2J56H

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- semiquinone in complex with amicyanin.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
375
structure length
375
Chain Sequence
ETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
total genus 96
structure length 375
sequence length 375
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2j56H00
3U4YA 5EAMA 4ZOYA 3I7NA 1JMXB 3ODTA 3PXSD 2H13A 3F3FA 2HJ4A 2Z2NA 3IIWA 2OK6A 3JZGA 3KRXB 3SCYA 4JXMA 2OJYA 2PBIB 5CXCB 2B5MA 3GFCA 3SFZA 3UKUC 5HE1B 3ZWLB 5C9ZB 3B7FA 3OKYA 4X61B 2CE8A 3MXXA 3AL8B 4Y5RD 2H14A 3F3GA 5CYKA 3RN1D 2CN3A 4JD2C 2B5LA 4MK0B 5H17A 4CZVA 3MZKA 3RRMC 3DSMA 3UVLA 5GXHA 1FWXA 1XIPA 3N0DA 4ERYA 3RLMD 3F3PA 2YNOA 4FA1D 4EWRA 3I89A 2CO0C 5IJ8E 2EBSA 4A2MA 2IURA 3IJ0A 4JT6C 5EM2A 4PBYA 2AGLA 5KDOB 1MDAH 5EMJB 3PVWB 2OVRB 3V7DB 4PXWA 1PBYB 3I2NA 3BG1A 5EAPA 2B5NA 4A08A 4JT5C 1YFQA 1TBGA 3BWSA 1L0QA 1JJUB 4PSXB 5FKTA 3SVWD 2AGYA 2H9NA 3OKYB 2OIZA 2IAAA 4XYHA 4ERQA 4GM8A 3OL2A 1U2VC 2BBKH 2PM6B 1OMWB 4O3UB 4NSXA 3MZLA 1NEXB 2H68A 5CXBA 5HE0B 3C9CA 2I0RA 4FHLA 5IT9g 2XL2A 4ERZA 4K3ID 3I8CA 4I79A 4H5IA 4N14A 1K32A 5TEEA 5SXMA 3VA6A 2GC4A 5IGQA 2OVPB 4O1QD 4R7AB 5K19A 3EI2A 3OTTA 3AL9A 2MTAH 4AEZA 5GXIA 3C5MA 3SBQA 3AH8B 4CY3A 5EM2B 4JSNC 3HFQA 4FB1D 2QC5A 4J0WA 4FA9D 4ESGA 3E0CA 2XL3A 4X3EA 4J0XA 3C75H 4A08B 3V5WB 3C99A 4CI8A 4CY5A 4E5ZB 3DXMC 3PSCB 1MG3A 2I3SA 2B4EA 3EI4A 2H6QA 3J80g 3NVNA 4CZYA 3OL2B 4QT8A 2J57G 1GOTB 4J8GA 2P9PC 5CXBB 3P4FA 5HYNB 4AOWA 3SMRA 3SHFA 2AH0A 3CFVA 4LGNA 2O9KA 2P9UC 4GZ8A 5HE3B 5I5IA 4J78A 3UVNA 3PVUB 4IMMA 3UR4A 2YBAA 4BL0A 4J77A 3SLED 5FQDA 3EI2B 3ORVD 4PC0A 5AJAA 5EARA 4JSVC 4BH6A 2H3XA 2OK4A 4L9OA 3RFGA 1A0RB 2IWKA 5FKRA 1GP2B 1NR0A 3EG6A 4A0BA 2PM7B 2HYEA 2IUPA 4ZOVA 1JMZB 3RFHA 1GXRA 2GC7A 3JZNA 1QNIA 4L3HD 3SN6B 1MG2A 3KRWB 4Y7RA 5IC7A 1B9YA 3SBRA 4ES0A 3SJLD 4O9DA 4O3TB 2HESX 2GNQA 4A2LA 4XYIA 4CC9A 5IGOA 2P9NC 4LG8A 5HQGA 2OVQB 1XKSA 5TDHB 4E54A 3UVOA 4X60B 2H9LA 2QXVA 1N6DA 3I8EA 3JROA 3SWSD 3FGBA 4X63B 2CN2A 4ZOXA 3I7OA 5CYKB 1B9XA 2HJBA 2YNNA 1N6FA 4OZUA 2AGXA 4D0KA 1K8KC 2Q7QA 5EALA 4QRJA 2UZXB 3IIYA 3EU7A 3VH0A 4J73A 4TZ4A 3GREA 1PI6A 4FA4D 1SQ9A 3EI3A 5THAA 4J82A 4K3JB 5TEFA 3IJCA 5AFU3 3CIKB 4PSWB 4ZOZA 1SQJA 2H9MA 4LG9A 5C2WB 4H5JA 3JRPA 2TRCB 4J79A 3UVMA 4HDJA 3CFSB 4A11A 2YMUA 4L3GD 2P9SC 3PXTD 2I0TA 5FXYA 2YNPA 3NVQA 5I5JA 4A7JA 4Z8LA 4PBZA 2Z2PA 3AL8A 3MKSB 4UI9R 1N6EA 1P22A 3A0FA 4J84A 4CI3A 3EI1A 2I0SA 3N0EA 4QQEA 3JB9L 4GM3A 2BCJB 3I7LA 1XHMA 4L1QD 3I7PA 1SHYB 3OKTA 5FA5B 2HXCA 3VGZA 2PM9A 4A09A 4D6VA 3EI3B 3NVXA 4XEIC 2P9LC 4BUJC 3SXTD 4A0AA 3L4MD 4A11B 5FKSA 3I7KA 1R5MA 4J86A 2CO0A 5GMKn 3PXWD 3RMZD 2G99A 3OKWA 3JPXA 3ULEC 5FLXg 3BG0A 2P9IC 3EI4B 5GSAA 5JWZA 2CNXA 5A2Qg 3EI1B 3DWLC 3K27A 3IJ1A 2IUQA 4GGDA 4PNKB 3DXKC 1PEVA 2AGWA 5B4WA 5AMSA 4IA9A 1S4UX 2G9AA 3EWEA 2H6NA 5I5MA 2XU7A 4KFMB 4GGCA 4GM9A 4YVDA 3JAMg 3EMHA 3UKRC 1OLZA 3PSLA 2PM9B 4A09B 4OWRA 5TF2A 4GQ2P 4CZXA 4JSXC 2P9KC 2CE9A 4JSPC 3DM0A 4FA5D 4J81A 5EMMB 1GG2B 3K26A 4GQ1A 3UVKA 4O45A 4A0AB 4GGAA 2HKRA 3L4OD 4A0BB 2H47A 1VYHC 2AH1A 5C2VB 4E5ZA 2J55H 3IKOA 3AFCA 4QL1A 4ZN4A 2J56H 4U1EI 5HE2B 2H9PA 4J87A 3SBPA 1ERJA 5EMKB 2AQ5A 5H14A 3FM0A 4U7AA 4CI1A 4CI2A 5CXCA 2UZYB 4FAND 1RI6A 1TYQC 1JOFA 4G56B 3OW8A 3JZHA 3W15A 5FKQA 4FAVD 4FWWA 4E54B 4J8BA 4CY1A 2IUVA 2YB8B 5IJ7E 2W18A 3MMYA 4GMBA 3J81g 4GQBB 3I7HA 3RSEC 2HKMA 1PGUA 4CY2A 5K1CC 3FRXA 3V9FA 2I3TA 3MKQA 2H6KA 3RN0D 3PE7A 1U4CA 2AGZA 2Z2OA 5H1MA 2XYIA 2IWFA 1Q47A 5EMLB
chains in the Genus database with same CATH superfamily
3U4YA 1YR2A 5EAMA 4ZOYA 3I7NA 1JMXB 3ODTA 3PXSD 2H13A 3F3FA 2HJ4A 2Z2NA 1QFMA 3IIWA 2OK6A 3JZGA 3KRXB 3SCYA 4JXMA 2OJYA 2PBIB 5CXCB 2B5MA 3GFCA 3SFZA 3NIGA 3UKUC 4IRZA 5HE1B 3ZWLB 5C9ZB 3B7FA 3OKYA 4X61B 3IUMA 2CE8A 3MXXA 3AL8B 4Y5RD 2H14A 3F3GA 3MUNA 5CYKA 3RN1D 2CN3A 4JD2C 2B5LA 4AN0A 4MK0B 5H17A 4CZVA 3MZKA 3RRMC 3DSMA 3IVMA 3UVLA 5GXHA 1FWXA 1XIPA 1T2XA 3EQ9A 3N0DA 4ERYA 3K6SA 3RLMD 3F3PA 1VE6A 2YNOA 2EIBA 4FA1D 1M1XA 4EWRA 3I89A 2CO0C 5IJ8E 2EBSA 4A2MA 1VZ2A 2IURA 3IJ0A 3IUJA 4JT6C 4WK0A 5M5UA 3FCUA 4Z7QA 5EM2A 4AMYA 4PBYA 2AGLA 3ZDZA 5KDOB 1MDAH 3ZE2A 5EMJB 3PVWB 2OVRB 3V7DB 4PXWA 1PBYB 3I2NA 3BG1A 5EAPA 2B5NA 4A08A 4JT5C 4NBMA 1YFQA 1TBGA 3BWSA 1JJUB 1L0QA 4PSXB 4Z7NA 5FKTA 4WK4A 4BCCA 1GOFA 2AGYA 2H9NA 3OKYB 3SVWD 2OIZA 2IAAA 4AN1A 1VE7A 4XYHA 4ERQA 4GM8A 3OL2A 1U2VC 2BBKH 2PM6B 4JHPC 1OMWB 4O3UB 3EQ8A 4NSXA 3MZLA 1NEXB 2H68A 5CXBA 5HE0B 3C9CA 2I0RA 4FHLA 5IT9g 2XL2A 4ERZA 4K3ID 3I8CA 3NIFA 4I79A 4H5IA 4N14A 1K32A 5TEEA 5SXMA 3VA6A 2GC4A 2VZ3A 5IGQA 2OVPB 4O1QD 4R7AB 5K19A 3EI2A 3OTTA 3AL9A 2BKLA 2MTAH 3DDUA 4AEZA 1GOHA 1C9LA 5GXIA 3C5MA 3SBQA 3AH8B 4CY3A 5EM2B 4JSNC 3O4JA 3HFQA 4AMZA 4FB1D 5FFGA 2QC5A 4J0WA 1E8MA 4FA9D 4ESGA 4BP9A 4NAAA 3O4GA 3E0CA 5HDBA 2XL3A 4X3EA 4J0XA 3C75H 4A08B 1H2ZA 3V5WB 3C99A 4CI8A 4CY5A 4E5ZB 3DXMC 3PSCB 1MG3A 1VZ3A 5M5TA 2QZPA 2I3SA 2B4EA 5M5RA 3EI4A 2H6QA 3K71A 3J80g 3NVNA 4CZYA 3T3MA 3OL2B 4QT8A 2J57G 1GOTB 4J8GA 2P9PC 5CXBB 3P4FA 3T3PA 4AOWA 3SMRA 5HYNB 3SHFA 2AH0A 1E8NA 3CFVA 4LGNA 2O9KA 2P9UC 4GZ8A 5HE3B 5I5IA 4J78A 3UVNA 3PVUB 4IMMA 3UR4A 2YBAA 4BL0A 4J77A 3SLED 5FQDA 3VI3A 3EI2B 2EICA 3ORVD 4BCDA 4PC0A 2VDPA 5AJAA 2VDMA 5EARA 4JSVC 4BH6A 2H3XA 2OK4A 1E5TA 4NC4A 4L9OA 3RFGA 1A0RB 2IWKA 5FKRA 1GP2B 3K72A 1NR0A 3EG6A 4A0BA 2PM7B 3IUQA 4G1EA 2HYEA 2IUPA 4G55A 4ZOVA 1JMZB 3RFHA 1GXRA 2GC7A 2VDKA 4WJKA 3JZNA 1QNIA 4L3HD 3SN6B 1MG2A 3KRWB 4Y7RA 5IC7A 1B9YA 3SBRA 5E6UA 3SJLD 4O9DA 4ES0A 2EIEA 4O3TB 2VDRA 4O2WA 2HESX 4BCBA 2GNQA 4A2LA 4XYIA 4CC9A 3O4HA 2VDNA 5IGOA 2P9NC 4LG8A 5HQGA 2OVQB 1XKSA 5TDHB 4E54A 3UVOA 3NIDA 4X60B 2H9LA 2QR5A 1GOGA 4RE5A 2QXVA 1N6DA 3I8EA 3JROA 4G1MA 3SWSD 3FGBA 1UTCA 4X63B 2CN2A 4ZOXA 4BP8A 3I7OA 5E6SA 5CYKB 1B9XA 2HJBA 2YNNA 1N6FA 3V4PA 4OZUA 2AGXA 4D0KA 1K8KC 2Q7QA 5EALA 4QRJA 2UZXB 3IIYA 3EU7A 5E6RA 3VH0A 4J73A 4TZ4A 3GREA 5FFOA 1PI6A 4FA4D 1SQ9A 3EI3A 5THAA 4J82A 4K3JB 5TEFA 4QAMA 3IJCA 5AFU3 3CIKB 4PSWB 4ZOZA 1SQJA 3OF7A 2H9MA 2XDWA 4LG9A 5C2WB 4H5JA 3JRPA 2TRCB 4J79A 3UVMA 3V4VA 3ZDYA 4HDJA 3CFSB 1O6GA 4A11A 2YMUA 4L3GD 2HU7A 2P9SC 3PXTD 2I0TA 4MMXA 5FXYA 2YNPA 3NVQA 5I5JA 1A12A 2WQ8A 4A7JA 4Z8LA 2VDQA 3QI0A 4PBZA 3ZE1A 2Z2PA 1UOOA 3AL8A 3MKSB 4UI9R 1N6EA 1P22A 3A0FA 4J84A 4WK2A 3MUOA 4CI3A 4L1MA 4UM9A 3EI1A 2I0SA 3N0EA 4QQEA 5M5SA 3JB9L 4GM3A 2BCJB 4AX4A 3I7LA 1XHMA 4L1QD 1JV2A 3I7PA 4O02A 5M5VA 1SHYB 2XE4A 3OKTA 5FA5B 2HXCA 3ZE0A 3VGZA 2PM9A 4A09A 2HU8A 4D6VA 3EI3B 3NVXA 4DNWA 4XEIC 2P9LC 1H2WA 3IUNA 1L5GA 4BUJC 3IJEA 3SXTD 3KCIA 4A0AA 3L4MD 2VZ1A 4A11B 5FKSA 3I7KA 1R5MA 4J86A 2CO0A 5GMKn 3PXWD 3RMZD 2G99A 2VC2A 3OKWA 3JPXA 1TYEA 3ULEC 5FLXg 1BPOA 3BG0A 5C92A 2P9IC 2VDOA 3EI4B 2EIDA 5GSAA 5JWZA 2CNXA 5A2Qg 3EI1B 3DWLC 2VDLA 3FCSA 3K27A 3IJ1A 2IUQA 2XZGA 4GGDA 4PNKB 4D9SA 3DXKC 1PEVA 2AGWA 5B4WA 5AMSA 4IA9A 1S4UX 2G9AA 3EWEA 2H6NA 5I5MA 2XU7A 4KFMB 4GGCA 4GM9A 4YVDA 3JAMg 1K3IA 3EMHA 3UKRC 1C9IA 1OLZA 3PSLA 2PM9B 4A09B 4OWRA 5TF2A 4GQ2P 4CZXA 4JSXC 3QHYB 4UM8A 2P9KC 2CE9A 4RE6A 4JSPC 3DM0A 4FA5D 4J81A 5C86A 5EMMB 1GG2B 3K26A 4GQ1A 3UVKA 4O45A 4DNUA 1O6FA 4A0AB 4GGAA 2HKRA 1I2MB 3L4OD 4A0BB 2JKXA 2H47A 1VYHC 2AH1A 5C2VB 4E5ZA 3MVDK 1UOQA 1U8CA 2J55H 3IKOA 4Z7OA 3AFCA 4QL1A 4ZN4A 3GC3B 2J56H 4U1EI 5HE2B 2H9PA 4J87A 1QFSA 3SBPA 1ERJA 5EMKB 2AQ5A 3IULA 3FM0A 4U7AA 5H14A 4CI1A 4CI2A 5CXCA 2UZYB 4FAND 1RI6A 1TYQC 4JHNA 1JOFA 3IURA 4MMYA 4G56B 3OW8A 3JZHA 3W15A 5FKQA 4FAVD 4FWWA 4E54B 4J8BA 1UOPA 4CY1A 3O4IA 2IUVA 1H2XA 2YB8B 5M61A 1JTDB 5IJ7E 4DNVA 2W18A 3EQ7A 3MMYA 4GMBA 3J81g 4GQBB 3I7HA 3RSEC 2HKMA 1PGUA 4CY2A 5K1CC 3FRXA 4MMZA 3V9FA 2I3TA 3MKQA 2H6KA 3RN0D 4NENA 3GD1I 3PE7A 1U4CA 2AGZA 2Z2OA 1H2YA 5H1MA 3ZDXA 3VI4A 2HU5A 2XYIA 2IWFA 1Q47A 5EMLB
chains in the Genus database with same CATH topology
3U4YA 5EAMA 4ZOYA 3I7NA 1JMXB 3ODTA 3PXSD 2H13A 3F3FA 2HJ4A 2Z2NA 3IIWA 2OK6A 3JZGA 3KRXB 3SCYA 4JXMA 2OJYA 2PBIB 5CXCB 2B5MA 3GFCA 3SFZA 3UKUC 5HE1B 3ZWLB 5C9ZB 3B7FA 3OKYA 4X61B 2CE8A 3MXXA 3AL8B 4Y5RD 2H14A 3F3GA 5CYKA 3RN1D 2CN3A 4JD2C 2B5LA 4MK0B 5H17A 4CZVA 3MZKA 3RRMC 3DSMA 3UVLA 5GXHA 1FWXA 1XIPA 3N0DA 4ERYA 3RLMD 3F3PA 2YNOA 4FA1D 4EWRA 3I89A 2CO0C 5IJ8E 2EBSA 4A2MA 2IURA 3IJ0A 4JT6C 5EM2A 4PBYA 2AGLA 5KDOB 1MDAH 5EMJB 3PVWB 2OVRB 3V7DB 4PXWA 1PBYB 3I2NA 3BG1A 5EAPA 2B5NA 4A08A 4JT5C 1YFQA 1TBGA 3BWSA 1L0QA 1JJUB 4PSXB 5FKTA 3SVWD 2AGYA 2H9NA 3OKYB 2OIZA 2IAAA 4XYHA 4ERQA 4GM8A 3OL2A 1U2VC 2BBKH 2PM6B 1OMWB 4O3UB 4NSXA 3MZLA 1NEXB 2H68A 5CXBA 5HE0B 3C9CA 2I0RA 4FHLA 5IT9g 2XL2A 4ERZA 4K3ID 3I8CA 4I79A 4H5IA 4N14A 1K32A 5TEEA 5SXMA 3VA6A 2GC4A 5IGQA 2OVPB 4O1QD 4R7AB 5K19A 3EI2A 3OTTA 3AL9A 2MTAH 4AEZA 5GXIA 3C5MA 3SBQA 3AH8B 4CY3A 5EM2B 4JSNC 3HFQA 4FB1D 2QC5A 4J0WA 4FA9D 4ESGA 3E0CA 2XL3A 4X3EA 4J0XA 3C75H 4A08B 3V5WB 3C99A 4CI8A 4CY5A 4E5ZB 3DXMC 3PSCB 1MG3A 2I3SA 2B4EA 3EI4A 2H6QA 3J80g 3NVNA 4CZYA 3OL2B 4QT8A 2J57G 1GOTB 4J8GA 2P9PC 5CXBB 3P4FA 5HYNB 4AOWA 3SMRA 3SHFA 2AH0A 3CFVA 4LGNA 2O9KA 2P9UC 4GZ8A 5HE3B 5I5IA 4J78A 3UVNA 3PVUB 4IMMA 3UR4A 2YBAA 4BL0A 4J77A 3SLED 5FQDA 3EI2B 3ORVD 4PC0A 5AJAA 5EARA 4JSVC 4BH6A 2H3XA 2OK4A 4L9OA 3RFGA 1A0RB 2IWKA 5FKRA 1GP2B 1NR0A 3EG6A 4A0BA 2PM7B 2HYEA 2IUPA 4ZOVA 1JMZB 3RFHA 1GXRA 2GC7A 3JZNA 1QNIA 4L3HD 3SN6B 1MG2A 3KRWB 4Y7RA 5IC7A 1B9YA 3SBRA 4ES0A 3SJLD 4O9DA 4O3TB 2HESX 2GNQA 4A2LA 4XYIA 4CC9A 5IGOA 2P9NC 4LG8A 5HQGA 2OVQB 1XKSA 5TDHB 4E54A 3UVOA 4X60B 2H9LA 2QXVA 1N6DA 3I8EA 3JROA 3SWSD 3FGBA 4X63B 2CN2A 4ZOXA 3I7OA 5CYKB 1B9XA 2HJBA 2YNNA 1N6FA 4OZUA 2AGXA 4D0KA 1K8KC 2Q7QA 5EALA 4QRJA 2UZXB 3IIYA 3EU7A 3VH0A 4J73A 4TZ4A 3GREA 1PI6A 4FA4D 1SQ9A 3EI3A 5THAA 4J82A 4K3JB 5TEFA 3IJCA 5AFU3 3CIKB 4PSWB 4ZOZA 1SQJA 2H9MA 4LG9A 5C2WB 4H5JA 3JRPA 2TRCB 4J79A 3UVMA 4HDJA 3CFSB 4A11A 2YMUA 4L3GD 2P9SC 3PXTD 2I0TA 5FXYA 2YNPA 3NVQA 5I5JA 4A7JA 4Z8LA 4PBZA 2Z2PA 3AL8A 3MKSB 4UI9R 1N6EA 1P22A 3A0FA 4J84A 4CI3A 3EI1A 2I0SA 3N0EA 4QQEA 3JB9L 4GM3A 2BCJB 3I7LA 1XHMA 4L1QD 3I7PA 1SHYB 3OKTA 5FA5B 2HXCA 3VGZA 2PM9A 4A09A 4D6VA 3EI3B 3NVXA 4XEIC 2P9LC 4BUJC 3SXTD 4A0AA 3L4MD 4A11B 5FKSA 3I7KA 1R5MA 4J86A 2CO0A 5GMKn 3PXWD 3RMZD 2G99A 3OKWA 3JPXA 3ULEC 5FLXg 3BG0A 2P9IC 3EI4B 5GSAA 5JWZA 2CNXA 5A2Qg 3EI1B 3DWLC 3K27A 3IJ1A 2IUQA 4GGDA 4PNKB 3DXKC 1PEVA 2AGWA 5B4WA 5AMSA 4IA9A 1S4UX 2G9AA 3EWEA 2H6NA 5I5MA 2XU7A 4KFMB 4GGCA 4GM9A 4YVDA 3JAMg 3EMHA 3UKRC 1OLZA 3PSLA 2PM9B 4A09B 4OWRA 5TF2A 4GQ2P 4CZXA 4JSXC 2P9KC 2CE9A 4JSPC 3DM0A 4FA5D 4J81A 5EMMB 1GG2B 3K26A 4GQ1A 3UVKA 4O45A 4A0AB 4GGAA 2HKRA 3L4OD 4A0BB 2H47A 1VYHC 2AH1A 5C2VB 4E5ZA 2J55H 3IKOA 3AFCA 4QL1A 4ZN4A 2J56H 4U1EI 5HE2B 2H9PA 4J87A 3SBPA 1ERJA 5EMKB 2AQ5A 5H14A 3FM0A 4U7AA 4CI1A 4CI2A 5CXCA 2UZYB 4FAND 1RI6A 1TYQC 1JOFA 4G56B 3OW8A 3JZHA 3W15A 5FKQA 4FAVD 4FWWA 4E54B 4J8BA 4CY1A 2IUVA 2YB8B 5IJ7E 2W18A 3MMYA 4GMBA 3J81g 4GQBB 3I7HA 3RSEC 2HKMA 1PGUA 4CY2A 5K1CC 3FRXA 3V9FA 2I3TA 3MKQA 2H6KA 3RN0D 3PE7A 1U4CA 2AGZA 2Z2OA 5H1MA 2XYIA 2IWFA 1Q47A 5EMLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4Y A;  5EAM A;  4ZOY A;  3I7N A;  1JMX B;  3ODT A;  3PXS D;  2H13 A;  3F3F A;  2HJ4 A;  2Z2N A;  3IIW A;  2OK6 A;  3JZG A;  3KRX B;  3SCY A;  4JXM A;  2OJY A;  2PBI B;  5CXC B;  2B5M A;  3GFC A;  3SFZ A;  3UKU C;  5HE1 B;  3ZWL B;  5C9Z B;  3B7F A;  3OKY A;  4X61 B;  2CE8 A;  3MXX A;  3AL8 B;  4Y5R D;  2H14 A;  3F3G A;  5CYK A;  3RN1 D;  2CN3 A;  4JD2 C;  2B5L A;  4MK0 B;  5H17 A;  4CZV A;  3MZK A;  3RRM C;  3DSM A;  3UVL A;  5GXH A;  1FWX A;  1XIP A;  3N0D A;  4ERY A;  3RLM D;  3F3P A;  2YNO A;  4FA1 D;  4EWR A;  3I89 A;  2CO0 C;  5IJ8 E;  2EBS A;  4A2M A;  2IUR A;  3IJ0 A;  4JT6 C;  5EM2 A;  4PBY A;  2AGL A;  5KDO B;  1MDA H;  5EMJ B;  3PVW B;  2OVR B;  3V7D B;  4PXW A;  1PBY B;  3I2N A;  3BG1 A;  5EAP A;  2B5N A;  4A08 A;  4JT5 C;  1YFQ A;  1TBG A;  3BWS A;  1L0Q A;  1JJU B;  4PSX B;  5FKT A;  3SVW D;  2AGY A;  2H9N A;  3OKY B;  2OIZ A;  2IAA A;  4XYH A;  4ERQ A;  4GM8 A;  3OL2 A;  1U2V C;  2BBK H;  2PM6 B;  1OMW B;  4O3U B;  4NSX A;  3MZL A;  1NEX B;  2H68 A;  5CXB A;  5HE0 B;  3C9C A;  2I0R A;  4FHL A;  5IT9 g;  2XL2 A;  4ERZ A;  4K3I D;  3I8C A;  4I79 A;  4H5I A;  4N14 A;  1K32 A;  5TEE A;  5SXM A;  3VA6 A;  2GC4 A;  5IGQ A;  2OVP B;  4O1Q D;  4R7A B;  5K19 A;  3EI2 A;  3OTT A;  3AL9 A;  2MTA H;  4AEZ A;  5GXI A;  3C5M A;  3SBQ A;  3AH8 B;  4CY3 A;  5EM2 B;  4JSN C;  3HFQ A;  4FB1 D;  2QC5 A;  4J0W A;  4FA9 D;  4ESG A;  3E0C A;  2XL3 A;  4X3E A;  4J0X A;  3C75 H;  4A08 B;  3V5W B;  3C99 A;  4CI8 A;  4CY5 A;  4E5Z B;  3DXM C;  3PSC B;  1MG3 A;  2I3S A;  2B4E A;  3EI4 A;  2H6Q A;  3J80 g;  3NVN A;  4CZY A;  3OL2 B;  4QT8 A;  2J57 G;  1GOT B;  4J8G A;  2P9P C;  5CXB B;  3P4F A;  5HYN B;  4AOW A;  3SMR A;  3SHF A;  2AH0 A;  3CFV A;  4LGN A;  2O9K A;  2P9U C;  4GZ8 A;  5HE3 B;  5I5I A;  4J78 A;  3UVN A;  3PVU B;  4IMM A;  3UR4 A;  2YBA A;  4BL0 A;  4J77 A;  3SLE D;  5FQD A;  3EI2 B;  3ORV D;  4PC0 A;  5AJA A;  5EAR A;  4JSV C;  4BH6 A;  2H3X A;  2OK4 A;  4L9O A;  3RFG A;  1A0R B;  2IWK A;  5FKR A;  1GP2 B;  1NR0 A;  3EG6 A;  4A0B A;  2PM7 B;  2HYE A;  2IUP A;  4ZOV A;  1JMZ B;  3RFH A;  1GXR A;  2GC7 A;  3JZN A;  1QNI A;  4L3H D;  3SN6 B;  1MG2 A;  3KRW B;  4Y7R A;  5IC7 A;  1B9Y A;  3SBR A;  4ES0 A;  3SJL D;  4O9D A;  4O3T B;  2HES X;  2GNQ A;  4A2L A;  4XYI A;  4CC9 A;  5IGO A;  2P9N C;  4LG8 A;  5HQG A;  2OVQ B;  1XKS A;  5TDH B;  4E54 A;  3UVO A;  4X60 B;  2H9L A;  2QXV A;  1N6D A;  3I8E A;  3JRO A;  3SWS D;  3FGB A;  4X63 B;  2CN2 A;  4ZOX A;  3I7O A;  5CYK B;  1B9X A;  2HJB A;  2YNN A;  1N6F A;  4OZU A;  2AGX A;  4D0K A;  1K8K C;  2Q7Q A;  5EAL A;  4QRJ A;  2UZX B;  3IIY A;  3EU7 A;  3VH0 A;  4J73 A;  4TZ4 A;  3GRE A;  1PI6 A;  4FA4 D;  1SQ9 A;  3EI3 A;  5THA A;  4J82 A;  4K3J B;  5TEF A;  3IJC A;  5AFU 3;  3CIK B;  4PSW B;  4ZOZ A;  1SQJ A;  2H9M A;  4LG9 A;  5C2W B;  4H5J A;  3JRP A;  2TRC B;  4J79 A;  3UVM A;  4HDJ A;  3CFS B;  4A11 A;  2YMU A;  4L3G D;  2P9S C;  3PXT D;  2I0T A;  5FXY A;  2YNP A;  3NVQ A;  5I5J A;  4A7J A;  4Z8L A;  4PBZ A;  2Z2P A;  3AL8 A;  3MKS B;  4UI9 R;  1N6E A;  1P22 A;  3A0F A;  4J84 A;  4CI3 A;  3EI1 A;  2I0S A;  3N0E A;  4QQE A;  3JB9 L;  4GM3 A;  2BCJ B;  3I7L A;  1XHM A;  4L1Q D;  3I7P A;  1SHY B;  3OKT A;  5FA5 B;  2HXC A;  3VGZ A;  2PM9 A;  4A09 A;  4D6V A;  3EI3 B;  3NVX A;  4XEI C;  2P9L C;  4BUJ C;  3SXT D;  4A0A A;  3L4M D;  4A11 B;  5FKS A;  3I7K A;  1R5M A;  4J86 A;  2CO0 A;  5GMK n;  3PXW D;  3RMZ D;  2G99 A;  3OKW A;  3JPX A;  3ULE C;  5FLX g;  3BG0 A;  2P9I C;  3EI4 B;  5GSA A;  5JWZ A;  2CNX A;  5A2Q g;  3EI1 B;  3DWL C;  3K27 A;  3IJ1 A;  2IUQ A;  4GGD A;  4PNK B;  3DXK C;  1PEV A;  2AGW A;  5B4W A;  5AMS A;  4IA9 A;  1S4U X;  2G9A A;  3EWE A;  2H6N A;  5I5M A;  2XU7 A;  4KFM B;  4GGC A;  4GM9 A;  4YVD A;  3JAM g;  3EMH A;  3UKR C;  1OLZ A;  3PSL A;  2PM9 B;  4A09 B;  4OWR A;  5TF2 A;  4GQ2 P;  4CZX A;  4JSX C;  2P9K C;  2CE9 A;  4JSP C;  3DM0 A;  4FA5 D;  4J81 A;  5EMM B;  1GG2 B;  3K26 A;  4GQ1 A;  3UVK A;  4O45 A;  4A0A B;  4GGA A;  2HKR A;  3L4O D;  4A0B B;  2H47 A;  1VYH C;  2AH1 A;  5C2V B;  4E5Z A;  2J55 H;  3IKO A;  3AFC A;  4QL1 A;  4ZN4 A;  2J56 H;  4U1E I;  5HE2 B;  2H9P A;  4J87 A;  3SBP A;  1ERJ A;  5EMK B;  2AQ5 A;  5H14 A;  3FM0 A;  4U7A A;  4CI1 A;  4CI2 A;  5CXC A;  2UZY B;  4FAN D;  1RI6 A;  1TYQ C;  1JOF A;  4G56 B;  3OW8 A;  3JZH A;  3W15 A;  5FKQ A;  4FAV D;  4FWW A;  4E54 B;  4J8B A;  4CY1 A;  2IUV A;  2YB8 B;  5IJ7 E;  2W18 A;  3MMY A;  4GMB A;  3J81 g;  4GQB B;  3I7H A;  3RSE C;  2HKM A;  1PGU A;  4CY2 A;  5K1C C;  3FRX A;  3V9F A;  2I3T A;  3MKQ A;  2H6K A;  3RN0 D;  3PE7 A;  1U4C A;  2AGZ A;  2Z2O A;  5H1M A;  2XYI A;  2IWF A;  1Q47 A;  5EML B; 
#chains in the Genus database with same CATH topology
 3U4Y A;  1YR2 A;  5EAM A;  4ZOY A;  3I7N A;  1JMX B;  3ODT A;  3PXS D;  2H13 A;  3F3F A;  2HJ4 A;  2Z2N A;  1QFM A;  3IIW A;  2OK6 A;  3JZG A;  3KRX B;  3SCY A;  4JXM A;  2OJY A;  2PBI B;  5CXC B;  2B5M A;  3GFC A;  3SFZ A;  3NIG A;  3UKU C;  4IRZ A;  5HE1 B;  3ZWL B;  5C9Z B;  3B7F A;  3OKY A;  4X61 B;  3IUM A;  2CE8 A;  3MXX A;  3AL8 B;  4Y5R D;  2H14 A;  3F3G A;  3MUN A;  5CYK A;  3RN1 D;  2CN3 A;  4JD2 C;  2B5L A;  4AN0 A;  4MK0 B;  5H17 A;  4CZV A;  3MZK A;  3RRM C;  3DSM A;  3IVM A;  3UVL A;  5GXH A;  1FWX A;  1XIP A;  1T2X A;  3EQ9 A;  3N0D A;  4ERY A;  3K6S A;  3RLM D;  3F3P A;  1VE6 A;  2YNO A;  2EIB A;  4FA1 D;  1M1X A;  4EWR A;  3I89 A;  2CO0 C;  5IJ8 E;  2EBS A;  4A2M A;  1VZ2 A;  2IUR A;  3IJ0 A;  3IUJ A;  4JT6 C;  4WK0 A;  5M5U A;  3FCU A;  4Z7Q A;  5EM2 A;  4AMY A;  4PBY A;  2AGL A;  3ZDZ A;  5KDO B;  1MDA H;  3ZE2 A;  5EMJ B;  3PVW B;  2OVR B;  3V7D B;  4PXW A;  1PBY B;  3I2N A;  3BG1 A;  5EAP A;  2B5N A;  4A08 A;  4JT5 C;  4NBM A;  1YFQ A;  1TBG A;  3BWS A;  1JJU B;  1L0Q A;  4PSX B;  4Z7N A;  5FKT A;  4WK4 A;  4BCC A;  1GOF A;  2AGY A;  2H9N A;  3OKY B;  3SVW D;  2OIZ A;  2IAA A;  4AN1 A;  1VE7 A;  4XYH A;  4ERQ A;  4GM8 A;  3OL2 A;  1U2V C;  2BBK H;  2PM6 B;  4JHP C;  1OMW B;  4O3U B;  3EQ8 A;  4NSX A;  3MZL A;  1NEX B;  2H68 A;  5CXB A;  5HE0 B;  3C9C A;  2I0R A;  4FHL A;  5IT9 g;  2XL2 A;  4ERZ A;  4K3I D;  3I8C A;  3NIF A;  4I79 A;  4H5I A;  4N14 A;  1K32 A;  5TEE A;  5SXM A;  3VA6 A;  2GC4 A;  2VZ3 A;  5IGQ A;  2OVP B;  4O1Q D;  4R7A B;  5K19 A;  3EI2 A;  3OTT A;  3AL9 A;  2BKL A;  2MTA H;  3DDU A;  4AEZ A;  1GOH A;  1C9L A;  5GXI A;  3C5M A;  3SBQ A;  3AH8 B;  4CY3 A;  5EM2 B;  4JSN C;  3O4J A;  3HFQ A;  4AMZ A;  4FB1 D;  5FFG A;  2QC5 A;  4J0W A;  1E8M A;  4FA9 D;  4ESG A;  4BP9 A;  4NAA A;  3O4G A;  3E0C A;  5HDB A;  2XL3 A;  4X3E A;  4J0X A;  3C75 H;  4A08 B;  1H2Z A;  3V5W B;  3C99 A;  4CI8 A;  4CY5 A;  4E5Z B;  3DXM C;  3PSC B;  1MG3 A;  1VZ3 A;  5M5T A;  2QZP A;  2I3S A;  2B4E A;  5M5R A;  3EI4 A;  2H6Q A;  3K71 A;  3J80 g;  3NVN A;  4CZY A;  3T3M A;  3OL2 B;  4QT8 A;  2J57 G;  1GOT B;  4J8G A;  2P9P C;  5CXB B;  3P4F A;  3T3P A;  4AOW A;  3SMR A;  5HYN B;  3SHF A;  2AH0 A;  1E8N A;  3CFV A;  4LGN A;  2O9K A;  2P9U C;  4GZ8 A;  5HE3 B;  5I5I A;  4J78 A;  3UVN A;  3PVU B;  4IMM A;  3UR4 A;  2YBA A;  4BL0 A;  4J77 A;  3SLE D;  5FQD A;  3VI3 A;  3EI2 B;  2EIC A;  3ORV D;  4BCD A;  4PC0 A;  2VDP A;  5AJA A;  2VDM A;  5EAR A;  4JSV C;  4BH6 A;  2H3X A;  2OK4 A;  1E5T A;  4NC4 A;  4L9O A;  3RFG A;  1A0R B;  2IWK A;  5FKR A;  1GP2 B;  3K72 A;  1NR0 A;  3EG6 A;  4A0B A;  2PM7 B;  3IUQ A;  4G1E A;  2HYE A;  2IUP A;  4G55 A;  4ZOV A;  1JMZ B;  3RFH A;  1GXR A;  2GC7 A;  2VDK A;  4WJK A;  3JZN A;  1QNI A;  4L3H D;  3SN6 B;  1MG2 A;  3KRW B;  4Y7R A;  5IC7 A;  1B9Y A;  3SBR A;  5E6U A;  3SJL D;  4O9D A;  4ES0 A;  2EIE A;  4O3T B;  2VDR A;  4O2W A;  2HES X;  4BCB A;  2GNQ A;  4A2L A;  4XYI A;  4CC9 A;  3O4H A;  2VDN A;  5IGO A;  2P9N C;  4LG8 A;  5HQG A;  2OVQ B;  1XKS A;  5TDH B;  4E54 A;  3UVO A;  3NID A;  4X60 B;  2H9L A;  2QR5 A;  1GOG A;  4RE5 A;  2QXV A;  1N6D A;  3I8E A;  3JRO A;  4G1M A;  3SWS D;  3FGB A;  1UTC A;  4X63 B;  2CN2 A;  4ZOX A;  4BP8 A;  3I7O A;  5E6S A;  5CYK B;  1B9X A;  2HJB A;  2YNN A;  1N6F A;  3V4P A;  4OZU A;  2AGX A;  4D0K A;  1K8K C;  2Q7Q A;  5EAL A;  4QRJ A;  2UZX B;  3IIY A;  3EU7 A;  5E6R A;  3VH0 A;  4J73 A;  4TZ4 A;  3GRE A;  5FFO A;  1PI6 A;  4FA4 D;  1SQ9 A;  3EI3 A;  5THA A;  4J82 A;  4K3J B;  5TEF A;  4QAM A;  3IJC A;  5AFU 3;  3CIK B;  4PSW B;  4ZOZ A;  1SQJ A;  3OF7 A;  2H9M A;  2XDW A;  4LG9 A;  5C2W B;  4H5J A;  3JRP A;  2TRC B;  4J79 A;  3UVM A;  3V4V A;  3ZDY A;  4HDJ A;  3CFS B;  1O6G A;  4A11 A;  2YMU A;  4L3G D;  2HU7 A;  2P9S C;  3PXT D;  2I0T A;  4MMX A;  5FXY A;  2YNP A;  3NVQ A;  5I5J A;  1A12 A;  2WQ8 A;  4A7J A;  4Z8L A;  2VDQ A;  3QI0 A;  4PBZ A;  3ZE1 A;  2Z2P A;  1UOO A;  3AL8 A;  3MKS B;  4UI9 R;  1N6E A;  1P22 A;  3A0F A;  4J84 A;  4WK2 A;  3MUO A;  4CI3 A;  4L1M A;  4UM9 A;  3EI1 A;  2I0S A;  3N0E A;  4QQE A;  5M5S A;  3JB9 L;  4GM3 A;  2BCJ B;  4AX4 A;  3I7L A;  1XHM A;  4L1Q D;  1JV2 A;  3I7P A;  4O02 A;  5M5V A;  1SHY B;  2XE4 A;  3OKT A;  5FA5 B;  2HXC A;  3ZE0 A;  3VGZ A;  2PM9 A;  4A09 A;  2HU8 A;  4D6V A;  3EI3 B;  3NVX A;  4DNW A;  4XEI C;  2P9L C;  1H2W A;  3IUN A;  1L5G A;  4BUJ C;  3IJE A;  3SXT D;  3KCI A;  4A0A A;  3L4M D;  2VZ1 A;  4A11 B;  5FKS A;  3I7K A;  1R5M A;  4J86 A;  2CO0 A;  5GMK n;  3PXW D;  3RMZ D;  2G99 A;  2VC2 A;  3OKW A;  3JPX A;  1TYE A;  3ULE C;  5FLX g;  1BPO A;  3BG0 A;  5C92 A;  2P9I C;  2VDO A;  3EI4 B;  2EID A;  5GSA A;  5JWZ A;  2CNX A;  5A2Q g;  3EI1 B;  3DWL C;  2VDL A;  3FCS A;  3K27 A;  3IJ1 A;  2IUQ A;  2XZG A;  4GGD A;  4PNK B;  4D9S A;  3DXK C;  1PEV A;  2AGW A;  5B4W A;  5AMS A;  4IA9 A;  1S4U X;  2G9A A;  3EWE A;  2H6N A;  5I5M A;  2XU7 A;  4KFM B;  4GGC A;  4GM9 A;  4YVD A;  3JAM g;  1K3I A;  3EMH A;  3UKR C;  1C9I A;  1OLZ A;  3PSL A;  2PM9 B;  4A09 B;  4OWR A;  5TF2 A;  4GQ2 P;  4CZX A;  4JSX C;  3QHY B;  4UM8 A;  2P9K C;  2CE9 A;  4RE6 A;  4JSP C;  3DM0 A;  4FA5 D;  4J81 A;  5C86 A;  5EMM B;  1GG2 B;  3K26 A;  4GQ1 A;  3UVK A;  4O45 A;  4DNU A;  1O6F A;  4A0A B;  4GGA A;  2HKR A;  1I2M B;  3L4O D;  4A0B B;  2JKX A;  2H47 A;  1VYH C;  2AH1 A;  5C2V B;  4E5Z A;  3MVD K;  1UOQ A;  1U8C A;  2J55 H;  3IKO A;  4Z7O A;  3AFC A;  4QL1 A;  4ZN4 A;  3GC3 B;  2J56 H;  4U1E I;  5HE2 B;  2H9P A;  4J87 A;  1QFS A;  3SBP A;  1ERJ A;  5EMK B;  2AQ5 A;  3IUL A;  3FM0 A;  4U7A A;  5H14 A;  4CI1 A;  4CI2 A;  5CXC A;  2UZY B;  4FAN D;  1RI6 A;  1TYQ C;  4JHN A;  1JOF A;  3IUR A;  4MMY A;  4G56 B;  3OW8 A;  3JZH A;  3W15 A;  5FKQ A;  4FAV D;  4FWW A;  4E54 B;  4J8B A;  1UOP A;  4CY1 A;  3O4I A;  2IUV A;  1H2X A;  2YB8 B;  5M61 A;  1JTD B;  5IJ7 E;  4DNV A;  2W18 A;  3EQ7 A;  3MMY A;  4GMB A;  3J81 g;  4GQB B;  3I7H A;  3RSE C;  2HKM A;  1PGU A;  4CY2 A;  5K1C C;  3FRX A;  4MMZ A;  3V9F A;  2I3T A;  3MKQ A;  2H6K A;  3RN0 D;  4NEN A;  3GD1 I;  3PE7 A;  1U4C A;  2AGZ A;  2Z2O A;  1H2Y A;  5H1M A;  3ZDX A;  3VI4 A;  2HU5 A;  2XYI A;  2IWF A;  1Q47 A;  5EML B; 
#chains in the Genus database with same CATH homology
 3U4Y A;  5EAM A;  4ZOY A;  3I7N A;  1JMX B;  3ODT A;  3PXS D;  2H13 A;  3F3F A;  2HJ4 A;  2Z2N A;  3IIW A;  2OK6 A;  3JZG A;  3KRX B;  3SCY A;  4JXM A;  2OJY A;  2PBI B;  5CXC B;  2B5M A;  3GFC A;  3SFZ A;  3UKU C;  5HE1 B;  3ZWL B;  5C9Z B;  3B7F A;  3OKY A;  4X61 B;  2CE8 A;  3MXX A;  3AL8 B;  4Y5R D;  2H14 A;  3F3G A;  5CYK A;  3RN1 D;  2CN3 A;  4JD2 C;  2B5L A;  4MK0 B;  5H17 A;  4CZV A;  3MZK A;  3RRM C;  3DSM A;  3UVL A;  5GXH A;  1FWX A;  1XIP A;  3N0D A;  4ERY A;  3RLM D;  3F3P A;  2YNO A;  4FA1 D;  4EWR A;  3I89 A;  2CO0 C;  5IJ8 E;  2EBS A;  4A2M A;  2IUR A;  3IJ0 A;  4JT6 C;  5EM2 A;  4PBY A;  2AGL A;  5KDO B;  1MDA H;  5EMJ B;  3PVW B;  2OVR B;  3V7D B;  4PXW A;  1PBY B;  3I2N A;  3BG1 A;  5EAP A;  2B5N A;  4A08 A;  4JT5 C;  1YFQ A;  1TBG A;  3BWS A;  1L0Q A;  1JJU B;  4PSX B;  5FKT A;  3SVW D;  2AGY A;  2H9N A;  3OKY B;  2OIZ A;  2IAA A;  4XYH A;  4ERQ A;  4GM8 A;  3OL2 A;  1U2V C;  2BBK H;  2PM6 B;  1OMW B;  4O3U B;  4NSX A;  3MZL A;  1NEX B;  2H68 A;  5CXB A;  5HE0 B;  3C9C A;  2I0R A;  4FHL A;  5IT9 g;  2XL2 A;  4ERZ A;  4K3I D;  3I8C A;  4I79 A;  4H5I A;  4N14 A;  1K32 A;  5TEE A;  5SXM A;  3VA6 A;  2GC4 A;  5IGQ A;  2OVP B;  4O1Q D;  4R7A B;  5K19 A;  3EI2 A;  3OTT A;  3AL9 A;  2MTA H;  4AEZ A;  5GXI A;  3C5M A;  3SBQ A;  3AH8 B;  4CY3 A;  5EM2 B;  4JSN C;  3HFQ A;  4FB1 D;  2QC5 A;  4J0W A;  4FA9 D;  4ESG A;  3E0C A;  2XL3 A;  4X3E A;  4J0X A;  3C75 H;  4A08 B;  3V5W B;  3C99 A;  4CI8 A;  4CY5 A;  4E5Z B;  3DXM C;  3PSC B;  1MG3 A;  2I3S A;  2B4E A;  3EI4 A;  2H6Q A;  3J80 g;  3NVN A;  4CZY A;  3OL2 B;  4QT8 A;  2J57 G;  1GOT B;  4J8G A;  2P9P C;  5CXB B;  3P4F A;  5HYN B;  4AOW A;  3SMR A;  3SHF A;  2AH0 A;  3CFV A;  4LGN A;  2O9K A;  2P9U C;  4GZ8 A;  5HE3 B;  5I5I A;  4J78 A;  3UVN A;  3PVU B;  4IMM A;  3UR4 A;  2YBA A;  4BL0 A;  4J77 A;  3SLE D;  5FQD A;  3EI2 B;  3ORV D;  4PC0 A;  5AJA A;  5EAR A;  4JSV C;  4BH6 A;  2H3X A;  2OK4 A;  4L9O A;  3RFG A;  1A0R B;  2IWK A;  5FKR A;  1GP2 B;  1NR0 A;  3EG6 A;  4A0B A;  2PM7 B;  2HYE A;  2IUP A;  4ZOV A;  1JMZ B;  3RFH A;  1GXR A;  2GC7 A;  3JZN A;  1QNI A;  4L3H D;  3SN6 B;  1MG2 A;  3KRW B;  4Y7R A;  5IC7 A;  1B9Y A;  3SBR A;  4ES0 A;  3SJL D;  4O9D A;  4O3T B;  2HES X;  2GNQ A;  4A2L A;  4XYI A;  4CC9 A;  5IGO A;  2P9N C;  4LG8 A;  5HQG A;  2OVQ B;  1XKS A;  5TDH B;  4E54 A;  3UVO A;  4X60 B;  2H9L A;  2QXV A;  1N6D A;  3I8E A;  3JRO A;  3SWS D;  3FGB A;  4X63 B;  2CN2 A;  4ZOX A;  3I7O A;  5CYK B;  1B9X A;  2HJB A;  2YNN A;  1N6F A;  4OZU A;  2AGX A;  4D0K A;  1K8K C;  2Q7Q A;  5EAL A;  4QRJ A;  2UZX B;  3IIY A;  3EU7 A;  3VH0 A;  4J73 A;  4TZ4 A;  3GRE A;  1PI6 A;  4FA4 D;  1SQ9 A;  3EI3 A;  5THA A;  4J82 A;  4K3J B;  5TEF A;  3IJC A;  5AFU 3;  3CIK B;  4PSW B;  4ZOZ A;  1SQJ A;  2H9M A;  4LG9 A;  5C2W B;  4H5J A;  3JRP A;  2TRC B;  4J79 A;  3UVM A;  4HDJ A;  3CFS B;  4A11 A;  2YMU A;  4L3G D;  2P9S C;  3PXT D;  2I0T A;  5FXY A;  2YNP A;  3NVQ A;  5I5J A;  4A7J A;  4Z8L A;  4PBZ A;  2Z2P A;  3AL8 A;  3MKS B;  4UI9 R;  1N6E A;  1P22 A;  3A0F A;  4J84 A;  4CI3 A;  3EI1 A;  2I0S A;  3N0E A;  4QQE A;  3JB9 L;  4GM3 A;  2BCJ B;  3I7L A;  1XHM A;  4L1Q D;  3I7P A;  1SHY B;  3OKT A;  5FA5 B;  2HXC A;  3VGZ A;  2PM9 A;  4A09 A;  4D6V A;  3EI3 B;  3NVX A;  4XEI C;  2P9L C;  4BUJ C;  3SXT D;  4A0A A;  3L4M D;  4A11 B;  5FKS A;  3I7K A;  1R5M A;  4J86 A;  2CO0 A;  5GMK n;  3PXW D;  3RMZ D;  2G99 A;  3OKW A;  3JPX A;  3ULE C;  5FLX g;  3BG0 A;  2P9I C;  3EI4 B;  5GSA A;  5JWZ A;  2CNX A;  5A2Q g;  3EI1 B;  3DWL C;  3K27 A;  3IJ1 A;  2IUQ A;  4GGD A;  4PNK B;  3DXK C;  1PEV A;  2AGW A;  5B4W A;  5AMS A;  4IA9 A;  1S4U X;  2G9A A;  3EWE A;  2H6N A;  5I5M A;  2XU7 A;  4KFM B;  4GGC A;  4GM9 A;  4YVD A;  3JAM g;  3EMH A;  3UKR C;  1OLZ A;  3PSL A;  2PM9 B;  4A09 B;  4OWR A;  5TF2 A;  4GQ2 P;  4CZX A;  4JSX C;  2P9K C;  2CE9 A;  4JSP C;  3DM0 A;  4FA5 D;  4J81 A;  5EMM B;  1GG2 B;  3K26 A;  4GQ1 A;  3UVK A;  4O45 A;  4A0A B;  4GGA A;  2HKR A;  3L4O D;  4A0B B;  2H47 A;  1VYH C;  2AH1 A;  5C2V B;  4E5Z A;  2J55 H;  3IKO A;  3AFC A;  4QL1 A;  4ZN4 A;  2J56 H;  4U1E I;  5HE2 B;  2H9P A;  4J87 A;  3SBP A;  1ERJ A;  5EMK B;  2AQ5 A;  5H14 A;  3FM0 A;  4U7A A;  4CI1 A;  4CI2 A;  5CXC A;  2UZY B;  4FAN D;  1RI6 A;  1TYQ C;  1JOF A;  4G56 B;  3OW8 A;  3JZH A;  3W15 A;  5FKQ A;  4FAV D;  4FWW A;  4E54 B;  4J8B A;  4CY1 A;  2IUV A;  2YB8 B;  5IJ7 E;  2W18 A;  3MMY A;  4GMB A;  3J81 g;  4GQB B;  3I7H A;  3RSE C;  2HKM A;  1PGU A;  4CY2 A;  5K1C C;  3FRX A;  3V9F A;  2I3T A;  3MKQ A;  2H6K A;  3RN0 D;  3PE7 A;  1U4C A;  2AGZ A;  2Z2O A;  5H1M A;  2XYI A;  2IWF A;  1Q47 A;  5EML B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...