
#chains in the Genus database with same CATH homology
 2CN3 A;  5FKR A;  4J86 A;  3OKW A;  1U2V C;  2I3S A;  4ZOY A;  1TBG A;  5TEF A;  4J81 A;  4GQ2 P;  5AJA A;  3I89 A;  3MKS B;  2H6N A;  3I2N A;  2W18 A;  2XYI A;  3DM0 A;  3F3P A;  4OWR A;  4PNK B;  4J8B A;  2AGX A;  4X60 B;  3SJL D;  4KFM B;  5CXB A;  3MXX A;  3BG1 A;  4XYH A;  3NVX A;  4J8G A;  2J56 H;  3JZH A;  3AH8 B;  3RMZ D;  2J55 H;  3JRP A;  2I0R A;  5FXY A;  4A11 B;  4GMB A;  4A11 A;  3E0C A;  4EWR A;  2GC7 A;  1K32 A;  3PSL A;  5EAR A;  2HYE A;  4BUJ C;  4JSX C;  2YNP A;  5C2V B;  3EI4 B;  3GRE A;  2CO0 A;  4I79 A;  3EI4 A;  4CZV A;  5H14 A;  1JMX B;  5EM2 B;  2P9N C;  5EM2 A;  1U4C A;  5IGQ A;  3EI1 B;  5FLX g;  1RI6 A;  4IMM A;  4J0W A;  4R7A B;  2OK4 A;  3GFC A;  3DXM C;  1P22 A;  5HQG A;  5FA5 B;  5EMK B;  4X63 B;  4A0B B;  3PVW B;  4CI3 A;  5A2Q g;  1N6F A;  3F3G A;  3JZN A;  3I7O A;  5I5M A;  3IJ0 A;  3OW8 A;  2CE8 A;  4GM9 A;  3SFZ A;  5HYN B;  4U7A A;  2Z2N A;  3EU7 A;  1S4U X;  1MG2 A;  3B7F A;  4CZY A;  4PXW A;  3SMR A;  2H6Q A;  2H9M A;  2P9S C;  4ZOV A;  4MK0 B;  3EWE A;  4QQE A;  4GQ1 A;  4J84 A;  3AL8 B;  2XL2 A;  4UI9 R;  3JRO A;  2I0S A;  4JT5 C;  3JZG A;  2H14 A;  2PM6 B;  2UZY B;  3DSM A;  4Z8L A;  2OK6 A;  4J82 A;  2OIZ A;  4FAV D;  3DWL C;  3IJC A;  2I3T A;  5EAM A;  3ODT A;  3C99 A;  1Q47 A;  4H5J A;  3BWS A;  2B4E A;  3FM0 A;  2TRC B;  4IA9 A;  4HDJ A;  5TEE A;  4L3G D;  5IJ7 E;  2OVP B;  4A2L A;  5HE0 B;  1SHY B;  3EMH A;  4NSX A;  4AOW A;  2YMU A;  1PEV A;  3OKT A;  1QNI A;  2EBS A;  2CE9 A;  3BG0 A;  2H47 A;  4A7J A;  3KRX B;  3I7L A;  1VYH C;  1NEX B;  1FWX A;  4GQB B;  5GXI A;  2I0T A;  3V5W B;  4FA5 D;  4OZU A;  3DXK C;  5TDH B;  3JAM g;  4CI1 A;  3N0E A;  3I7K A;  2BBK H;  5TF2 A;  1A0R B;  3VA6 A;  1JJU B;  3I8E A;  3MKQ A;  3PSC B;  5CXB B;  1TYQ C;  3UKR C;  2G99 A;  2IUV A;  5GSA A;  2AH1 A;  1ERJ A;  4L1Q D;  3I8C A;  3ZWL B;  1MDA H;  3A0F A;  5CYK B;  4A09 B;  4CY3 A;  2H9N A;  5CYK A;  1YFQ A;  4A09 A;  3P4F A;  3OL2 B;  4ZN4 A;  3OL2 A;  4ERY A;  4BH6 A;  1JOF A;  3PE7 A;  3RN0 D;  2IUR A;  3J80 g;  4G56 B;  4GZ8 A;  3V7D B;  2B5N A;  4GGA A;  2IUQ A;  4JT6 C;  4CI2 A;  1GP2 B;  3RFH A;  2G9A A;  3SWS D;  3UR4 A;  4FB1 D;  2P9I C;  4ESG A;  4Y7R A;  3L4O D;  4PSW B;  3F3F A;  4FWW A;  1N6D A;  2P9U C;  2IAA A;  4H5I A;  2P9L C;  3IKO A;  2AH0 A;  2QXV A;  5IGO A;  3U4Y A;  4JD2 C;  3I7P A;  5C2W B;  5IC7 A;  5HE2 B;  3PXS D;  4J78 A;  4U1E I;  3K27 A;  2PM7 B;  3V9F A;  5HE1 B;  2AGL A;  4N14 A;  5FQD A;  1GOT B;  1MG3 A;  4PBZ A;  4QT8 A;  4A0A A;  3N0D A;  4QL1 A;  3C9C A;  3SBP A;  5CXC B;  5CXC A;  4E54 A;  3EG6 A;  3I7H A;  4ZOX A;  5I5I A;  1GG2 B;  5IT9 g;  4FHL A;  3RFG A;  3RRM C;  2AQ5 A;  2P9P C;  2H13 A;  5K19 A;  2J57 G;  4O1Q D;  4JSN C;  4LG8 A;  1B9Y A;  3CFS B;  2H9P A;  4CY1 A;  4YVD A;  2HKM A;  4J87 A;  3UVM A;  4FA1 D;  3RSE C;  3NVN A;  3MZK A;  3FGB A;  5EAL A;  5HE3 B;  3UVK A;  2CO0 C;  2UZX B;  3IIW A;  2HJB A;  4E5Z A;  3RLM D;  3SBR A;  2P9K C;  2OJY A;  4PBY A;  5JWZ A;  2HJ4 A;  4CZX A;  1XIP A;  2HES X;  3UVN A;  3HFQ A;  2Q7Q A;  4O9D A;  1PGU A;  1PI6 A;  4D6V A;  4FA4 D;  3SCY A;  5EMJ B;  1K8K C;  2BCJ B;  4ERQ A;  2YB8 B;  4O3T B;  5H1M A;  2Z2P A;  5IJ8 E;  3SXT D;  4L9O A;  5H17 A;  4D0K A;  4PSX B;  4CI8 A;  2YNO A;  2PBI B;  5SXM A;  3PXW D;  3K26 A;  3L4M D;  2HKR A;  4GGC A;  1B9X A;  5AMS A;  4CC9 A;  4TZ4 A;  2XL3 A;  2PM9 B;  2PM9 A;  1PBY B;  4AEZ A;  1OLZ A;  3OKY B;  5FKS A;  2MTA H;  2AGY A;  3KRW B;  3OKY A;  3SHF A;  1GXR A;  1L0Q A;  4PC0 A;  2O9K A;  2IWF A;  3EI3 B;  3EI3 A;  4JSP C;  2IUP A;  4J79 A;  3W15 A;  3C75 H;  3JPX A;  4X3E A;  3NVQ A;  3CIK B;  4LG9 A;  4GGD A;  5EMM B;  4JXM A;  3IJ1 A;  2AGW A;  4CY2 A;  2H3X A;  4J77 A;  5THA A;  4ES0 A;  3C5M A;  4Y5R D;  3SBQ A;  4LGN A;  5GXH A;  3J81 g;  3UKU C;  3UVO A;  3EI1 A;  3UVL A;  1SQ9 A;  3MZL A;  5EML B;  3PVU B;  4CY5 A;  4XYI A;  2GNQ A;  5I5J A;  3IIY A;  4A0B A;  2YNN A;  3AFC A;  5AFU 3;  4FA9 D;  4A0A B;  2H68 A;  2HXC A;  3VGZ A;  1N6E A;  4A08 B;  3OTT A;  4A08 A;  4JSV C;  3RN1 D;  3ULE C;  3PXT D;  4E54 B;  5FKT A;  3I7N A;  1JMZ B;  4K3J B;  4FAN D;  2YBA A;  3SLE D;  4L3H D;  2CNX A;  3JB9 L;  4O3U B;  4J73 A;  3AL8 A;  1NR0 A;  3EI2 B;  3EI2 A;  3VH0 A;  4GM3 A;  2B5L A;  4ZOZ A;  3ORV D;  4O45 A;  5C9Z B;  2H6K A;  3MMY A;  2IWK A;  2CN2 A;  4GM8 A;  1R5M A;  4QRJ A;  2OVQ B;  5FKQ A;  5B4W A;  3SN6 B;  2AGZ A;  4BL0 A;  4K3I D;  2Z2O A;  5EAP A;  4J0X A;  4A2M A;  5GMK n;  4E5Z B;  4XEI C;  3AL9 A;  1OMW B;  1XKS A;  2B5M A;  2GC4 A;  1SQJ A;  2XU7 A;  2H9L A;  4ERZ A;  3CFV A;  4X61 B;  5K1C C;  3SVW D;  2QC5 A;  1XHM A;  3FRX A;  5KDO B;  2OVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...