2J56H

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- semiquinone in complex with amicyanin.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
375
structure length
375
Chain Sequence
ETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 375
sequence length 375
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2j56H00
4A2LA 2AGLA 3ULEC 3PE7A 4A08B 5IGQA 1NEXB 2H6NA 1GOTB 5AJAA 4JSXC 3DXKC 3RFHA 1GXRA 3K27A 4GM3A 4FA1D 4JSNC 2HYEA 4ES0A 3RFGA 2OK4A 3CFVA 1B9YA 5IJ7E 5HQGA 2XYIA 2HXCA 1SHYB 2AGXA 3MXXA 2OJYA 4MK0B 2P9NC 1N6EA 4X60B 3AL9A 4O3TB 3ODTA 3FRXA 4FAVD 2G99A 2HKMA 3AH8B 2P9SC 5FKTA 5AMSA 3ORVD 4ZOYA 2H9NA 3EI4B 3IJ1A 1B9XA 1OMWB 4A0AB 3I7PA 3SMRA 4GM9A 3C75H 1XKSA 5EMMB 1N6DA 2EBSA 3EMHA 4O1QD 5JWZA 5EMLB 3MKSB 2CO0A 3PSLA 3C5MA 3J81g 4JSPC 1K8KC 4J86A 2H9PA 1OLZA 2OVRB 1GG2B 4Y7RA 1TBGA 4CY1A 2AGYA 3I7NA 3I8EA 3I7KA 3SVWD 4J82A 3OKWA 5CXBA 3UVKA 3F3FA 4A09A 3JAMg 4CZVA 1JOFA 3MMYA 2B5NA 2PM9A 4FA4D 4BUJC 3JROA 3IKOA 4E54B 1YFQA 3JB9L 4ZOZA 3B7FA 4G56B 4ESGA 2I0RA 5CXCB 3EI3B 4AEZA 3EI1B 1S4UX 3CFSB 5TF2A 3NVQA 3RLMD 5HYNB 2HESX 3OKYB 5GMKn 3FGBA 4CI3A 3N0DA 3K26A 3IJ0A 5GXIA 1PEVA 2IURA 3BWSA 2PM7B 3I7OA 3SHFA 4O9DA 3DSMA 3IIYA 4FHLA 3L4MD 2Z2OA 2B5LA 2I3SA 2IUVA 2H3XA 2XL2A 4JT6C 5HE0B 4D6VA 3UR4A 4GM8A 3VGZA 1NR0A 3V7DB 2H13A 3L4OD 3V5WB 3SBQA 4ZOVA 5TEEA 2H47A 5H17A 2CE9A 1A0RB 2OVQB 4PBZA 4GQ2P 4A11A 2CN2A 5K1CC 4BH6A 2GNQA 4K3JB 4QRJA 1QNIA 3E0CA 5FKSA 3VA6A 3I2NA 5CYKB 5KDOB 5SXMA 4PC0A 4J79A 4FB1D 5FKRA 4XEIC 4L9OA 3SBPA 5GSAA 5C2WB 4AOWA 4CI8A 1MG3A 3JRPA 3EI4A 3KRXB 4GGAA 2AGZA 2YB8B 2IUQA 4CC9A 3I7HA 1FWXA 2P9KC 3GFCA 2B4EA 3OTTA 3SBRA 5AFU3 2G9AA 4L1QD 3OL2B 4Y5RD 4YVDA 2AQ5A 4J77A 5HE2B 2H14A 1SQ9A 5I5JA 2IUPA 2QXVA 2YNOA 4J8BA 1N6FA 2AH0A 4I79A 2YNPA 4GGDA 4CI2A 4GZ8A 5IJ8E 3FM0A 5H1MA 2H9LA 4E54A 3VH0A 2H6KA 3V9FA 1P22A 1MG2A 3C99A 3GREA 4PBYA 2O9KA 4QT8A 4X61B 1RI6A 4X3EA 3A0FA 2XL3A 4J8GA 3JZNA 2YMUA 3MKQA 4XYHA 3SJLD 3AL8A 2PM6B 4OWRA 1MDAH 2P9PC 5A2Qg 4NSXA 4R7AB 5TDHB 1GP2B 3I8CA 4PSWB 3UVOA 2HJBA 2TRCB 4O45A 2HJ4A 3RN1D 3EU7A 4Z8LA 4L3GD 4QL1A 3RMZD 4IA9A 3CIKB 3J80g 1PGUA 3HFQA 5IT9g 2H6QA 2P9IC 2CE8A 1R5MA 2W18A 1JJUB 4J73A 3EI2A 4A0BB 3PVWB 4LG9A 4J87A 3UKUC 4A08A 3I89A 3RRMC 5EARA 5EAPA 5FLXg 5EAMA 4JD2C 3MZKA 4L3HD 5TEFA 2CNXA 3JZHA 2QC5A 3UVMA 4X63B 3NVNA 2I0TA 3PSCB 2OIZA 4FA5D 2J55H 5FKQA 1XIPA 5I5IA 2P9UC 2UZXB 2J56H 2AH1A 3JPXA 3ZWLB 3W15A 3BG0A 4J78A 4H5IA 2H9MA 4JT5C 3IIWA 5C2VB 4KFMB 4U1EI 4FWWA 3OL2A 4A0AA 2CO0C 1VYHC 2BCJB 3RSEC 4D0KA 5EM2B 2MTAH 2B5MA 4LGNA 5H14A 1TYQC 3I7LA 2OVPB 1PBYB 2I3TA 4E5ZB 2I0SA 2P9LC 3DXMC 1U2VC 4ERYA 3OW8A 4ZOXA 4CI1A 5HE3B 4A11B 4PXWA 3EG6A 2GC4A 3SFZA 5EMKB 4FAND 4O3UB 3JZGA 3F3GA 3RN0D 3NVXA 1K32A 3PXTD 1JMZB 4QQEA 3IJCA 4BL0A 3PXSD 5EMJB 5FXYA 3SN6B 4H5JA 2H68A 4TZ4A 2J57G 4J0XA 2IWFA 5C9ZB 1SQJA 5CXCA 3EI3A 3DWLC 2HKRA 2IWKA 3MZLA 4OZUA 3SLED 3PXWD 3EI1A 3SCYA 5K19A 1L0QA 3OKYA 3C9CA 1U4CA 4FA9D 4U7AA 2YBAA 4CY3A 3N0EA 3PVUB 3UVLA 4GQ1A 2Z2PA 5B4WA 4HDJA 4IMMA 1XHMA 4A0BA 3F3PA 4J84A 1JMXB 2XU7A 3DM0A 5CXBB 4ERQA 4EWRA 4PNKB 4K3ID 2Q7QA 4A09B 4CY5A 2UZYB 3UVNA 2PM9B 4CZXA 4CY2A 4A2MA 5IC7A 5I5MA 3KRWB 4LG8A 4J81A 3AL8B 4XYIA 4ERZA 2PBIB 4UI9R 2AGWA 4A7JA 3P4FA 2GC7A 1ERJA 5HE1B 5IGOA 5CYKA 4GMBA 2Z2NA 3SXTD 3UKRC 3BG1A 3SWSD 2OK6A 4GQBB 2IAAA 4JXMA 3U4YA 4PSXB 3AFCA 4JSVC 1PI6A 5EM2A 3EWEA 5FQDA 2BBKH 5EALA 4ZN4A 1Q47A 3OKTA 5FA5B 4E5ZA 2YNNA 5THAA 4GGCA 4J0WA 4CZYA 3EI2B 4N14A 2CN3A 5GXHA
chains in the Genus database with same CATH superfamily
4A2LA 2AGLA 3ULEC 5M61A 3PE7A 4A08B 5IGQA 1NEXB 2H6NA 1GOTB 5AJAA 3ZDYA 4JSXC 3DXKC 3RFHA 1GXRA 1H2WA 3K27A 4GM3A 4DNVA 4NAAA 4FA1D 4JSNC 2HYEA 4ES0A 3RFGA 5M5RA 2OK4A 3CFVA 1B9YA 5IJ7E 2VZ1A 5HQGA 1UOPA 2XYIA 2HXCA 1SHYB 4AMZA 2AGXA 3MXXA 2OJYA 4MK0B 2P9NC 1N6EA 3FCSA 1VZ3A 1QFSA 4X60B 3AL9A 5C92A 4O3TB 3ODTA 3FRXA 4FAVD 2G99A 2HKMA 3AH8B 3IJEA 2P9SC 5FFGA 5FKTA 5AMSA 4AN1A 1K3IA 3ORVD 1T2XA 1GOHA 2H9NA 3EI4B 1B9XA 1OMWB 3IJ1A 3I7PA 3ZDXA 4ZOYA 4A0AB 3SMRA 4GM9A 3C75H 1XKSA 5EMMB 1N6DA 2EBSA 3EMHA 4O1QD 5JWZA 1UOOA 1H2YA 5EMLB 2QR5A 3MKSB 2CO0A 2EIEA 3PSLA 3C5MA 2VDMA 2BKLA 1GOFA 3J81g 4JSPC 4AN0A 1K8KC 3IUJA 4J86A 2H9PA 1OLZA 3K6SA 2OVRB 1GG2B 4Y7RA 1TBGA 4CY1A 2AGYA 3EQ7A 3I7NA 3I8EA 4D9SA 3I7KA 3SVWD 4J82A 3O4HA 3OKWA 4JHNA 4WK0A 5CXBA 3UVKA 3F3FA 3FCUA 4A09A 3JAMg 3GD1I 2XZGA 4CZVA 1JOFA 3MMYA 2B5NA 2PM9A 4FA4D 4BUJC 4Z7OA 3JROA 3IKOA 3NIDA 4E54B 1YFQA 3JB9L 4ZOZA 3B7FA 4G56B 4ESGA 2I0RA 5CXCB 3EI3B 5E6UA 4AEZA 3EI1B 1S4UX 1JTDB 3CFSB 4UM8A 3NVQA 5TF2A 3RLMD 5HYNB 2HESX 3OKYB 5GMKn 3FGBA 4NC4A 2XE4A 4CI3A 3N0DA 3K26A 3IJ0A 5GXIA 1PEVA 2IURA 3BWSA 2PM7B 3OF7A 3I7OA 3SHFA 4O9DA 3DSMA 3IIYA 4FHLA 3L4MD 2Z2OA 1QFMA 4Z7QA 2B5LA 2I3SA 2IUVA 2H3XA 2XL2A 4JT6C 5HE0B 4D6VA 3KCIA 3UR4A 4GM8A 3VGZA 1NR0A 3V7DB 2H13A 3L4OD 2JKXA 3V5WB 3SBQA 4ZOVA 5TEEA 5M5VA 2H47A 5H17A 2EIBA 2CE9A 3ZDZA 1A0RB 2OVQB 2VC2A 4PBZA 4GQ2P 4A11A 1YR2A 2CN2A 5K1CC 4MMZA 3ZE1A 4BH6A 2GNQA 3NIGA 4K3JB 4QRJA 3VI4A 1QNIA 3E0CA 5FKSA 3VA6A 2VDNA 3I2NA 5CYKB 5KDOB 5SXMA 4PC0A 4J79A 4FB1D 5FKRA 4XEIC 4L9OA 3SBPA 5GSAA 5C2WB 4AOWA 4CI8A 1MG3A 3JRPA 3EI4A 3KRXB 4GGAA 1JV2A 2AGZA 4G1MA 2YB8B 2IUQA 4CC9A 3I7HA 1FWXA 2P9KC 3ZE2A 3GFCA 3MUOA 2B4EA 3K71A 3OTTA 2VZ3A 3SBRA 5AFU3 1UOQA 2G9AA 4L1QD 3NIFA 3OL2B 4Y5RD 4YVDA 2AQ5A 4J77A 5HE2B 1C9IA 1O6GA 1O6FA 2H14A 1SQ9A 1VE6A 5I5JA 2IUPA 1L5GA 4WK2A 2QXVA 2YNOA 4QAMA 4J8BA 1N6FA 4G1EA 2AH0A 4I79A 2VDLA 2YNPA 4GGDA 4CI2A 5M5SA 4GZ8A 5IJ8E 3FM0A 5H1MA 2H9LA 4E54A 3VH0A 2H6KA 4O02A 3V9FA 3O4JA 1P22A 1E8MA 1MG2A 3C99A 3VI3A 3GREA 4PBYA 4NBMA 2O9KA 4QT8A 4X61B 4AX4A 1RI6A 4X3EA 3A0FA 2XL3A 1E8NA 4J8GA 3O4IA 3V4VA 4DNWA 3JZNA 2YMUA 3MKQA 4XYHA 3SJLD 4UM9A 3AL8A 2PM6B 4OWRA 1MDAH 2P9PC 5A2Qg 4NSXA 5HDBA 4R7AB 3V4PA 5TDHB 1GP2B 3I8CA 2VDPA 4PSWB 3UVOA 2HJBA 2TRCB 4O45A 5E6RA 2HJ4A 3RN1D 3EU7A 3ZE0A 4Z8LA 4L3GD 4QL1A 3RMZD 4IA9A 3CIKB 3J80g 1PGUA 3HFQA 3IUQA 5IT9g 2H6QA 2P9IC 3QI0A 1VE7A 2CE8A 1GOGA 1R5MA 3IUMA 2W18A 1JJUB 4J73A 3EI2A 4A0BB 3PVWB 4LG9A 4J87A 3UKUC 5M5TA 3T3PA 4RE6A 4A08A 3I89A 3RRMC 4RE5A 5EARA 3IVMA 5EAPA 5FLXg 5EAMA 4G55A 4JD2C 1A12A 3MZKA 4L3HD 5TEFA 2CNXA 3MVDK 3JZHA 2QC5A 1TYEA 3UVMA 4X63B 3NVNA 2I0TA 3PSCB 4NENA 2OIZA 2QZPA 4BCBA 4FA5D 2J55H 5FKQA 1XIPA 5I5IA 2P9UC 2UZXB 2VDRA 2J56H 2AH1A 2EICA 3JPXA 3ZWLB 3W15A 3BG0A 3DDUA 4J78A 4H5IA 2H9MA 4JT5C 3IIWA 5C2VB 4KFMB 1I2MB 1E5TA 1H2ZA 4U1EI 4FWWA 3OL2A 4A0AA 2CO0C 1VYHC 2BCJB 3RSEC 4D0KA 5EM2B 2MTAH 2B5MA 4LGNA 5H14A 1TYQC 3I7LA 2OVPB 1PBYB 2I3TA 4E5ZB 2I0SA 2P9LC 3DXMC 1U2VC 4ERYA 3OW8A 4ZOXA 4CI1A 4MMXA 5HE3B 2EIDA 4WJKA 4A11B 4PXWA 3EG6A 2GC4A 4DNUA 3SFZA 2VDOA 5EMKB 4FAND 4O3UB 5E6SA 4IRZA 3JZGA 3F3GA 3RN0D 2HU8A 3NVXA 1K32A 3PXTD 1JMZB 3O4GA 4QQEA 3MUNA 3IURA 3IJCA 4BL0A 3PXSD 5EMJB 5FXYA 4MMYA 3GC3B 3SN6B 4H5JA 2H68A 4TZ4A 1VZ2A 2J57G 4J0XA 4L1MA 4O2WA 2IWFA 5C9ZB 1SQJA 5CXCA 3EI3A 3DWLC 2HKRA 2IWKA 2VDQA 3MZLA 4OZUA 3SLED 3PXWD 3EI1A 3SCYA 2HU5A 5K19A 2XDWA 1L0QA 3OKYA 3C9CA 1U4CA 4FA9D 4U7AA 2YBAA 4CY3A 3N0EA 3PVUB 3UVLA 4GQ1A 2Z2PA 3IULA 5B4WA 4HDJA 4BP8A 4IMMA 3EQ8A 3T3MA 1XHMA 1C9LA 4A0BA 3F3PA 4J84A 1JMXB 1UTCA 2XU7A 3DM0A 5CXBB 4BCDA 4ERQA 4EWRA 4PNKB 4K3ID 2Q7QA 4A09B 3IUNA 2UZYB 4CY5A 3UVNA 2PM9B 5C86A 4CZXA 4CY2A 4JHPC 4A2MA 5IC7A 5FFOA 5I5MA 3KRWB 4LG8A 3K72A 4J81A 4WK4A 3AL8B 2HU7A 4XYIA 4ERZA 2PBIB 4UI9R 1M1XA 2AGWA 4A7JA 2WQ8A 3EQ9A 1U8CA 3P4FA 2GC7A 4BCCA 1ERJA 5HE1B 5IGOA 5CYKA 4GMBA 2Z2NA 3SXTD 3UKRC 3BG1A 3SWSD 2VDKA 2OK6A 4GQBB 2IAAA 5M5UA 1BPOA 4JXMA 3U4YA 4PSXB 3AFCA 4JSVC 1PI6A 5EM2A 3EWEA 5FQDA 2BBKH 5EALA 4ZN4A 1Q47A 3OKTA 3QHYB 5FA5B 4BP9A 4E5ZA 2YNNA 5THAA 4GGCA 4J0WA 4CZYA 3EI2B 4N14A 1H2XA 4AMYA 4Z7NA 2CN3A 5GXHA
chains in the Genus database with same CATH topology
4A2LA 2AGLA 3ULEC 3PE7A 4A08B 5IGQA 1NEXB 2H6NA 1GOTB 5AJAA 4JSXC 3DXKC 3RFHA 1GXRA 3K27A 4GM3A 4FA1D 4JSNC 2HYEA 4ES0A 3RFGA 2OK4A 3CFVA 1B9YA 5IJ7E 5HQGA 2XYIA 2HXCA 1SHYB 2AGXA 3MXXA 2OJYA 4MK0B 2P9NC 1N6EA 4X60B 3AL9A 4O3TB 3ODTA 3FRXA 4FAVD 2G99A 2HKMA 3AH8B 2P9SC 5FKTA 5AMSA 3ORVD 4ZOYA 2H9NA 3EI4B 3IJ1A 1B9XA 1OMWB 4A0AB 3I7PA 3SMRA 4GM9A 3C75H 1XKSA 5EMMB 1N6DA 2EBSA 3EMHA 4O1QD 5JWZA 5EMLB 3MKSB 2CO0A 3PSLA 3C5MA 3J81g 4JSPC 1K8KC 4J86A 2H9PA 1OLZA 2OVRB 1GG2B 4Y7RA 1TBGA 4CY1A 2AGYA 3I7NA 3I8EA 3I7KA 3SVWD 4J82A 3OKWA 5CXBA 3UVKA 3F3FA 4A09A 3JAMg 4CZVA 1JOFA 3MMYA 2B5NA 2PM9A 4FA4D 4BUJC 3JROA 3IKOA 4E54B 1YFQA 3JB9L 4ZOZA 3B7FA 4G56B 4ESGA 2I0RA 5CXCB 3EI3B 4AEZA 3EI1B 1S4UX 3CFSB 5TF2A 3NVQA 3RLMD 5HYNB 2HESX 3OKYB 5GMKn 3FGBA 4CI3A 3N0DA 3K26A 3IJ0A 5GXIA 1PEVA 2IURA 3BWSA 2PM7B 3I7OA 3SHFA 4O9DA 3DSMA 3IIYA 4FHLA 3L4MD 2Z2OA 2B5LA 2I3SA 2IUVA 2H3XA 2XL2A 4JT6C 5HE0B 4D6VA 3UR4A 4GM8A 3VGZA 1NR0A 3V7DB 2H13A 3L4OD 3V5WB 3SBQA 4ZOVA 5TEEA 2H47A 5H17A 2CE9A 1A0RB 2OVQB 4PBZA 4GQ2P 4A11A 2CN2A 5K1CC 4BH6A 2GNQA 4K3JB 4QRJA 1QNIA 3E0CA 5FKSA 3VA6A 3I2NA 5CYKB 5KDOB 5SXMA 4PC0A 4J79A 4FB1D 5FKRA 4XEIC 4L9OA 3SBPA 5GSAA 5C2WB 4AOWA 4CI8A 1MG3A 3JRPA 3EI4A 3KRXB 4GGAA 2AGZA 2YB8B 2IUQA 4CC9A 3I7HA 1FWXA 2P9KC 3GFCA 2B4EA 3OTTA 3SBRA 5AFU3 2G9AA 4L1QD 3OL2B 4Y5RD 4YVDA 2AQ5A 4J77A 5HE2B 2H14A 1SQ9A 5I5JA 2IUPA 2QXVA 2YNOA 4J8BA 1N6FA 2AH0A 4I79A 2YNPA 4GGDA 4CI2A 4GZ8A 5IJ8E 3FM0A 5H1MA 2H9LA 4E54A 3VH0A 2H6KA 3V9FA 1P22A 1MG2A 3C99A 3GREA 4PBYA 2O9KA 4QT8A 4X61B 1RI6A 4X3EA 3A0FA 2XL3A 4J8GA 3JZNA 2YMUA 3MKQA 4XYHA 3SJLD 3AL8A 2PM6B 4OWRA 1MDAH 2P9PC 5A2Qg 4NSXA 4R7AB 5TDHB 1GP2B 3I8CA 4PSWB 3UVOA 2HJBA 2TRCB 4O45A 2HJ4A 3RN1D 3EU7A 4Z8LA 4L3GD 4QL1A 3RMZD 4IA9A 3CIKB 3J80g 1PGUA 3HFQA 5IT9g 2H6QA 2P9IC 2CE8A 1R5MA 2W18A 1JJUB 4J73A 3EI2A 4A0BB 3PVWB 4LG9A 4J87A 3UKUC 4A08A 3I89A 3RRMC 5EARA 5EAPA 5FLXg 5EAMA 4JD2C 3MZKA 4L3HD 5TEFA 2CNXA 3JZHA 2QC5A 3UVMA 4X63B 3NVNA 2I0TA 3PSCB 2OIZA 4FA5D 2J55H 5FKQA 1XIPA 5I5IA 2P9UC 2UZXB 2J56H 2AH1A 3JPXA 3ZWLB 3W15A 3BG0A 4J78A 4H5IA 2H9MA 4JT5C 3IIWA 5C2VB 4KFMB 4U1EI 4FWWA 3OL2A 4A0AA 2CO0C 1VYHC 2BCJB 3RSEC 4D0KA 5EM2B 2MTAH 2B5MA 4LGNA 5H14A 1TYQC 3I7LA 2OVPB 1PBYB 2I3TA 4E5ZB 2I0SA 2P9LC 3DXMC 1U2VC 4ERYA 3OW8A 4ZOXA 4CI1A 5HE3B 4A11B 4PXWA 3EG6A 2GC4A 3SFZA 5EMKB 4FAND 4O3UB 3JZGA 3F3GA 3RN0D 3NVXA 1K32A 3PXTD 1JMZB 4QQEA 3IJCA 4BL0A 3PXSD 5EMJB 5FXYA 3SN6B 4H5JA 2H68A 4TZ4A 2J57G 4J0XA 2IWFA 5C9ZB 1SQJA 5CXCA 3EI3A 3DWLC 2HKRA 2IWKA 3MZLA 4OZUA 3SLED 3PXWD 3EI1A 3SCYA 5K19A 1L0QA 3OKYA 3C9CA 1U4CA 4FA9D 4U7AA 2YBAA 4CY3A 3N0EA 3PVUB 3UVLA 4GQ1A 2Z2PA 5B4WA 4HDJA 4IMMA 1XHMA 4A0BA 3F3PA 4J84A 1JMXB 2XU7A 3DM0A 5CXBB 4ERQA 4EWRA 4PNKB 4K3ID 2Q7QA 4A09B 4CY5A 2UZYB 3UVNA 2PM9B 4CZXA 4CY2A 4A2MA 5IC7A 5I5MA 3KRWB 4LG8A 4J81A 3AL8B 4XYIA 4ERZA 2PBIB 4UI9R 2AGWA 4A7JA 3P4FA 2GC7A 1ERJA 5HE1B 5IGOA 5CYKA 4GMBA 2Z2NA 3SXTD 3UKRC 3BG1A 3SWSD 2OK6A 4GQBB 2IAAA 4JXMA 3U4YA 4PSXB 3AFCA 4JSVC 1PI6A 5EM2A 3EWEA 5FQDA 2BBKH 5EALA 4ZN4A 1Q47A 3OKTA 5FA5B 4E5ZA 2YNNA 5THAA 4GGCA 4J0WA 4CZYA 3EI2B 4N14A 2CN3A 5GXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2L A;  2AGL A;  3ULE C;  3PE7 A;  4A08 B;  5IGQ A;  1NEX B;  2H6N A;  1GOT B;  5AJA A;  4JSX C;  3DXK C;  3RFH A;  1GXR A;  3K27 A;  4GM3 A;  4FA1 D;  4JSN C;  2HYE A;  4ES0 A;  3RFG A;  2OK4 A;  3CFV A;  1B9Y A;  5IJ7 E;  5HQG A;  2XYI A;  2HXC A;  1SHY B;  2AGX A;  3MXX A;  2OJY A;  4MK0 B;  2P9N C;  1N6E A;  4X60 B;  3AL9 A;  4O3T B;  3ODT A;  3FRX A;  4FAV D;  2G99 A;  2HKM A;  3AH8 B;  2P9S C;  5FKT A;  5AMS A;  3ORV D;  4ZOY A;  2H9N A;  3EI4 B;  3IJ1 A;  1B9X A;  1OMW B;  4A0A B;  3I7P A;  3SMR A;  4GM9 A;  3C75 H;  1XKS A;  5EMM B;  1N6D A;  2EBS A;  3EMH A;  4O1Q D;  5JWZ A;  5EML B;  3MKS B;  2CO0 A;  3PSL A;  3C5M A;  3J81 g;  4JSP C;  1K8K C;  4J86 A;  2H9P A;  1OLZ A;  2OVR B;  1GG2 B;  4Y7R A;  1TBG A;  4CY1 A;  2AGY A;  3I7N A;  3I8E A;  3I7K A;  3SVW D;  4J82 A;  3OKW A;  5CXB A;  3UVK A;  3F3F A;  4A09 A;  3JAM g;  4CZV A;  1JOF A;  3MMY A;  2B5N A;  2PM9 A;  4FA4 D;  4BUJ C;  3JRO A;  3IKO A;  4E54 B;  1YFQ A;  3JB9 L;  4ZOZ A;  3B7F A;  4G56 B;  4ESG A;  2I0R A;  5CXC B;  3EI3 B;  4AEZ A;  3EI1 B;  1S4U X;  3CFS B;  5TF2 A;  3NVQ A;  3RLM D;  5HYN B;  2HES X;  3OKY B;  5GMK n;  3FGB A;  4CI3 A;  3N0D A;  3K26 A;  3IJ0 A;  5GXI A;  1PEV A;  2IUR A;  3BWS A;  2PM7 B;  3I7O A;  3SHF A;  4O9D A;  3DSM A;  3IIY A;  4FHL A;  3L4M D;  2Z2O A;  2B5L A;  2I3S A;  2IUV A;  2H3X A;  2XL2 A;  4JT6 C;  5HE0 B;  4D6V A;  3UR4 A;  4GM8 A;  3VGZ A;  1NR0 A;  3V7D B;  2H13 A;  3L4O D;  3V5W B;  3SBQ A;  4ZOV A;  5TEE A;  2H47 A;  5H17 A;  2CE9 A;  1A0R B;  2OVQ B;  4PBZ A;  4GQ2 P;  4A11 A;  2CN2 A;  5K1C C;  4BH6 A;  2GNQ A;  4K3J B;  4QRJ A;  1QNI A;  3E0C A;  5FKS A;  3VA6 A;  3I2N A;  5CYK B;  5KDO B;  5SXM A;  4PC0 A;  4J79 A;  4FB1 D;  5FKR A;  4XEI C;  4L9O A;  3SBP A;  5GSA A;  5C2W B;  4AOW A;  4CI8 A;  1MG3 A;  3JRP A;  3EI4 A;  3KRX B;  4GGA A;  2AGZ A;  2YB8 B;  2IUQ A;  4CC9 A;  3I7H A;  1FWX A;  2P9K C;  3GFC A;  2B4E A;  3OTT A;  3SBR A;  5AFU 3;  2G9A A;  4L1Q D;  3OL2 B;  4Y5R D;  4YVD A;  2AQ5 A;  4J77 A;  5HE2 B;  2H14 A;  1SQ9 A;  5I5J A;  2IUP A;  2QXV A;  2YNO A;  4J8B A;  1N6F A;  2AH0 A;  4I79 A;  2YNP A;  4GGD A;  4CI2 A;  4GZ8 A;  5IJ8 E;  3FM0 A;  5H1M A;  2H9L A;  4E54 A;  3VH0 A;  2H6K A;  3V9F A;  1P22 A;  1MG2 A;  3C99 A;  3GRE A;  4PBY A;  2O9K A;  4QT8 A;  4X61 B;  1RI6 A;  4X3E A;  3A0F A;  2XL3 A;  4J8G A;  3JZN A;  2YMU A;  3MKQ A;  4XYH A;  3SJL D;  3AL8 A;  2PM6 B;  4OWR A;  1MDA H;  2P9P C;  5A2Q g;  4NSX A;  4R7A B;  5TDH B;  1GP2 B;  3I8C A;  4PSW B;  3UVO A;  2HJB A;  2TRC B;  4O45 A;  2HJ4 A;  3RN1 D;  3EU7 A;  4Z8L A;  4L3G D;  4QL1 A;  3RMZ D;  4IA9 A;  3CIK B;  3J80 g;  1PGU A;  3HFQ A;  5IT9 g;  2H6Q A;  2P9I C;  2CE8 A;  1R5M A;  2W18 A;  1JJU B;  4J73 A;  3EI2 A;  4A0B B;  3PVW B;  4LG9 A;  4J87 A;  3UKU C;  4A08 A;  3I89 A;  3RRM C;  5EAR A;  5EAP A;  5FLX g;  5EAM A;  4JD2 C;  3MZK A;  4L3H D;  5TEF A;  2CNX A;  3JZH A;  2QC5 A;  3UVM A;  4X63 B;  3NVN A;  2I0T A;  3PSC B;  2OIZ A;  4FA5 D;  2J55 H;  5FKQ A;  1XIP A;  5I5I A;  2P9U C;  2UZX B;  2J56 H;  2AH1 A;  3JPX A;  3ZWL B;  3W15 A;  3BG0 A;  4J78 A;  4H5I A;  2H9M A;  4JT5 C;  3IIW A;  5C2V B;  4KFM B;  4U1E I;  4FWW A;  3OL2 A;  4A0A A;  2CO0 C;  1VYH C;  2BCJ B;  3RSE C;  4D0K A;  5EM2 B;  2MTA H;  2B5M A;  4LGN A;  5H14 A;  1TYQ C;  3I7L A;  2OVP B;  1PBY B;  2I3T A;  4E5Z B;  2I0S A;  2P9L C;  3DXM C;  1U2V C;  4ERY A;  3OW8 A;  4ZOX A;  4CI1 A;  5HE3 B;  4A11 B;  4PXW A;  3EG6 A;  2GC4 A;  3SFZ A;  5EMK B;  4FAN D;  4O3U B;  3JZG A;  3F3G A;  3RN0 D;  3NVX A;  1K32 A;  3PXT D;  1JMZ B;  4QQE A;  3IJC A;  4BL0 A;  3PXS D;  5EMJ B;  5FXY A;  3SN6 B;  4H5J A;  2H68 A;  4TZ4 A;  2J57 G;  4J0X A;  2IWF A;  5C9Z B;  1SQJ A;  5CXC A;  3EI3 A;  3DWL C;  2HKR A;  2IWK A;  3MZL A;  4OZU A;  3SLE D;  3PXW D;  3EI1 A;  3SCY A;  5K19 A;  1L0Q A;  3OKY A;  3C9C A;  1U4C A;  4FA9 D;  4U7A A;  2YBA A;  4CY3 A;  3N0E A;  3PVU B;  3UVL A;  4GQ1 A;  2Z2P A;  5B4W A;  4HDJ A;  4IMM A;  1XHM A;  4A0B A;  3F3P A;  4J84 A;  1JMX B;  2XU7 A;  3DM0 A;  5CXB B;  4ERQ A;  4EWR A;  4PNK B;  4K3I D;  2Q7Q A;  4A09 B;  4CY5 A;  2UZY B;  3UVN A;  2PM9 B;  4CZX A;  4CY2 A;  4A2M A;  5IC7 A;  5I5M A;  3KRW B;  4LG8 A;  4J81 A;  3AL8 B;  4XYI A;  4ERZ A;  2PBI B;  4UI9 R;  2AGW A;  4A7J A;  3P4F A;  2GC7 A;  1ERJ A;  5HE1 B;  5IGO A;  5CYK A;  4GMB A;  2Z2N A;  3SXT D;  3UKR C;  3BG1 A;  3SWS D;  2OK6 A;  4GQB B;  2IAA A;  4JXM A;  3U4Y A;  4PSX B;  3AFC A;  4JSV C;  1PI6 A;  5EM2 A;  3EWE A;  5FQD A;  2BBK H;  5EAL A;  4ZN4 A;  1Q47 A;  3OKT A;  5FA5 B;  4E5Z A;  2YNN A;  5THA A;  4GGC A;  4J0W A;  4CZY A;  3EI2 B;  4N14 A;  2CN3 A;  5GXH A; 
#chains in the Genus database with same CATH topology
 4A2L A;  2AGL A;  3ULE C;  5M61 A;  3PE7 A;  4A08 B;  5IGQ A;  1NEX B;  2H6N A;  1GOT B;  5AJA A;  3ZDY A;  4JSX C;  3DXK C;  3RFH A;  1GXR A;  1H2W A;  3K27 A;  4GM3 A;  4DNV A;  4NAA A;  4FA1 D;  4JSN C;  2HYE A;  4ES0 A;  3RFG A;  5M5R A;  2OK4 A;  3CFV A;  1B9Y A;  5IJ7 E;  2VZ1 A;  5HQG A;  1UOP A;  2XYI A;  2HXC A;  1SHY B;  4AMZ A;  2AGX A;  3MXX A;  2OJY A;  4MK0 B;  2P9N C;  1N6E A;  3FCS A;  1VZ3 A;  1QFS A;  4X60 B;  3AL9 A;  5C92 A;  4O3T B;  3ODT A;  3FRX A;  4FAV D;  2G99 A;  2HKM A;  3AH8 B;  3IJE A;  2P9S C;  5FFG A;  5FKT A;  5AMS A;  4AN1 A;  1K3I A;  3ORV D;  1T2X A;  1GOH A;  2H9N A;  3EI4 B;  1B9X A;  1OMW B;  3IJ1 A;  3I7P A;  3ZDX A;  4ZOY A;  4A0A B;  3SMR A;  4GM9 A;  3C75 H;  1XKS A;  5EMM B;  1N6D A;  2EBS A;  3EMH A;  4O1Q D;  5JWZ A;  1UOO A;  1H2Y A;  5EML B;  2QR5 A;  3MKS B;  2CO0 A;  2EIE A;  3PSL A;  3C5M A;  2VDM A;  2BKL A;  1GOF A;  3J81 g;  4JSP C;  4AN0 A;  1K8K C;  3IUJ A;  4J86 A;  2H9P A;  1OLZ A;  3K6S A;  2OVR B;  1GG2 B;  4Y7R A;  1TBG A;  4CY1 A;  2AGY A;  3EQ7 A;  3I7N A;  3I8E A;  4D9S A;  3I7K A;  3SVW D;  4J82 A;  3O4H A;  3OKW A;  4JHN A;  4WK0 A;  5CXB A;  3UVK A;  3F3F A;  3FCU A;  4A09 A;  3JAM g;  3GD1 I;  2XZG A;  4CZV A;  1JOF A;  3MMY A;  2B5N A;  2PM9 A;  4FA4 D;  4BUJ C;  4Z7O A;  3JRO A;  3IKO A;  3NID A;  4E54 B;  1YFQ A;  3JB9 L;  4ZOZ A;  3B7F A;  4G56 B;  4ESG A;  2I0R A;  5CXC B;  3EI3 B;  5E6U A;  4AEZ A;  3EI1 B;  1S4U X;  1JTD B;  3CFS B;  4UM8 A;  3NVQ A;  5TF2 A;  3RLM D;  5HYN B;  2HES X;  3OKY B;  5GMK n;  3FGB A;  4NC4 A;  2XE4 A;  4CI3 A;  3N0D A;  3K26 A;  3IJ0 A;  5GXI A;  1PEV A;  2IUR A;  3BWS A;  2PM7 B;  3OF7 A;  3I7O A;  3SHF A;  4O9D A;  3DSM A;  3IIY A;  4FHL A;  3L4M D;  2Z2O A;  1QFM A;  4Z7Q A;  2B5L A;  2I3S A;  2IUV A;  2H3X A;  2XL2 A;  4JT6 C;  5HE0 B;  4D6V A;  3KCI A;  3UR4 A;  4GM8 A;  3VGZ A;  1NR0 A;  3V7D B;  2H13 A;  3L4O D;  2JKX A;  3V5W B;  3SBQ A;  4ZOV A;  5TEE A;  5M5V A;  2H47 A;  5H17 A;  2EIB A;  2CE9 A;  3ZDZ A;  1A0R B;  2OVQ B;  2VC2 A;  4PBZ A;  4GQ2 P;  4A11 A;  1YR2 A;  2CN2 A;  5K1C C;  4MMZ A;  3ZE1 A;  4BH6 A;  2GNQ A;  3NIG A;  4K3J B;  4QRJ A;  3VI4 A;  1QNI A;  3E0C A;  5FKS A;  3VA6 A;  2VDN A;  3I2N A;  5CYK B;  5KDO B;  5SXM A;  4PC0 A;  4J79 A;  4FB1 D;  5FKR A;  4XEI C;  4L9O A;  3SBP A;  5GSA A;  5C2W B;  4AOW A;  4CI8 A;  1MG3 A;  3JRP A;  3EI4 A;  3KRX B;  4GGA A;  1JV2 A;  2AGZ A;  4G1M A;  2YB8 B;  2IUQ A;  4CC9 A;  3I7H A;  1FWX A;  2P9K C;  3ZE2 A;  3GFC A;  3MUO A;  2B4E A;  3K71 A;  3OTT A;  2VZ3 A;  3SBR A;  5AFU 3;  1UOQ A;  2G9A A;  4L1Q D;  3NIF A;  3OL2 B;  4Y5R D;  4YVD A;  2AQ5 A;  4J77 A;  5HE2 B;  1C9I A;  1O6G A;  1O6F A;  2H14 A;  1SQ9 A;  1VE6 A;  5I5J A;  2IUP A;  1L5G A;  4WK2 A;  2QXV A;  2YNO A;  4QAM A;  4J8B A;  1N6F A;  4G1E A;  2AH0 A;  4I79 A;  2VDL A;  2YNP A;  4GGD A;  4CI2 A;  5M5S A;  4GZ8 A;  5IJ8 E;  3FM0 A;  5H1M A;  2H9L A;  4E54 A;  3VH0 A;  2H6K A;  4O02 A;  3V9F A;  3O4J A;  1P22 A;  1E8M A;  1MG2 A;  3C99 A;  3VI3 A;  3GRE A;  4PBY A;  4NBM A;  2O9K A;  4QT8 A;  4X61 B;  4AX4 A;  1RI6 A;  4X3E A;  3A0F A;  2XL3 A;  1E8N A;  4J8G A;  3O4I A;  3V4V A;  4DNW A;  3JZN A;  2YMU A;  3MKQ A;  4XYH A;  3SJL D;  4UM9 A;  3AL8 A;  2PM6 B;  4OWR A;  1MDA H;  2P9P C;  5A2Q g;  4NSX A;  5HDB A;  4R7A B;  3V4P A;  5TDH B;  1GP2 B;  3I8C A;  2VDP A;  4PSW B;  3UVO A;  2HJB A;  2TRC B;  4O45 A;  5E6R A;  2HJ4 A;  3RN1 D;  3EU7 A;  3ZE0 A;  4Z8L A;  4L3G D;  4QL1 A;  3RMZ D;  4IA9 A;  3CIK B;  3J80 g;  1PGU A;  3HFQ A;  3IUQ A;  5IT9 g;  2H6Q A;  2P9I C;  3QI0 A;  1VE7 A;  2CE8 A;  1GOG A;  1R5M A;  3IUM A;  2W18 A;  1JJU B;  4J73 A;  3EI2 A;  4A0B B;  3PVW B;  4LG9 A;  4J87 A;  3UKU C;  5M5T A;  3T3P A;  4RE6 A;  4A08 A;  3I89 A;  3RRM C;  4RE5 A;  5EAR A;  3IVM A;  5EAP A;  5FLX g;  5EAM A;  4G55 A;  4JD2 C;  1A12 A;  3MZK A;  4L3H D;  5TEF A;  2CNX A;  3MVD K;  3JZH A;  2QC5 A;  1TYE A;  3UVM A;  4X63 B;  3NVN A;  2I0T A;  3PSC B;  4NEN A;  2OIZ A;  2QZP A;  4BCB A;  4FA5 D;  2J55 H;  5FKQ A;  1XIP A;  5I5I A;  2P9U C;  2UZX B;  2VDR A;  2J56 H;  2AH1 A;  2EIC A;  3JPX A;  3ZWL B;  3W15 A;  3BG0 A;  3DDU A;  4J78 A;  4H5I A;  2H9M A;  4JT5 C;  3IIW A;  5C2V B;  4KFM B;  1I2M B;  1E5T A;  1H2Z A;  4U1E I;  4FWW A;  3OL2 A;  4A0A A;  2CO0 C;  1VYH C;  2BCJ B;  3RSE C;  4D0K A;  5EM2 B;  2MTA H;  2B5M A;  4LGN A;  5H14 A;  1TYQ C;  3I7L A;  2OVP B;  1PBY B;  2I3T A;  4E5Z B;  2I0S A;  2P9L C;  3DXM C;  1U2V C;  4ERY A;  3OW8 A;  4ZOX A;  4CI1 A;  4MMX A;  5HE3 B;  2EID A;  4WJK A;  4A11 B;  4PXW A;  3EG6 A;  2GC4 A;  4DNU A;  3SFZ A;  2VDO A;  5EMK B;  4FAN D;  4O3U B;  5E6S A;  4IRZ A;  3JZG A;  3F3G A;  3RN0 D;  2HU8 A;  3NVX A;  1K32 A;  3PXT D;  1JMZ B;  3O4G A;  4QQE A;  3MUN A;  3IUR A;  3IJC A;  4BL0 A;  3PXS D;  5EMJ B;  5FXY A;  4MMY A;  3GC3 B;  3SN6 B;  4H5J A;  2H68 A;  4TZ4 A;  1VZ2 A;  2J57 G;  4J0X A;  4L1M A;  4O2W A;  2IWF A;  5C9Z B;  1SQJ A;  5CXC A;  3EI3 A;  3DWL C;  2HKR A;  2IWK A;  2VDQ A;  3MZL A;  4OZU A;  3SLE D;  3PXW D;  3EI1 A;  3SCY A;  2HU5 A;  5K19 A;  2XDW A;  1L0Q A;  3OKY A;  3C9C A;  1U4C A;  4FA9 D;  4U7A A;  2YBA A;  4CY3 A;  3N0E A;  3PVU B;  3UVL A;  4GQ1 A;  2Z2P A;  3IUL A;  5B4W A;  4HDJ A;  4BP8 A;  4IMM A;  3EQ8 A;  3T3M A;  1XHM A;  1C9L A;  4A0B A;  3F3P A;  4J84 A;  1JMX B;  1UTC A;  2XU7 A;  3DM0 A;  5CXB B;  4BCD A;  4ERQ A;  4EWR A;  4PNK B;  4K3I D;  2Q7Q A;  4A09 B;  3IUN A;  2UZY B;  4CY5 A;  3UVN A;  2PM9 B;  5C86 A;  4CZX A;  4CY2 A;  4JHP C;  4A2M A;  5IC7 A;  5FFO A;  5I5M A;  3KRW B;  4LG8 A;  3K72 A;  4J81 A;  4WK4 A;  3AL8 B;  2HU7 A;  4XYI A;  4ERZ A;  2PBI B;  4UI9 R;  1M1X A;  2AGW A;  4A7J A;  2WQ8 A;  3EQ9 A;  1U8C A;  3P4F A;  2GC7 A;  4BCC A;  1ERJ A;  5HE1 B;  5IGO A;  5CYK A;  4GMB A;  2Z2N A;  3SXT D;  3UKR C;  3BG1 A;  3SWS D;  2VDK A;  2OK6 A;  4GQB B;  2IAA A;  5M5U A;  1BPO A;  4JXM A;  3U4Y A;  4PSX B;  3AFC A;  4JSV C;  1PI6 A;  5EM2 A;  3EWE A;  5FQD A;  2BBK H;  5EAL A;  4ZN4 A;  1Q47 A;  3OKT A;  3QHY B;  5FA5 B;  4BP9 A;  4E5Z A;  2YNN A;  5THA A;  4GGC A;  4J0W A;  4CZY A;  3EI2 B;  4N14 A;  1H2X A;  4AMY A;  4Z7N A;  2CN3 A;  5GXH A; 
#chains in the Genus database with same CATH homology
 4A2L A;  2AGL A;  3ULE C;  3PE7 A;  4A08 B;  5IGQ A;  1NEX B;  2H6N A;  1GOT B;  5AJA A;  4JSX C;  3DXK C;  3RFH A;  1GXR A;  3K27 A;  4GM3 A;  4FA1 D;  4JSN C;  2HYE A;  4ES0 A;  3RFG A;  2OK4 A;  3CFV A;  1B9Y A;  5IJ7 E;  5HQG A;  2XYI A;  2HXC A;  1SHY B;  2AGX A;  3MXX A;  2OJY A;  4MK0 B;  2P9N C;  1N6E A;  4X60 B;  3AL9 A;  4O3T B;  3ODT A;  3FRX A;  4FAV D;  2G99 A;  2HKM A;  3AH8 B;  2P9S C;  5FKT A;  5AMS A;  3ORV D;  4ZOY A;  2H9N A;  3EI4 B;  3IJ1 A;  1B9X A;  1OMW B;  4A0A B;  3I7P A;  3SMR A;  4GM9 A;  3C75 H;  1XKS A;  5EMM B;  1N6D A;  2EBS A;  3EMH A;  4O1Q D;  5JWZ A;  5EML B;  3MKS B;  2CO0 A;  3PSL A;  3C5M A;  3J81 g;  4JSP C;  1K8K C;  4J86 A;  2H9P A;  1OLZ A;  2OVR B;  1GG2 B;  4Y7R A;  1TBG A;  4CY1 A;  2AGY A;  3I7N A;  3I8E A;  3I7K A;  3SVW D;  4J82 A;  3OKW A;  5CXB A;  3UVK A;  3F3F A;  4A09 A;  3JAM g;  4CZV A;  1JOF A;  3MMY A;  2B5N A;  2PM9 A;  4FA4 D;  4BUJ C;  3JRO A;  3IKO A;  4E54 B;  1YFQ A;  3JB9 L;  4ZOZ A;  3B7F A;  4G56 B;  4ESG A;  2I0R A;  5CXC B;  3EI3 B;  4AEZ A;  3EI1 B;  1S4U X;  3CFS B;  5TF2 A;  3NVQ A;  3RLM D;  5HYN B;  2HES X;  3OKY B;  5GMK n;  3FGB A;  4CI3 A;  3N0D A;  3K26 A;  3IJ0 A;  5GXI A;  1PEV A;  2IUR A;  3BWS A;  2PM7 B;  3I7O A;  3SHF A;  4O9D A;  3DSM A;  3IIY A;  4FHL A;  3L4M D;  2Z2O A;  2B5L A;  2I3S A;  2IUV A;  2H3X A;  2XL2 A;  4JT6 C;  5HE0 B;  4D6V A;  3UR4 A;  4GM8 A;  3VGZ A;  1NR0 A;  3V7D B;  2H13 A;  3L4O D;  3V5W B;  3SBQ A;  4ZOV A;  5TEE A;  2H47 A;  5H17 A;  2CE9 A;  1A0R B;  2OVQ B;  4PBZ A;  4GQ2 P;  4A11 A;  2CN2 A;  5K1C C;  4BH6 A;  2GNQ A;  4K3J B;  4QRJ A;  1QNI A;  3E0C A;  5FKS A;  3VA6 A;  3I2N A;  5CYK B;  5KDO B;  5SXM A;  4PC0 A;  4J79 A;  4FB1 D;  5FKR A;  4XEI C;  4L9O A;  3SBP A;  5GSA A;  5C2W B;  4AOW A;  4CI8 A;  1MG3 A;  3JRP A;  3EI4 A;  3KRX B;  4GGA A;  2AGZ A;  2YB8 B;  2IUQ A;  4CC9 A;  3I7H A;  1FWX A;  2P9K C;  3GFC A;  2B4E A;  3OTT A;  3SBR A;  5AFU 3;  2G9A A;  4L1Q D;  3OL2 B;  4Y5R D;  4YVD A;  2AQ5 A;  4J77 A;  5HE2 B;  2H14 A;  1SQ9 A;  5I5J A;  2IUP A;  2QXV A;  2YNO A;  4J8B A;  1N6F A;  2AH0 A;  4I79 A;  2YNP A;  4GGD A;  4CI2 A;  4GZ8 A;  5IJ8 E;  3FM0 A;  5H1M A;  2H9L A;  4E54 A;  3VH0 A;  2H6K A;  3V9F A;  1P22 A;  1MG2 A;  3C99 A;  3GRE A;  4PBY A;  2O9K A;  4QT8 A;  4X61 B;  1RI6 A;  4X3E A;  3A0F A;  2XL3 A;  4J8G A;  3JZN A;  2YMU A;  3MKQ A;  4XYH A;  3SJL D;  3AL8 A;  2PM6 B;  4OWR A;  1MDA H;  2P9P C;  5A2Q g;  4NSX A;  4R7A B;  5TDH B;  1GP2 B;  3I8C A;  4PSW B;  3UVO A;  2HJB A;  2TRC B;  4O45 A;  2HJ4 A;  3RN1 D;  3EU7 A;  4Z8L A;  4L3G D;  4QL1 A;  3RMZ D;  4IA9 A;  3CIK B;  3J80 g;  1PGU A;  3HFQ A;  5IT9 g;  2H6Q A;  2P9I C;  2CE8 A;  1R5M A;  2W18 A;  1JJU B;  4J73 A;  3EI2 A;  4A0B B;  3PVW B;  4LG9 A;  4J87 A;  3UKU C;  4A08 A;  3I89 A;  3RRM C;  5EAR A;  5EAP A;  5FLX g;  5EAM A;  4JD2 C;  3MZK A;  4L3H D;  5TEF A;  2CNX A;  3JZH A;  2QC5 A;  3UVM A;  4X63 B;  3NVN A;  2I0T A;  3PSC B;  2OIZ A;  4FA5 D;  2J55 H;  5FKQ A;  1XIP A;  5I5I A;  2P9U C;  2UZX B;  2J56 H;  2AH1 A;  3JPX A;  3ZWL B;  3W15 A;  3BG0 A;  4J78 A;  4H5I A;  2H9M A;  4JT5 C;  3IIW A;  5C2V B;  4KFM B;  4U1E I;  4FWW A;  3OL2 A;  4A0A A;  2CO0 C;  1VYH C;  2BCJ B;  3RSE C;  4D0K A;  5EM2 B;  2MTA H;  2B5M A;  4LGN A;  5H14 A;  1TYQ C;  3I7L A;  2OVP B;  1PBY B;  2I3T A;  4E5Z B;  2I0S A;  2P9L C;  3DXM C;  1U2V C;  4ERY A;  3OW8 A;  4ZOX A;  4CI1 A;  5HE3 B;  4A11 B;  4PXW A;  3EG6 A;  2GC4 A;  3SFZ A;  5EMK B;  4FAN D;  4O3U B;  3JZG A;  3F3G A;  3RN0 D;  3NVX A;  1K32 A;  3PXT D;  1JMZ B;  4QQE A;  3IJC A;  4BL0 A;  3PXS D;  5EMJ B;  5FXY A;  3SN6 B;  4H5J A;  2H68 A;  4TZ4 A;  2J57 G;  4J0X A;  2IWF A;  5C9Z B;  1SQJ A;  5CXC A;  3EI3 A;  3DWL C;  2HKR A;  2IWK A;  3MZL A;  4OZU A;  3SLE D;  3PXW D;  3EI1 A;  3SCY A;  5K19 A;  1L0Q A;  3OKY A;  3C9C A;  1U4C A;  4FA9 D;  4U7A A;  2YBA A;  4CY3 A;  3N0E A;  3PVU B;  3UVL A;  4GQ1 A;  2Z2P A;  5B4W A;  4HDJ A;  4IMM A;  1XHM A;  4A0B A;  3F3P A;  4J84 A;  1JMX B;  2XU7 A;  3DM0 A;  5CXB B;  4ERQ A;  4EWR A;  4PNK B;  4K3I D;  2Q7Q A;  4A09 B;  4CY5 A;  2UZY B;  3UVN A;  2PM9 B;  4CZX A;  4CY2 A;  4A2M A;  5IC7 A;  5I5M A;  3KRW B;  4LG8 A;  4J81 A;  3AL8 B;  4XYI A;  4ERZ A;  2PBI B;  4UI9 R;  2AGW A;  4A7J A;  3P4F A;  2GC7 A;  1ERJ A;  5HE1 B;  5IGO A;  5CYK A;  4GMB A;  2Z2N A;  3SXT D;  3UKR C;  3BG1 A;  3SWS D;  2OK6 A;  4GQB B;  2IAA A;  4JXM A;  3U4Y A;  4PSX B;  3AFC A;  4JSV C;  1PI6 A;  5EM2 A;  3EWE A;  5FQD A;  2BBK H;  5EAL A;  4ZN4 A;  1Q47 A;  3OKT A;  5FA5 B;  4E5Z A;  2YNN A;  5THA A;  4GGC A;  4J0W A;  4CZY A;  3EI2 B;  4N14 A;  2CN3 A;  5GXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...