4GQBB

Crystal structure of the human prmt5:mep50 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
309
structure length
303
Chain Sequence
PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human PRMT5:MEP50 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
total genus 87
structure length 303
sequence length 309
ec nomenclature
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gqbB00
5EM2A 2IWKA 4IA9A 4J87A 5HE2B 3RFGA 5GXIA 1PBYB 3JROA 4LGNA 4ZN4A 1B9YA 2IUVA 4Z8LA 3PE7A 5I5IA 4FA4D 4U7AA 3EG6A 3UVLA 5THAA 4A7JA 4PSWB 2CO0A 4J79A 4OZUA 4A2LA 3PVWB 4ERQA 4GZ8A 1SQJA 3I8CA 4PNKB 5I5MA 3V7DB 5TEFA 4PSXB 3NVQA 3EWEA 2CN2A 2OK6A 4QT8A 4G56B 4CZYA 5C2WB 3DSMA 4FHLA 3EI4A 2CNXA 5IGQA 2YNNA 4CZXA 3AL9A 1U2VC 2AGWA 4GM8A 1RI6A 3FGBA 4A09B 4A0BA 3MKSB 3P4FA 5CYKA 3DM0A 3V5WB 2OVPB 4FAVD 3J81g 4AOWA 4I79A 4LG9A 3SMRA 3SWSD 5HE3B 3PXTD 4ZOXA 3JB9L 4FAND 3RFHA 3HFQA 2H47A 2I3SA 4BUJC 5CXBA 5AJAA 4ERYA 4X63B 2I3TA 4H5IA 4J8BA 3SVWD 4J78A 4IMMA 1GOTB 5EALA 3IJ0A 3C5MA 3ZWLB 5GXHA 1OLZA 2HKRA 5FQDA 3OKYA 4NSXA 5H17A 3J80g 3RMZD 1JMZB 4X61B 2HXCA 3DXKC 5TDHB 2OJYA 3B7FA 2P9NC 4J86A 2PM7B 3OL2A 5HQGA 2B4EA 5EMKB 3I7HA 2J56H 1PGUA 3I8EA 3VGZA 5IC7A 3ORVD 3CFVA 4N14A 5FKSA 2G99A 3A0FA 1VYHC 4GGCA 3SN6B 1XHMA 3MZLA 1N6FA 2PM9A 4MK0B 4GM9A 1MG2A 3SBPA 2AGLA 4ERZA 3ODTA 3OTTA 3CFSB 2YB8B 3GREA 2PM9B 3EI4B 1TYQC 5A2Qg 4A11A 3AL8B 3KRWB 3BWSA 3I7KA 2YMUA 3RLMD 3JRPA 1S4UX 4O45A 2P9LC 1GXRA 3AL8A 4L3HD 3I7OA 3UR4A 5CYKB 2P9KC 3F3PA 1SHYB 3JAMg 4X3EA 5IJ8E 4D6VA 3KRXB 5H14A 5FKTA 2I0RA 3RN1D 3SBQA 2I0TA 4XYIA 4E54A 1TBGA 2OVQB 3E0CA 3FRXA 4Y7RA 5CXBB 4E54B 5FLXg 2B5LA 3UKUC 5FXYA 1B9XA 2GNQA 4AEZA 3BG1A 4CY1A 4PC0A 4O1QD 3SJLD 4EWRA 4K3JB 3AFCA 3OKYB 4GQ1A 3C99A 1L0QA 4J82A 2CO0C 2Z2NA 4GQBB 4U1EI 2YBAA 2QC5A 2UZYB 3IJ1A 4Y5RD 2J57G 3GFCA 3OL2B 2P9SC 2BCJB 3MMYA 3ULEC 3PSLA 1P22A 2W18A 3SHFA 3JPXA 2J55H 3PVUB 4L1QD 3SLED 2XYIA 5HE0B 4ZOVA 1NR0A 3I2NA 4BH6A 4O3UB 4YVDA 4XYHA 2MTAH 4JT5C 3BG0A 2XL2A 3I7LA 3JZNA 5FKRA 2OIZA 5K1CC 3MZKA 5FA5B 3U4YA 2GC4A 2YNPA 2H13A 3UVOA 4JXMA 4A11B 2G9AA 4UI9R 2B5NA 3FM0A 3C9CA 4LG8A 3JZHA 1K8KC 4ZOZA 2H9NA 4ES0A 3VH0A 4JT6C 3MKQA 5HE1B 2P9IC 3IIYA 5SXMA 1XKSA 5TEEA 4J77A 3W15A 2H6NA 1OMWB 3VA6A 3UKRC 3F3GA 2CE8A 2EBSA 3I7PA 3K27A 1SQ9A 4HDJA 5K19A 2AH0A 5HYNB 2XU7A 4KFMB 2I0SA 1PEVA 2H9LA 4PBYA 4J0XA 3MXXA 3L4OD 5C9ZB 2IUQA 2H3XA 5IJ7E 5EMMB 2CN3A 5CXCA 1JMXB 4JD2C 4JSNC 1PI6A 5EAMA 1MDAH 2HKMA 4ESGA 2Z2OA 4GGDA 5H1MA 4R7AB 1N6EA 4FA9D 2AGYA 4ZOYA 2IWFA 4CY2A 3C75H 2O9KA 5KDOB 4GMBA 3AH8B 4J81A 3OW8A 4BL0A 3RRMC 1YFQA 4CZVA 2IAAA 3PXWD 1N6DA 2H6QA 2H9PA 1Q47A 4L3GD 4FA5D 3EI2A 3SCYA 1FWXA 2Z2PA 3RN0D 2HJ4A 5GMKn 5EMLB 1JJUB 3PSCB 1QNIA 2Q7QA 4J73A 4K3ID 3EI2B 4FB1D 4QRJA 2AGZA 2IURA 4JSXC 3RSEC 3UVKA 3DXMC 3V9FA 3I89A 3SFZA 1R5MA 5EMJB 5AMSA 1K32A 2OK4A 2IUPA 4E5ZA 2P9PC 2QXVA 3EI3B 4PBZA 3DWLC 1A0RB 2BBKH 4L9OA 3IKOA 2GC7A 3EMHA 4CC9A 5EM2B 1GP2B 4QL1A 2CE9A 4QQEA 4CI3A 4CY3A 3EU7A 4XEIC 2PBIB 4GQ2P 4J84A 5IT9g 3L4MD 5IGOA 3PXSD 2HYEA 4A08B 5EARA 5CXCB 4J0WA 2H9MA 4TZ4A 2AH1A 2H6KA 3IJCA 3I7NA 4A08A 3F3FA 2HESX 2PM6B 4O3TB 1XIPA 4GGAA 4A2MA 5B4WA 4PXWA 4OWRA 3UVNA 5GSAA 5FKQA 5C2VB 3JZGA 2XL3A 2AQ5A 2TRCB 5AFU3 4FA1D 4A0BB 3OKWA 3SXTD 5I5JA 4A09A 4O9DA 5EAPA 4CI1A 4FWWA 3K26A 5JWZA 4D0KA 2P9UC 3NVXA 2HJBA 1U4CA 2B5MA 4A0AB 4CI2A 3EI1B 2OVRB 3OKTA 5TF2A 4CY5A 3NVNA 3CIKB 1GG2B 3IIWA 4A0AA 3N0EA 3N0DA 1JOFA 1ERJA 4H5JA 3EI1A 1MG3A 3SBRA 4CI8A 4E5ZB 3EI3A 4JSVC 4GM3A 4JSPC 4X60B 2H14A 2AGXA 2UZXB 4J8GA 2YNOA 1NEXB 2H68A 3UVMA
chains in the Genus database with same CATH superfamily
1JTDB 5EM2A 2IWKA 4IA9A 4J87A 5HE2B 3RFGA 5GXIA 4MMYA 1VZ2A 1PBYB 3JROA 4LGNA 4ZN4A 1B9YA 2IUVA 4Z8LA 3PE7A 5I5IA 4FA4D 4U7AA 3EG6A 3ZDYA 3UVLA 1C9LA 5THAA 4A7JA 4PSWB 2CO0A 4J79A 4OZUA 4A2LA 3PVWB 4WJKA 4GZ8A 4ERQA 1SQJA 3I8CA 4PNKB 5I5MA 4O2WA 3V7DB 5TEFA 4PSXB 2VDRA 3NVQA 3EWEA 2CN2A 5M61A 2OK6A 4QT8A 4G56B 4CZYA 4NC4A 5C2WB 1GOFA 3MUOA 5C92A 3DSMA 4FHLA 2HU7A 3EI4A 1GOHA 2CNXA 5IGQA 2YNNA 5E6SA 4WK0A 4CZXA 3AL9A 1BPOA 4MMXA 1U2VC 2XE4A 2VZ1A 2AGWA 4GM8A 1RI6A 3FGBA 4BCCA 4A09B 4A0BA 3ZE2A 3MKSB 3P4FA 5CYKA 3DM0A 5M5UA 3V5WB 2OVPB 4FAVD 3J81g 4AX4A 4AOWA 4I79A 4LG9A 3IVMA 5FFGA 3SMRA 3SWSD 3ZE1A 5HE3B 3PXTD 4ZOXA 3JB9L 4FAND 3RFHA 4IRZA 3HFQA 3K6SA 2H47A 2I3SA 4BUJC 5CXBA 3VI3A 5AJAA 4ERYA 4X63B 2I3TA 4H5IA 2VDOA 4J8BA 3SVWD 4J78A 4IMMA 1GOTB 5EALA 3IJ0A 3C5MA 3ZWLB 5GXHA 1OLZA 2HKRA 5FQDA 3OKYA 4NSXA 3NIGA 5H17A 4JHNA 3J80g 3RMZD 5HDBA 4Z7QA 1JMZB 4X61B 2HXCA 3DXKC 5TDHB 2OJYA 3B7FA 5E6RA 2P9NC 4J86A 2PM7B 3FCSA 3OL2A 5HQGA 2B4EA 5EMKB 1E8MA 3I7HA 2J56H 1PGUA 3I8EA 3VGZA 3QI0A 5IC7A 1UTCA 3MUNA 3QHYB 3ORVD 3CFVA 4N14A 5FKSA 2EICA 2G99A 3A0FA 1VYHC 4GGCA 3SN6B 1XHMA 3MZLA 1N6FA 2PM9A 4MK0B 1UOPA 4GM9A 1MG2A 3SBPA 2AGLA 4ERZA 4AMZA 3ODTA 3IUMA 3OTTA 3CFSB 2YB8B 2QZPA 3GREA 3T3MA 2PM9B 1E8NA 3EI4B 1TYQC 5A2Qg 4A11A 3AL8B 3KRWB 3BWSA 3I7KA 2YMUA 1UOQA 3RLMD 3JRPA 3NIDA 1S4UX 1I2MB 4O45A 2P9LC 1GXRA 3AL8A 4L3HD 3I7OA 3UR4A 5CYKB 2P9KC 3F3PA 4WK4A 1SHYB 3JAMg 4X3EA 5IJ8E 4D6VA 3KRXB 5H14A 4G1EA 5M5SA 5FKTA 2I0RA 3RN1D 3SBQA 2I0TA 1H2YA 2VC2A 4XYIA 4E54A 4O02A 1TBGA 4WK2A 2VDKA 4JHPC 2OVQB 3E0CA 3FRXA 4Z7NA 4Y7RA 2WQ8A 2QR5A 5M5TA 4AN0A 5CXBB 4E54B 5FLXg 2B5LA 3UKUC 4Z7OA 5FXYA 1B9XA 2GNQA 4AEZA 3BG1A 4CY1A 4PC0A 4O1QD 3SJLD 4EWRA 4K3JB 3AFCA 3OKYB 4DNVA 4GQ1A 3C99A 1L0QA 4J82A 2CO0C 2Z2NA 4GQBB 4U1EI 2JKXA 2YBAA 3IUJA 2QC5A 2UZYB 3K71A 3IJ1A 4Y5RD 2J57G 2EIEA 3GFCA 3OL2B 2P9SC 3O4HA 2BCJB 3MMYA 3ULEC 3K72A 3PSLA 5C86A 1P22A 2W18A 3SHFA 3JPXA 2J55H 3PVUB 4L1QD 3DDUA 3SLED 2XYIA 5HE0B 4ZOVA 1NR0A 2VDLA 4BCDA 3I2NA 4BH6A 4O3UB 2HU5A 4XYHA 2MTAH 3OF7A 4YVDA 4JT5C 3BG0A 2XL2A 3I7LA 5M5RA 2XDWA 3JZNA 5FKRA 2OIZA 5K1CC 3MZKA 5FA5B 3U4YA 2GC4A 4BCBA 2YNPA 4NAAA 2H13A 1H2XA 3UVOA 4JXMA 4A11B 2VDMA 2G9AA 4UI9R 2B5NA 3FM0A 3C9CA 4LG8A 3JZHA 4RE5A 1K8KC 4ZOZA 2H9NA 4ES0A 3VH0A 4JT6C 3MKQA 5HE1B 2P9IC 3IIYA 5SXMA 1XKSA 4NBMA 5TEEA 4J77A 2VZ3A 3W15A 2H6NA 1OMWB 3VA6A 3UKRC 3F3GA 2CE8A 2EBSA 3I7PA 3K27A 1SQ9A 4HDJA 5K19A 2AH0A 4UM9A 5HYNB 2XU7A 4KFMB 4G1MA 2I0SA 1PEVA 2H9LA 4PBYA 4J0XA 1JV2A 3FCUA 3MXXA 3L4OD 5C9ZB 4RE6A 2IUQA 2H3XA 5IJ7E 3GD1I 5EMMB 2CN3A 5CXCA 1JMXB 4JD2C 4JSNC 4G55A 3EQ7A 1PI6A 5EAMA 3MVDK 1MDAH 2HKMA 3V4VA 4ESGA 4D9SA 2Z2OA 4GGDA 5H1MA 4R7AB 1N6EA 4FA9D 2AGYA 4ZOYA 2IWFA 2EIDA 3C75H 4CY2A 2O9KA 5KDOB 4GMBA 1A12A 3AH8B 5M5VA 1VZ3A 4J81A 3OW8A 4BL0A 3RRMC 1YFQA 4CZVA 2IAAA 3PXWD 1L5GA 1N6DA 2H6QA 1C9IA 1QFSA 4BP8A 4NENA 2VDQA 2H9PA 1Q47A 4L3GD 2VDPA 3V4PA 4FA5D 3EI2A 3SCYA 1FWXA 2Z2PA 1VE6A 3RN0D 3KCIA 4UM8A 2HJ4A 5GMKn 5EMLB 1JJUB 3PSCB 1QNIA 3GC3B 2Q7QA 4J73A 4K3ID 3EI2B 4FB1D 4QRJA 1VE7A 2AGZA 2IURA 4JSXC 1H2WA 3RSEC 3UVKA 1H2ZA 3DXMC 3V9FA 3IJEA 3I89A 2VDNA 3EQ9A 3SFZA 1R5MA 5EMJB 5AMSA 1K32A 2OK4A 2IUPA 4E5ZA 2P9PC 2QXVA 1O6FA 3EI3B 4PBZA 3DWLC 1A0RB 2BBKH 5E6UA 3O4GA 4L9OA 3IKOA 4AMYA 2GC7A 1YR2A 3EMHA 3T3PA 4CC9A 3IUNA 5EM2B 1GP2B 1GOGA 4QL1A 2CE9A 4BP9A 3IULA 4QQEA 4DNUA 4CI3A 3ZDZA 4CY3A 3EU7A 4XEIC 2PBIB 4AN1A 4GQ2P 4J84A 5IT9g 3L4MD 1UOOA 5IGOA 3PXSD 2HYEA 3ZE0A 4A08B 5EARA 5CXCB 4J0WA 4L1MA 2H9MA 4TZ4A 2AH1A 2H6KA 3IJCA 3I7NA 4A08A 1QFMA 3F3FA 2XZGA 2HESX 2PM6B 4O3TB 4QAMA 1T2XA 1XIPA 4GGAA 3O4JA 3VI4A 4A2MA 5B4WA 5FFOA 4PXWA 4OWRA 3UVNA 3EQ8A 5GSAA 5FKQA 4MMZA 5C2VB 3JZGA 2XL3A 3O4IA 3IURA 2AQ5A 3IUQA 1O6GA 1TYEA 2TRCB 5AFU3 4FA1D 4A0BB 3OKWA 3SXTD 5I5JA 3ZDXA 4O9DA 4A09A 5EAPA 4CI1A 2EIBA 4FWWA 3K26A 5JWZA 4DNWA 4D0KA 2P9UC 3NVXA 1K3IA 2HJBA 3NIFA 1U8CA 1U4CA 2B5MA 2HU8A 4A0AB 4CI2A 3EI1B 2OVRB 3OKTA 5TF2A 4CY5A 3NVNA 1M1XA 3CIKB 1GG2B 3IIWA 4A0AA 3N0EA 3N0DA 1ERJA 1JOFA 4H5JA 3EI1A 1E5TA 1MG3A 3SBRA 4CI8A 4E5ZB 3EI3A 4JSVC 4GM3A 4JSPC 4X60B 2H14A 2AGXA 2UZXB 4J8GA 2YNOA 2BKLA 1NEXB 2H68A 3UVMA
chains in the Genus database with same CATH topology
5EM2A 2IWKA 4IA9A 4J87A 5HE2B 3RFGA 5GXIA 1PBYB 3JROA 4LGNA 4ZN4A 1B9YA 2IUVA 4Z8LA 3PE7A 5I5IA 4FA4D 4U7AA 3EG6A 3UVLA 5THAA 4A7JA 4PSWB 2CO0A 4J79A 4OZUA 4A2LA 3PVWB 4ERQA 4GZ8A 1SQJA 3I8CA 4PNKB 5I5MA 3V7DB 5TEFA 4PSXB 3NVQA 3EWEA 2CN2A 2OK6A 4QT8A 4G56B 4CZYA 5C2WB 3DSMA 4FHLA 3EI4A 2CNXA 5IGQA 2YNNA 4CZXA 3AL9A 1U2VC 2AGWA 4GM8A 1RI6A 3FGBA 4A09B 4A0BA 3MKSB 3P4FA 5CYKA 3DM0A 3V5WB 2OVPB 4FAVD 3J81g 4AOWA 4I79A 4LG9A 3SMRA 3SWSD 5HE3B 3PXTD 4ZOXA 3JB9L 4FAND 3RFHA 3HFQA 2H47A 2I3SA 4BUJC 5CXBA 5AJAA 4ERYA 4X63B 2I3TA 4H5IA 4J8BA 3SVWD 4J78A 4IMMA 1GOTB 5EALA 3IJ0A 3C5MA 3ZWLB 5GXHA 1OLZA 2HKRA 5FQDA 3OKYA 4NSXA 5H17A 3J80g 3RMZD 1JMZB 4X61B 2HXCA 3DXKC 5TDHB 2OJYA 3B7FA 2P9NC 4J86A 2PM7B 3OL2A 5HQGA 2B4EA 5EMKB 3I7HA 2J56H 1PGUA 3I8EA 3VGZA 5IC7A 3ORVD 3CFVA 4N14A 5FKSA 2G99A 3A0FA 1VYHC 4GGCA 3SN6B 1XHMA 3MZLA 1N6FA 2PM9A 4MK0B 4GM9A 1MG2A 3SBPA 2AGLA 4ERZA 3ODTA 3OTTA 3CFSB 2YB8B 3GREA 2PM9B 3EI4B 1TYQC 5A2Qg 4A11A 3AL8B 3KRWB 3BWSA 3I7KA 2YMUA 3RLMD 3JRPA 1S4UX 4O45A 2P9LC 1GXRA 3AL8A 4L3HD 3I7OA 3UR4A 5CYKB 2P9KC 3F3PA 1SHYB 3JAMg 4X3EA 5IJ8E 4D6VA 3KRXB 5H14A 5FKTA 2I0RA 3RN1D 3SBQA 2I0TA 4XYIA 4E54A 1TBGA 2OVQB 3E0CA 3FRXA 4Y7RA 5CXBB 4E54B 5FLXg 2B5LA 3UKUC 5FXYA 1B9XA 2GNQA 4AEZA 3BG1A 4CY1A 4PC0A 4O1QD 3SJLD 4EWRA 4K3JB 3AFCA 3OKYB 4GQ1A 3C99A 1L0QA 4J82A 2CO0C 2Z2NA 4GQBB 4U1EI 2YBAA 2QC5A 2UZYB 3IJ1A 4Y5RD 2J57G 3GFCA 3OL2B 2P9SC 2BCJB 3MMYA 3ULEC 3PSLA 1P22A 2W18A 3SHFA 3JPXA 2J55H 3PVUB 4L1QD 3SLED 2XYIA 5HE0B 4ZOVA 1NR0A 3I2NA 4BH6A 4O3UB 4YVDA 4XYHA 2MTAH 4JT5C 3BG0A 2XL2A 3I7LA 3JZNA 5FKRA 2OIZA 5K1CC 3MZKA 5FA5B 3U4YA 2GC4A 2YNPA 2H13A 3UVOA 4JXMA 4A11B 2G9AA 4UI9R 2B5NA 3FM0A 3C9CA 4LG8A 3JZHA 1K8KC 4ZOZA 2H9NA 4ES0A 3VH0A 4JT6C 3MKQA 5HE1B 2P9IC 3IIYA 5SXMA 1XKSA 5TEEA 4J77A 3W15A 2H6NA 1OMWB 3VA6A 3UKRC 3F3GA 2CE8A 2EBSA 3I7PA 3K27A 1SQ9A 4HDJA 5K19A 2AH0A 5HYNB 2XU7A 4KFMB 2I0SA 1PEVA 2H9LA 4PBYA 4J0XA 3MXXA 3L4OD 5C9ZB 2IUQA 2H3XA 5IJ7E 5EMMB 2CN3A 5CXCA 1JMXB 4JD2C 4JSNC 1PI6A 5EAMA 1MDAH 2HKMA 4ESGA 2Z2OA 4GGDA 5H1MA 4R7AB 1N6EA 4FA9D 2AGYA 4ZOYA 2IWFA 4CY2A 3C75H 2O9KA 5KDOB 4GMBA 3AH8B 4J81A 3OW8A 4BL0A 3RRMC 1YFQA 4CZVA 2IAAA 3PXWD 1N6DA 2H6QA 2H9PA 1Q47A 4L3GD 4FA5D 3EI2A 3SCYA 1FWXA 2Z2PA 3RN0D 2HJ4A 5GMKn 5EMLB 1JJUB 3PSCB 1QNIA 2Q7QA 4J73A 4K3ID 3EI2B 4FB1D 4QRJA 2AGZA 2IURA 4JSXC 3RSEC 3UVKA 3DXMC 3V9FA 3I89A 3SFZA 1R5MA 5EMJB 5AMSA 1K32A 2OK4A 2IUPA 4E5ZA 2P9PC 2QXVA 3EI3B 4PBZA 3DWLC 1A0RB 2BBKH 4L9OA 3IKOA 2GC7A 3EMHA 4CC9A 5EM2B 1GP2B 4QL1A 2CE9A 4QQEA 4CI3A 4CY3A 3EU7A 4XEIC 2PBIB 4GQ2P 4J84A 5IT9g 3L4MD 5IGOA 3PXSD 2HYEA 4A08B 5EARA 5CXCB 4J0WA 2H9MA 4TZ4A 2AH1A 2H6KA 3IJCA 3I7NA 4A08A 3F3FA 2HESX 2PM6B 4O3TB 1XIPA 4GGAA 4A2MA 5B4WA 4PXWA 4OWRA 3UVNA 5GSAA 5FKQA 5C2VB 3JZGA 2XL3A 2AQ5A 2TRCB 5AFU3 4FA1D 4A0BB 3OKWA 3SXTD 5I5JA 4A09A 4O9DA 5EAPA 4CI1A 4FWWA 3K26A 5JWZA 4D0KA 2P9UC 3NVXA 2HJBA 1U4CA 2B5MA 4A0AB 4CI2A 3EI1B 2OVRB 3OKTA 5TF2A 4CY5A 3NVNA 3CIKB 1GG2B 3IIWA 4A0AA 3N0EA 3N0DA 1JOFA 1ERJA 4H5JA 3EI1A 1MG3A 3SBRA 4CI8A 4E5ZB 3EI3A 4JSVC 4GM3A 4JSPC 4X60B 2H14A 2AGXA 2UZXB 4J8GA 2YNOA 1NEXB 2H68A 3UVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM2 A;  2IWK A;  4IA9 A;  4J87 A;  5HE2 B;  3RFG A;  5GXI A;  1PBY B;  3JRO A;  4LGN A;  4ZN4 A;  1B9Y A;  2IUV A;  4Z8L A;  3PE7 A;  5I5I A;  4FA4 D;  4U7A A;  3EG6 A;  3UVL A;  5THA A;  4A7J A;  4PSW B;  2CO0 A;  4J79 A;  4OZU A;  4A2L A;  3PVW B;  4ERQ A;  4GZ8 A;  1SQJ A;  3I8C A;  4PNK B;  5I5M A;  3V7D B;  5TEF A;  4PSX B;  3NVQ A;  3EWE A;  2CN2 A;  2OK6 A;  4QT8 A;  4G56 B;  4CZY A;  5C2W B;  3DSM A;  4FHL A;  3EI4 A;  2CNX A;  5IGQ A;  2YNN A;  4CZX A;  3AL9 A;  1U2V C;  2AGW A;  4GM8 A;  1RI6 A;  3FGB A;  4A09 B;  4A0B A;  3MKS B;  3P4F A;  5CYK A;  3DM0 A;  3V5W B;  2OVP B;  4FAV D;  3J81 g;  4AOW A;  4I79 A;  4LG9 A;  3SMR A;  3SWS D;  5HE3 B;  3PXT D;  4ZOX A;  3JB9 L;  4FAN D;  3RFH A;  3HFQ A;  2H47 A;  2I3S A;  4BUJ C;  5CXB A;  5AJA A;  4ERY A;  4X63 B;  2I3T A;  4H5I A;  4J8B A;  3SVW D;  4J78 A;  4IMM A;  1GOT B;  5EAL A;  3IJ0 A;  3C5M A;  3ZWL B;  5GXH A;  1OLZ A;  2HKR A;  5FQD A;  3OKY A;  4NSX A;  5H17 A;  3J80 g;  3RMZ D;  1JMZ B;  4X61 B;  2HXC A;  3DXK C;  5TDH B;  2OJY A;  3B7F A;  2P9N C;  4J86 A;  2PM7 B;  3OL2 A;  5HQG A;  2B4E A;  5EMK B;  3I7H A;  2J56 H;  1PGU A;  3I8E A;  3VGZ A;  5IC7 A;  3ORV D;  3CFV A;  4N14 A;  5FKS A;  2G99 A;  3A0F A;  1VYH C;  4GGC A;  3SN6 B;  1XHM A;  3MZL A;  1N6F A;  2PM9 A;  4MK0 B;  4GM9 A;  1MG2 A;  3SBP A;  2AGL A;  4ERZ A;  3ODT A;  3OTT A;  3CFS B;  2YB8 B;  3GRE A;  2PM9 B;  3EI4 B;  1TYQ C;  5A2Q g;  4A11 A;  3AL8 B;  3KRW B;  3BWS A;  3I7K A;  2YMU A;  3RLM D;  3JRP A;  1S4U X;  4O45 A;  2P9L C;  1GXR A;  3AL8 A;  4L3H D;  3I7O A;  3UR4 A;  5CYK B;  2P9K C;  3F3P A;  1SHY B;  3JAM g;  4X3E A;  5IJ8 E;  4D6V A;  3KRX B;  5H14 A;  5FKT A;  2I0R A;  3RN1 D;  3SBQ A;  2I0T A;  4XYI A;  4E54 A;  1TBG A;  2OVQ B;  3E0C A;  3FRX A;  4Y7R A;  5CXB B;  4E54 B;  5FLX g;  2B5L A;  3UKU C;  5FXY A;  1B9X A;  2GNQ A;  4AEZ A;  3BG1 A;  4CY1 A;  4PC0 A;  4O1Q D;  3SJL D;  4EWR A;  4K3J B;  3AFC A;  3OKY B;  4GQ1 A;  3C99 A;  1L0Q A;  4J82 A;  2CO0 C;  2Z2N A;  4GQB B;  4U1E I;  2YBA A;  2QC5 A;  2UZY B;  3IJ1 A;  4Y5R D;  2J57 G;  3GFC A;  3OL2 B;  2P9S C;  2BCJ B;  3MMY A;  3ULE C;  3PSL A;  1P22 A;  2W18 A;  3SHF A;  3JPX A;  2J55 H;  3PVU B;  4L1Q D;  3SLE D;  2XYI A;  5HE0 B;  4ZOV A;  1NR0 A;  3I2N A;  4BH6 A;  4O3U B;  4YVD A;  4XYH A;  2MTA H;  4JT5 C;  3BG0 A;  2XL2 A;  3I7L A;  3JZN A;  5FKR A;  2OIZ A;  5K1C C;  3MZK A;  5FA5 B;  3U4Y A;  2GC4 A;  2YNP A;  2H13 A;  3UVO A;  4JXM A;  4A11 B;  2G9A A;  4UI9 R;  2B5N A;  3FM0 A;  3C9C A;  4LG8 A;  3JZH A;  1K8K C;  4ZOZ A;  2H9N A;  4ES0 A;  3VH0 A;  4JT6 C;  3MKQ A;  5HE1 B;  2P9I C;  3IIY A;  5SXM A;  1XKS A;  5TEE A;  4J77 A;  3W15 A;  2H6N A;  1OMW B;  3VA6 A;  3UKR C;  3F3G A;  2CE8 A;  2EBS A;  3I7P A;  3K27 A;  1SQ9 A;  4HDJ A;  5K19 A;  2AH0 A;  5HYN B;  2XU7 A;  4KFM B;  2I0S A;  1PEV A;  2H9L A;  4PBY A;  4J0X A;  3MXX A;  3L4O D;  5C9Z B;  2IUQ A;  2H3X A;  5IJ7 E;  5EMM B;  2CN3 A;  5CXC A;  1JMX B;  4JD2 C;  4JSN C;  1PI6 A;  5EAM A;  1MDA H;  2HKM A;  4ESG A;  2Z2O A;  4GGD A;  5H1M A;  4R7A B;  1N6E A;  4FA9 D;  2AGY A;  4ZOY A;  2IWF A;  4CY2 A;  3C75 H;  2O9K A;  5KDO B;  4GMB A;  3AH8 B;  4J81 A;  3OW8 A;  4BL0 A;  3RRM C;  1YFQ A;  4CZV A;  2IAA A;  3PXW D;  1N6D A;  2H6Q A;  2H9P A;  1Q47 A;  4L3G D;  4FA5 D;  3EI2 A;  3SCY A;  1FWX A;  2Z2P A;  3RN0 D;  2HJ4 A;  5GMK n;  5EML B;  1JJU B;  3PSC B;  1QNI A;  2Q7Q A;  4J73 A;  4K3I D;  3EI2 B;  4FB1 D;  4QRJ A;  2AGZ A;  2IUR A;  4JSX C;  3RSE C;  3UVK A;  3DXM C;  3V9F A;  3I89 A;  3SFZ A;  1R5M A;  5EMJ B;  5AMS A;  1K32 A;  2OK4 A;  2IUP A;  4E5Z A;  2P9P C;  2QXV A;  3EI3 B;  4PBZ A;  3DWL C;  1A0R B;  2BBK H;  4L9O A;  3IKO A;  2GC7 A;  3EMH A;  4CC9 A;  5EM2 B;  1GP2 B;  4QL1 A;  2CE9 A;  4QQE A;  4CI3 A;  4CY3 A;  3EU7 A;  4XEI C;  2PBI B;  4GQ2 P;  4J84 A;  5IT9 g;  3L4M D;  5IGO A;  3PXS D;  2HYE A;  4A08 B;  5EAR A;  5CXC B;  4J0W A;  2H9M A;  4TZ4 A;  2AH1 A;  2H6K A;  3IJC A;  3I7N A;  4A08 A;  3F3F A;  2HES X;  2PM6 B;  4O3T B;  1XIP A;  4GGA A;  4A2M A;  5B4W A;  4PXW A;  4OWR A;  3UVN A;  5GSA A;  5FKQ A;  5C2V B;  3JZG A;  2XL3 A;  2AQ5 A;  2TRC B;  5AFU 3;  4FA1 D;  4A0B B;  3OKW A;  3SXT D;  5I5J A;  4A09 A;  4O9D A;  5EAP A;  4CI1 A;  4FWW A;  3K26 A;  5JWZ A;  4D0K A;  2P9U C;  3NVX A;  2HJB A;  1U4C A;  2B5M A;  4A0A B;  4CI2 A;  3EI1 B;  2OVR B;  3OKT A;  5TF2 A;  4CY5 A;  3NVN A;  3CIK B;  1GG2 B;  3IIW A;  4A0A A;  3N0E A;  3N0D A;  1JOF A;  1ERJ A;  4H5J A;  3EI1 A;  1MG3 A;  3SBR A;  4CI8 A;  4E5Z B;  3EI3 A;  4JSV C;  4GM3 A;  4JSP C;  4X60 B;  2H14 A;  2AGX A;  2UZX B;  4J8G A;  2YNO A;  1NEX B;  2H68 A;  3UVM A; 
#chains in the Genus database with same CATH topology
 1JTD B;  5EM2 A;  2IWK A;  4IA9 A;  4J87 A;  5HE2 B;  3RFG A;  5GXI A;  4MMY A;  1VZ2 A;  1PBY B;  3JRO A;  4LGN A;  4ZN4 A;  1B9Y A;  2IUV A;  4Z8L A;  3PE7 A;  5I5I A;  4FA4 D;  4U7A A;  3EG6 A;  3ZDY A;  3UVL A;  1C9L A;  5THA A;  4A7J A;  4PSW B;  2CO0 A;  4J79 A;  4OZU A;  4A2L A;  3PVW B;  4WJK A;  4GZ8 A;  4ERQ A;  1SQJ A;  3I8C A;  4PNK B;  5I5M A;  4O2W A;  3V7D B;  5TEF A;  4PSX B;  2VDR A;  3NVQ A;  3EWE A;  2CN2 A;  5M61 A;  2OK6 A;  4QT8 A;  4G56 B;  4CZY A;  4NC4 A;  5C2W B;  1GOF A;  3MUO A;  5C92 A;  3DSM A;  4FHL A;  2HU7 A;  3EI4 A;  1GOH A;  2CNX A;  5IGQ A;  2YNN A;  5E6S A;  4WK0 A;  4CZX A;  3AL9 A;  1BPO A;  4MMX A;  1U2V C;  2XE4 A;  2VZ1 A;  2AGW A;  4GM8 A;  1RI6 A;  3FGB A;  4BCC A;  4A09 B;  4A0B A;  3ZE2 A;  3MKS B;  3P4F A;  5CYK A;  3DM0 A;  5M5U A;  3V5W B;  2OVP B;  4FAV D;  3J81 g;  4AX4 A;  4AOW A;  4I79 A;  4LG9 A;  3IVM A;  5FFG A;  3SMR A;  3SWS D;  3ZE1 A;  5HE3 B;  3PXT D;  4ZOX A;  3JB9 L;  4FAN D;  3RFH A;  4IRZ A;  3HFQ A;  3K6S A;  2H47 A;  2I3S A;  4BUJ C;  5CXB A;  3VI3 A;  5AJA A;  4ERY A;  4X63 B;  2I3T A;  4H5I A;  2VDO A;  4J8B A;  3SVW D;  4J78 A;  4IMM A;  1GOT B;  5EAL A;  3IJ0 A;  3C5M A;  3ZWL B;  5GXH A;  1OLZ A;  2HKR A;  5FQD A;  3OKY A;  4NSX A;  3NIG A;  5H17 A;  4JHN A;  3J80 g;  3RMZ D;  5HDB A;  4Z7Q A;  1JMZ B;  4X61 B;  2HXC A;  3DXK C;  5TDH B;  2OJY A;  3B7F A;  5E6R A;  2P9N C;  4J86 A;  2PM7 B;  3FCS A;  3OL2 A;  5HQG A;  2B4E A;  5EMK B;  1E8M A;  3I7H A;  2J56 H;  1PGU A;  3I8E A;  3VGZ A;  3QI0 A;  5IC7 A;  1UTC A;  3MUN A;  3QHY B;  3ORV D;  3CFV A;  4N14 A;  5FKS A;  2EIC A;  2G99 A;  3A0F A;  1VYH C;  4GGC A;  3SN6 B;  1XHM A;  3MZL A;  1N6F A;  2PM9 A;  4MK0 B;  1UOP A;  4GM9 A;  1MG2 A;  3SBP A;  2AGL A;  4ERZ A;  4AMZ A;  3ODT A;  3IUM A;  3OTT A;  3CFS B;  2YB8 B;  2QZP A;  3GRE A;  3T3M A;  2PM9 B;  1E8N A;  3EI4 B;  1TYQ C;  5A2Q g;  4A11 A;  3AL8 B;  3KRW B;  3BWS A;  3I7K A;  2YMU A;  1UOQ A;  3RLM D;  3JRP A;  3NID A;  1S4U X;  1I2M B;  4O45 A;  2P9L C;  1GXR A;  3AL8 A;  4L3H D;  3I7O A;  3UR4 A;  5CYK B;  2P9K C;  3F3P A;  4WK4 A;  1SHY B;  3JAM g;  4X3E A;  5IJ8 E;  4D6V A;  3KRX B;  5H14 A;  4G1E A;  5M5S A;  5FKT A;  2I0R A;  3RN1 D;  3SBQ A;  2I0T A;  1H2Y A;  2VC2 A;  4XYI A;  4E54 A;  4O02 A;  1TBG A;  4WK2 A;  2VDK A;  4JHP C;  2OVQ B;  3E0C A;  3FRX A;  4Z7N A;  4Y7R A;  2WQ8 A;  2QR5 A;  5M5T A;  4AN0 A;  5CXB B;  4E54 B;  5FLX g;  2B5L A;  3UKU C;  4Z7O A;  5FXY A;  1B9X A;  2GNQ A;  4AEZ A;  3BG1 A;  4CY1 A;  4PC0 A;  4O1Q D;  3SJL D;  4EWR A;  4K3J B;  3AFC A;  3OKY B;  4DNV A;  4GQ1 A;  3C99 A;  1L0Q A;  4J82 A;  2CO0 C;  2Z2N A;  4GQB B;  4U1E I;  2JKX A;  2YBA A;  3IUJ A;  2QC5 A;  2UZY B;  3K71 A;  3IJ1 A;  4Y5R D;  2J57 G;  2EIE A;  3GFC A;  3OL2 B;  2P9S C;  3O4H A;  2BCJ B;  3MMY A;  3ULE C;  3K72 A;  3PSL A;  5C86 A;  1P22 A;  2W18 A;  3SHF A;  3JPX A;  2J55 H;  3PVU B;  4L1Q D;  3DDU A;  3SLE D;  2XYI A;  5HE0 B;  4ZOV A;  1NR0 A;  2VDL A;  4BCD A;  3I2N A;  4BH6 A;  4O3U B;  2HU5 A;  4XYH A;  2MTA H;  3OF7 A;  4YVD A;  4JT5 C;  3BG0 A;  2XL2 A;  3I7L A;  5M5R A;  2XDW A;  3JZN A;  5FKR A;  2OIZ A;  5K1C C;  3MZK A;  5FA5 B;  3U4Y A;  2GC4 A;  4BCB A;  2YNP A;  4NAA A;  2H13 A;  1H2X A;  3UVO A;  4JXM A;  4A11 B;  2VDM A;  2G9A A;  4UI9 R;  2B5N A;  3FM0 A;  3C9C A;  4LG8 A;  3JZH A;  4RE5 A;  1K8K C;  4ZOZ A;  2H9N A;  4ES0 A;  3VH0 A;  4JT6 C;  3MKQ A;  5HE1 B;  2P9I C;  3IIY A;  5SXM A;  1XKS A;  4NBM A;  5TEE A;  4J77 A;  2VZ3 A;  3W15 A;  2H6N A;  1OMW B;  3VA6 A;  3UKR C;  3F3G A;  2CE8 A;  2EBS A;  3I7P A;  3K27 A;  1SQ9 A;  4HDJ A;  5K19 A;  2AH0 A;  4UM9 A;  5HYN B;  2XU7 A;  4KFM B;  4G1M A;  2I0S A;  1PEV A;  2H9L A;  4PBY A;  4J0X A;  1JV2 A;  3FCU A;  3MXX A;  3L4O D;  5C9Z B;  4RE6 A;  2IUQ A;  2H3X A;  5IJ7 E;  3GD1 I;  5EMM B;  2CN3 A;  5CXC A;  1JMX B;  4JD2 C;  4JSN C;  4G55 A;  3EQ7 A;  1PI6 A;  5EAM A;  3MVD K;  1MDA H;  2HKM A;  3V4V A;  4ESG A;  4D9S A;  2Z2O A;  4GGD A;  5H1M A;  4R7A B;  1N6E A;  4FA9 D;  2AGY A;  4ZOY A;  2IWF A;  2EID A;  3C75 H;  4CY2 A;  2O9K A;  5KDO B;  4GMB A;  1A12 A;  3AH8 B;  5M5V A;  1VZ3 A;  4J81 A;  3OW8 A;  4BL0 A;  3RRM C;  1YFQ A;  4CZV A;  2IAA A;  3PXW D;  1L5G A;  1N6D A;  2H6Q A;  1C9I A;  1QFS A;  4BP8 A;  4NEN A;  2VDQ A;  2H9P A;  1Q47 A;  4L3G D;  2VDP A;  3V4P A;  4FA5 D;  3EI2 A;  3SCY A;  1FWX A;  2Z2P A;  1VE6 A;  3RN0 D;  3KCI A;  4UM8 A;  2HJ4 A;  5GMK n;  5EML B;  1JJU B;  3PSC B;  1QNI A;  3GC3 B;  2Q7Q A;  4J73 A;  4K3I D;  3EI2 B;  4FB1 D;  4QRJ A;  1VE7 A;  2AGZ A;  2IUR A;  4JSX C;  1H2W A;  3RSE C;  3UVK A;  1H2Z A;  3DXM C;  3V9F A;  3IJE A;  3I89 A;  2VDN A;  3EQ9 A;  3SFZ A;  1R5M A;  5EMJ B;  5AMS A;  1K32 A;  2OK4 A;  2IUP A;  4E5Z A;  2P9P C;  2QXV A;  1O6F A;  3EI3 B;  4PBZ A;  3DWL C;  1A0R B;  2BBK H;  5E6U A;  3O4G A;  4L9O A;  3IKO A;  4AMY A;  2GC7 A;  1YR2 A;  3EMH A;  3T3P A;  4CC9 A;  3IUN A;  5EM2 B;  1GP2 B;  1GOG A;  4QL1 A;  2CE9 A;  4BP9 A;  3IUL A;  4QQE A;  4DNU A;  4CI3 A;  3ZDZ A;  4CY3 A;  3EU7 A;  4XEI C;  2PBI B;  4AN1 A;  4GQ2 P;  4J84 A;  5IT9 g;  3L4M D;  1UOO A;  5IGO A;  3PXS D;  2HYE A;  3ZE0 A;  4A08 B;  5EAR A;  5CXC B;  4J0W A;  4L1M A;  2H9M A;  4TZ4 A;  2AH1 A;  2H6K A;  3IJC A;  3I7N A;  4A08 A;  1QFM A;  3F3F A;  2XZG A;  2HES X;  2PM6 B;  4O3T B;  4QAM A;  1T2X A;  1XIP A;  4GGA A;  3O4J A;  3VI4 A;  4A2M A;  5B4W A;  5FFO A;  4PXW A;  4OWR A;  3UVN A;  3EQ8 A;  5GSA A;  5FKQ A;  4MMZ A;  5C2V B;  3JZG A;  2XL3 A;  3O4I A;  3IUR A;  2AQ5 A;  3IUQ A;  1O6G A;  1TYE A;  2TRC B;  5AFU 3;  4FA1 D;  4A0B B;  3OKW A;  3SXT D;  5I5J A;  3ZDX A;  4O9D A;  4A09 A;  5EAP A;  4CI1 A;  2EIB A;  4FWW A;  3K26 A;  5JWZ A;  4DNW A;  4D0K A;  2P9U C;  3NVX A;  1K3I A;  2HJB A;  3NIF A;  1U8C A;  1U4C A;  2B5M A;  2HU8 A;  4A0A B;  4CI2 A;  3EI1 B;  2OVR B;  3OKT A;  5TF2 A;  4CY5 A;  3NVN A;  1M1X A;  3CIK B;  1GG2 B;  3IIW A;  4A0A A;  3N0E A;  3N0D A;  1ERJ A;  1JOF A;  4H5J A;  3EI1 A;  1E5T A;  1MG3 A;  3SBR A;  4CI8 A;  4E5Z B;  3EI3 A;  4JSV C;  4GM3 A;  4JSP C;  4X60 B;  2H14 A;  2AGX A;  2UZX B;  4J8G A;  2YNO A;  2BKL A;  1NEX B;  2H68 A;  3UVM A; 
#chains in the Genus database with same CATH homology
 5EM2 A;  2IWK A;  4IA9 A;  4J87 A;  5HE2 B;  3RFG A;  5GXI A;  1PBY B;  3JRO A;  4LGN A;  4ZN4 A;  1B9Y A;  2IUV A;  4Z8L A;  3PE7 A;  5I5I A;  4FA4 D;  4U7A A;  3EG6 A;  3UVL A;  5THA A;  4A7J A;  4PSW B;  2CO0 A;  4J79 A;  4OZU A;  4A2L A;  3PVW B;  4ERQ A;  4GZ8 A;  1SQJ A;  3I8C A;  4PNK B;  5I5M A;  3V7D B;  5TEF A;  4PSX B;  3NVQ A;  3EWE A;  2CN2 A;  2OK6 A;  4QT8 A;  4G56 B;  4CZY A;  5C2W B;  3DSM A;  4FHL A;  3EI4 A;  2CNX A;  5IGQ A;  2YNN A;  4CZX A;  3AL9 A;  1U2V C;  2AGW A;  4GM8 A;  1RI6 A;  3FGB A;  4A09 B;  4A0B A;  3MKS B;  3P4F A;  5CYK A;  3DM0 A;  3V5W B;  2OVP B;  4FAV D;  3J81 g;  4AOW A;  4I79 A;  4LG9 A;  3SMR A;  3SWS D;  5HE3 B;  3PXT D;  4ZOX A;  3JB9 L;  4FAN D;  3RFH A;  3HFQ A;  2H47 A;  2I3S A;  4BUJ C;  5CXB A;  5AJA A;  4ERY A;  4X63 B;  2I3T A;  4H5I A;  4J8B A;  3SVW D;  4J78 A;  4IMM A;  1GOT B;  5EAL A;  3IJ0 A;  3C5M A;  3ZWL B;  5GXH A;  1OLZ A;  2HKR A;  5FQD A;  3OKY A;  4NSX A;  5H17 A;  3J80 g;  3RMZ D;  1JMZ B;  4X61 B;  2HXC A;  3DXK C;  5TDH B;  2OJY A;  3B7F A;  2P9N C;  4J86 A;  2PM7 B;  3OL2 A;  5HQG A;  2B4E A;  5EMK B;  3I7H A;  2J56 H;  1PGU A;  3I8E A;  3VGZ A;  5IC7 A;  3ORV D;  3CFV A;  4N14 A;  5FKS A;  2G99 A;  3A0F A;  1VYH C;  4GGC A;  3SN6 B;  1XHM A;  3MZL A;  1N6F A;  2PM9 A;  4MK0 B;  4GM9 A;  1MG2 A;  3SBP A;  2AGL A;  4ERZ A;  3ODT A;  3OTT A;  3CFS B;  2YB8 B;  3GRE A;  2PM9 B;  3EI4 B;  1TYQ C;  5A2Q g;  4A11 A;  3AL8 B;  3KRW B;  3BWS A;  3I7K A;  2YMU A;  3RLM D;  3JRP A;  1S4U X;  4O45 A;  2P9L C;  1GXR A;  3AL8 A;  4L3H D;  3I7O A;  3UR4 A;  5CYK B;  2P9K C;  3F3P A;  1SHY B;  3JAM g;  4X3E A;  5IJ8 E;  4D6V A;  3KRX B;  5H14 A;  5FKT A;  2I0R A;  3RN1 D;  3SBQ A;  2I0T A;  4XYI A;  4E54 A;  1TBG A;  2OVQ B;  3E0C A;  3FRX A;  4Y7R A;  5CXB B;  4E54 B;  5FLX g;  2B5L A;  3UKU C;  5FXY A;  1B9X A;  2GNQ A;  4AEZ A;  3BG1 A;  4CY1 A;  4PC0 A;  4O1Q D;  3SJL D;  4EWR A;  4K3J B;  3AFC A;  3OKY B;  4GQ1 A;  3C99 A;  1L0Q A;  4J82 A;  2CO0 C;  2Z2N A;  4GQB B;  4U1E I;  2YBA A;  2QC5 A;  2UZY B;  3IJ1 A;  4Y5R D;  2J57 G;  3GFC A;  3OL2 B;  2P9S C;  2BCJ B;  3MMY A;  3ULE C;  3PSL A;  1P22 A;  2W18 A;  3SHF A;  3JPX A;  2J55 H;  3PVU B;  4L1Q D;  3SLE D;  2XYI A;  5HE0 B;  4ZOV A;  1NR0 A;  3I2N A;  4BH6 A;  4O3U B;  4YVD A;  4XYH A;  2MTA H;  4JT5 C;  3BG0 A;  2XL2 A;  3I7L A;  3JZN A;  5FKR A;  2OIZ A;  5K1C C;  3MZK A;  5FA5 B;  3U4Y A;  2GC4 A;  2YNP A;  2H13 A;  3UVO A;  4JXM A;  4A11 B;  2G9A A;  4UI9 R;  2B5N A;  3FM0 A;  3C9C A;  4LG8 A;  3JZH A;  1K8K C;  4ZOZ A;  2H9N A;  4ES0 A;  3VH0 A;  4JT6 C;  3MKQ A;  5HE1 B;  2P9I C;  3IIY A;  5SXM A;  1XKS A;  5TEE A;  4J77 A;  3W15 A;  2H6N A;  1OMW B;  3VA6 A;  3UKR C;  3F3G A;  2CE8 A;  2EBS A;  3I7P A;  3K27 A;  1SQ9 A;  4HDJ A;  5K19 A;  2AH0 A;  5HYN B;  2XU7 A;  4KFM B;  2I0S A;  1PEV A;  2H9L A;  4PBY A;  4J0X A;  3MXX A;  3L4O D;  5C9Z B;  2IUQ A;  2H3X A;  5IJ7 E;  5EMM B;  2CN3 A;  5CXC A;  1JMX B;  4JD2 C;  4JSN C;  1PI6 A;  5EAM A;  1MDA H;  2HKM A;  4ESG A;  2Z2O A;  4GGD A;  5H1M A;  4R7A B;  1N6E A;  4FA9 D;  2AGY A;  4ZOY A;  2IWF A;  4CY2 A;  3C75 H;  2O9K A;  5KDO B;  4GMB A;  3AH8 B;  4J81 A;  3OW8 A;  4BL0 A;  3RRM C;  1YFQ A;  4CZV A;  2IAA A;  3PXW D;  1N6D A;  2H6Q A;  2H9P A;  1Q47 A;  4L3G D;  4FA5 D;  3EI2 A;  3SCY A;  1FWX A;  2Z2P A;  3RN0 D;  2HJ4 A;  5GMK n;  5EML B;  1JJU B;  3PSC B;  1QNI A;  2Q7Q A;  4J73 A;  4K3I D;  3EI2 B;  4FB1 D;  4QRJ A;  2AGZ A;  2IUR A;  4JSX C;  3RSE C;  3UVK A;  3DXM C;  3V9F A;  3I89 A;  3SFZ A;  1R5M A;  5EMJ B;  5AMS A;  1K32 A;  2OK4 A;  2IUP A;  4E5Z A;  2P9P C;  2QXV A;  3EI3 B;  4PBZ A;  3DWL C;  1A0R B;  2BBK H;  4L9O A;  3IKO A;  2GC7 A;  3EMH A;  4CC9 A;  5EM2 B;  1GP2 B;  4QL1 A;  2CE9 A;  4QQE A;  4CI3 A;  4CY3 A;  3EU7 A;  4XEI C;  2PBI B;  4GQ2 P;  4J84 A;  5IT9 g;  3L4M D;  5IGO A;  3PXS D;  2HYE A;  4A08 B;  5EAR A;  5CXC B;  4J0W A;  2H9M A;  4TZ4 A;  2AH1 A;  2H6K A;  3IJC A;  3I7N A;  4A08 A;  3F3F A;  2HES X;  2PM6 B;  4O3T B;  1XIP A;  4GGA A;  4A2M A;  5B4W A;  4PXW A;  4OWR A;  3UVN A;  5GSA A;  5FKQ A;  5C2V B;  3JZG A;  2XL3 A;  2AQ5 A;  2TRC B;  5AFU 3;  4FA1 D;  4A0B B;  3OKW A;  3SXT D;  5I5J A;  4A09 A;  4O9D A;  5EAP A;  4CI1 A;  4FWW A;  3K26 A;  5JWZ A;  4D0K A;  2P9U C;  3NVX A;  2HJB A;  1U4C A;  2B5M A;  4A0A B;  4CI2 A;  3EI1 B;  2OVR B;  3OKT A;  5TF2 A;  4CY5 A;  3NVN A;  3CIK B;  1GG2 B;  3IIW A;  4A0A A;  3N0E A;  3N0D A;  1JOF A;  1ERJ A;  4H5J A;  3EI1 A;  1MG3 A;  3SBR A;  4CI8 A;  4E5Z B;  3EI3 A;  4JSV C;  4GM3 A;  4JSP C;  4X60 B;  2H14 A;  2AGX A;  2UZX B;  4J8G A;  2YNO A;  1NEX B;  2H68 A;  3UVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...