4GQBB

Crystal structure of the human prmt5:mep50 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
309
structure length
303
Chain Sequence
b'PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
molecule tags Transferase/protein binding
source organism Homo sapiens
publication title Crystal structure of the human PRMT5:MEP50 complex.
pubmed doi rcsb
total genus 87
structure length 303
sequence length 309
ec nomenclature
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gqbB00
4X3EA 4ESGA 3V9FA 3FRXA 3IJ0A 4GGDA 3SLED 4A0AA 1PI6A 4A09B 3IJ1A 5FKRA 5FA5B 4J0WA 2I0TA 3DM0A 4GMBA 4A08B 3OL2B 5H14A 3EI4A 4Z8LA 2O9KA 3RN1D 2J56H 2IAAA 4QT8A 3OKYB 2H6KA 2OVPB 4A2MA 5CXCA 3C9CA 3RN0D 5FXYA 4D6VA 2OVRB 3C75H 5EM2B 3I8CA 4L3HD 3CFSB 5FKQA 4FA5D 3I7KA 1PBYB 3F3FA 3MXXA 3HFQA 3JB9L 1YFQA 5EMKB 3EI3A 4FA4D 2I3SA 4A11B 4ZOZA 4ERQA 4FAVD 2P9SC 4BUJC 3FM0A 2H9NA 4CY1A 1ERJA 4J81A 4FA1D 2EBSA 3DXKC 4E54A 4LGNA 3L4OD 3JROA 5GXIA 2P9NC 5I5MA 5IC7A 2G9AA 4AEZA 4FAND 4PSXB 2Q7QA 3KRWB 2H14A 2H6NA 4GQ1A 3EMHA 2PBIB 2H6QA 4I79A 4ERYA 3SBPA 3EI2A 4CI3A 5GXHA 2P9PC 1MDAH 4J87A 4AOWA 1GG2B 4E5ZA 2OK4A 2CE9A 2AGZA 3AL8A 3PSCB 3I7OA 4H5JA 4FA9D 2AGXA 1TBGA 3JAMg 3SHFA 2J55H 2HJBA 3SWSD 3SBRA 3I8EA 3MMYA 2CO0C 3RRMC 1U2VC 2I3TA 2YBAA 4CY2A 4A0BB 3C5MA 4D0KA 5B4WA 2H68A 5IJ7E 3EI1B 5IGQA 4FB1D 4ES0A 2HESX 4A09A 5GMKn 4Y5RD 3F3GA 3N0EA 3VH0A 4LG9A 3K27A 3EU7A 4X61B 2IURA 5FQDA 3EG6A 3IIWA 5SXMA 5TEEA 2BCJB 3NVXA 4JSPC 1XKSA 3CFVA 3DSMA 4GM3A 1OMWB 1NR0A 2AGLA 3F3PA 2P9LC 4PBYA 1JJUB 4U7AA 5EAPA 5CYKA 2AH1A 4OZUA 1GOTB 3MZLA 2H9MA 2UZXB 3PXSD 4CZVA 4K3JB 4LG8A 2PM9B 4L3GD 1R5MA 4CZYA 3JRPA 4JSXC 3V5WB 2GC7A 2TRCB 1SQJA 1NEXB 3J81g 3BG1A 4UI9R 2I0RA 4GGAA 4ZOYA 2P9KC 3DWLC 3B7FA 2HKRA 2H47A 2W18A 3UVLA 3GREA 5EALA 4E54B 4A2LA 2IWKA 4JT6C 2B5MA 4O45A 3SJLD 1GP2B 4X63B 3L4MD 4J8BA 1A0RB 3ZWLB 4YVDA 2IUQA 5H17A 3SBQA 4NSXA 3VGZA 2BBKH 4ERZA 1QNIA 5EAMA 3I7HA 1XIPA 4QL1A 4FHLA 2IUVA 4EWRA 2MTAH 1SHYB 3SVWD 1N6DA 2G99A 5EMJB 2XL2A 5AFU3 4JT5C 1B9XA 3DXMC 3OL2A 5JWZA 3IKOA 1U4CA 3OKYA 3OTTA 4R7AB 2AH0A 4A0AB 5THAA 5HE2B 5CXCB 3GFCA 1FWXA 3KRXB 5C2VB 4OWRA 5IT9g 4GGCA 2HXCA 5EM2A 3EI4B 4PBZA 2CNXA 3JPXA 3PXWD 5K1CC 3EI1A 1GXRA 4CI1A 4J8GA 2PM6B 2J57G 1N6FA 5EMMB 1TYQC 5C2WB 1JMXB 2P9IC 4XEIC 2P9UC 4J73A 2QXVA 2AGYA 3SMRA 3J80g 4O3UB 5I5JA 4U1EI 2YB8B 2CE8A 1MG3A 2H9LA 4O1QD 4BL0A 5CXBB 3FGBA 4J82A 2H13A 2HYEA 1K32A 3EI3B 3PVUB 4A11A 4PC0A 3OKWA 4JSNC 4L1QD 1PGUA 5FKSA 2HJ4A 3RMZD 5AMSA 1P22A 3UVOA 1Q47A 3A0FA 3PXTD 5KDOB 4J86A 2OIZA 3K26A 3JZNA 2XYIA 3U4YA 2H9PA 4XYHA 4H5IA 2OK6A 3I89A 3AL8B 4GM8A 5K19A 4CZXA 3EI2B 4JD2C 1S4UX 3PE7A 4TZ4A 5HE3B 4QQEA 5HYNB 3P4FA 3V7DB 1XHMA 3EWEA 4E5ZB 4J84A 3I7PA 3PVWB 4A08A 3ORVD 5TF2A 5HE0B 1JOFA 4A0BA 3ULEC 2I0SA 3AFCA 2IWFA 3UVKA 3I2NA 3RSEC 3I7LA 5FLXg 4Y7RA 2Z2PA 2B4EA 2YNOA 2IUPA 2GNQA 2AQ5A 4IA9A 1RI6A 2Z2OA 1N6EA 2YNNA 2YNPA 3NVQA 4CI2A 2CN2A 3I7NA 3SFZA 2CO0A 4ZN4A 2AGWA 4IMMA 3BG0A 4GQ2P 4BH6A 5TEFA 2OJYA 4JSVC 3CIKB 1SQ9A 3ODTA 1JMZB 5HE1B 3SXTD 2XU7A 3MKQA 3RLMD 4GQBB 4J0XA 3VA6A 3BWSA 1L0QA 4G56B 4O3TB 3C99A 1PEVA 1OLZA 5IJ8E 2PM7B 4J79A 3SN6B 5EARA 3AL9A 4JXMA 5GSAA 4HDJA 2B5LA 3SCYA 4CY5A 3MZKA 3IJCA 2OVQB 3UVMA 2QC5A 5TDHB 1VYHC 5EMLB 3N0DA 4GZ8A 4K3ID 1K8KC 3UR4A 1MG2A 4J77A 5IGOA 3JZGA 3UVNA 2UZYB 5CYKB 3UKRC 5C9ZB 4PNKB 4CI8A 3IIYA 3W15A 4CC9A 4ZOVA 5A2Qg 4A7JA 2XL3A 5AJAA 4O9DA 3E0CA 4PSWB 4QRJA 3RFHA 3MKSB 2PM9A 4KFMB 2CN3A 2HKMA 4L9OA 2H3XA 5CXBA 3JZHA 3RFGA 4CY3A 4GM9A 5I5IA 4PXWA 3UKUC 5FKTA 2Z2NA 4MK0B 2GC4A 5H1MA 3PSLA 4XYIA 4J78A 5HQGA 4N14A 1B9YA 3AH8B 4ZOXA 2YMUA 3OKTA 3OW8A 3NVNA 2B5NA 4X60B 4FWWA
chains in the Genus database with same CATH superfamily
4X3EA 5M5RA 1H2YA 4ESGA 4NENA 3V9FA 3FRXA 1L5GA 3IJ0A 4WK2A 4G55A 4GGDA 4MMZA 3SLED 4A0AA 1PI6A 4A09B 3IJ1A 5FKRA 5FA5B 4J0WA 2I0TA 3DM0A 1GOHA 4GMBA 3ZE0A 5FFGA 4A08B 3OL2B 5H14A 4UM9A 3EI4A 4Z8LA 2O9KA 3RN1D 2J56H 2IAAA 4QT8A 3OKYB 2H6KA 2OVPB 4A2MA 5CXCA 3C9CA 3RN0D 2VZ1A 4L1MA 4NBMA 5FXYA 4D6VA 2OVRB 2VDRA 3C75H 5EM2B 3I8CA 4L3HD 3CFSB 1M1XA 5FKQA 4FA5D 3I7KA 1PBYB 3F3FA 2VZ3A 3O4JA 3MXXA 3HFQA 1H2XA 3JB9L 1YFQA 2QR5A 1C9IA 5EMKB 4O2WA 3EI3A 4FA4D 2I3SA 4A11B 4ZOZA 4ERQA 4FAVD 2P9SC 4BUJC 3FM0A 5M5UA 2H9NA 4CY1A 1H2WA 1ERJA 2EIDA 4J81A 4FA1D 1TYEA 2EBSA 3DXKC 4E54A 4LGNA 3L4OD 3JROA 5GXIA 2VDPA 2P9NC 5I5MA 5IC7A 2G9AA 4AEZA 4FAND 4PSXB 2Q7QA 3KRWB 2H14A 2H6NA 4GQ1A 3EMHA 2PBIB 2VDQA 2H6QA 4I79A 4ERYA 3SBPA 3EI2A 4CI3A 5GXHA 2P9PC 1MDAH 4J87A 3O4IA 3MVDK 4AOWA 1GG2B 4E5ZA 2OK4A 2VDNA 2CE9A 2AGZA 3AL8A 3PSCB 3I7OA 4H5JA 4FA9D 2AGXA 1TBGA 4Z7NA 3JAMg 3SHFA 2J55H 2HJBA 3SWSD 3SBRA 3I8EA 1O6FA 3MMYA 2CO0C 3RRMC 1U2VC 2I3TA 2YBAA 2QZPA 4CY2A 4A0BB 2VC2A 3C5MA 3FCUA 4D0KA 5B4WA 4BCCA 2H68A 4WK4A 5IJ7E 3EI1B 2VDKA 1GOGA 4UM8A 5IGQA 4DNVA 4FB1D 4ES0A 2HESX 2EIBA 1K3IA 2EIEA 4A09A 5GMKn 4Y5RD 3F3GA 3N0EA 3VH0A 4LG9A 3K27A 3EU7A 4X61B 2IURA 5FQDA 3EG6A 3IIWA 5C92A 5SXMA 3EQ7A 5TEEA 2BCJB 3NVXA 4IRZA 1XKSA 3CFVA 4JSPC 3DSMA 3GC3B 5C86A 1UOOA 4GM3A 1OMWB 1NR0A 2AGLA 3F3PA 1QFMA 2P9LC 4PBYA 1JJUB 4U7AA 5HDBA 5EAPA 5CYKA 2AH1A 4OZUA 1GOTB 3MZLA 2H9MA 2UZXB 3PXSD 4CZVA 4QAMA 4K3JB 3NIGA 4LG8A 4BCDA 2PM9B 1JV2A 1VE7A 4L3GD 1E8NA 1R5MA 4CZYA 1O6GA 1U8CA 3JRPA 4JSXC 3V5WB 4AX4A 2GC7A 2TRCB 1SQJA 1NEXB 3J81g 3EQ8A 3BG1A 4UI9R 2I0RA 4GGAA 4ZOYA 4BP8A 2P9KC 3MUOA 3ZDZA 4DNWA 3DWLC 1E8MA 2VDOA 3B7FA 3ZE1A 2HKRA 2H47A 3IVMA 3O4HA 2W18A 3UVLA 3GREA 5EALA 1UTCA 4E54B 4A2LA 2IWKA 4JT6C 2B5MA 4O45A 3K6SA 3SJLD 1GP2B 4X63B 3L4MD 4J8BA 1A0RB 3ZWLB 4YVDA 2IUQA 5H17A 4MMXA 4NSXA 3SBQA 3EQ9A 3VGZA 2BBKH 4ERZA 1QNIA 5EAMA 3I7HA 1XIPA 4QL1A 3IURA 4FHLA 3QHYB 2IUVA 4EWRA 2MTAH 1SHYB 3V4VA 3SVWD 1N6DA 2G99A 5EMJB 2XL2A 5FFOA 5AFU3 4JT5C 1B9XA 3DXMC 3OL2A 4BCBA 5JWZA 2XE4A 3IKOA 3ZE2A 2EICA 1U4CA 3OKYA 3OTTA 4R7AB 2AH0A 4A0AB 2VDLA 5THAA 5HE2B 5CXCB 4WK0A 3GFCA 5E6SA 1FWXA 3KRXB 5C2VB 4OWRA 5IT9g 4GGCA 2HXCA 5EM2A 2HU7A 3EI4B 4PBZA 2CNXA 1VZ3A 3JPXA 3PXWD 3T3PA 5K1CC 3EI1A 1GXRA 3T3MA 4CI1A 4MMYA 3IUMA 4J8GA 3V4PA 2PM6B 2J57G 1N6FA 5EMMB 1TYQC 5C2WB 1JMXB 2P9IC 3MUNA 4G1MA 4JHPC 4XEIC 2P9UC 4J73A 2QXVA 2AGYA 3SMRA 4AMZA 3J80g 4O3UB 5I5JA 4U1EI 1C9LA 2YB8B 2CE8A 1MG3A 2H9LA 4O1QD 4BL0A 4WJKA 5CXBB 3FGBA 4J82A 2H13A 2HYEA 1K32A 3EI3B 3PVUB 1UOQA 3QI0A 4A11A 4PC0A 3OKWA 4JSNC 4L1QD 1PGUA 3DDUA 5FKSA 2HJ4A 3RMZD 5AMSA 1P22A 3UVOA 1Q47A 3A0FA 3PXTD 5KDOB 4J86A 1JTDB 2OIZA 3K26A 5M5SA 3JZNA 2XYIA 3U4YA 4Z7OA 1UOPA 3NIDA 1T2XA 3IUNA 5E6UA 3OF7A 2H9PA 4XYHA 4H5IA 2OK6A 3I89A 3AL8B 4GM8A 5M5TA 5K19A 1VE6A 4CZXA 3EI2B 4JD2C 1S4UX 3PE7A 4TZ4A 4Z7QA 5HE3B 4QQEA 5HYNB 1BPOA 3P4FA 4DNUA 3V7DB 1XHMA 3EWEA 4E5ZB 3IUQA 4J84A 3I7PA 3PVWB 4A08A 3ORVD 5TF2A 1GOFA 4AN0A 5HE0B 1JOFA 4NC4A 1VZ2A 4A0BA 5M61A 3ULEC 3IJEA 2I0SA 4AN1A 3AFCA 2IWFA 3UVKA 3I2NA 3RSEC 3I7LA 5FLXg 4AMYA 4Y7RA 4JHNA 2Z2PA 2B4EA 2YNOA 2IUPA 2GNQA 2AQ5A 4IA9A 1RI6A 2Z2OA 1N6EA 2YNNA 2YNPA 3NVQA 4CI2A 2CN2A 3I7NA 3SFZA 1YR2A 2CO0A 4BP9A 4ZN4A 2AGWA 4IMMA 3BG0A 4GQ2P 4BH6A 5TEFA 2OJYA 3FCSA 3CIKB 4JSVC 3O4GA 1SQ9A 2HU5A 1JMZB 3ODTA 4RE6A 2VDMA 5HE1B 3SXTD 2XU7A 3MKQA 3RLMD 4GQBB 4J0XA 3VA6A 3BWSA 1L0QA 4G56B 4O3TB 3C99A 1PEVA 3GD1I 1QFSA 1OLZA 5IJ8E 2PM7B 4J79A 3SN6B 5EARA 3AL9A 4JXMA 5GSAA 4HDJA 4RE5A 2B5LA 3NIFA 3SCYA 2XZGA 4CY5A 3MZKA 3IJCA 2OVQB 3UVMA 2QC5A 5TDHB 1VYHC 5EMLB 3N0DA 4GZ8A 4K3ID 4NAAA 1K8KC 3UR4A 1MG2A 4D9SA 1A12A 4J77A 5IGOA 3K72A 3JZGA 3UVNA 2UZYB 5CYKB 3UKRC 2WQ8A 5C9ZB 4PNKB 4CI8A 3VI4A 3IIYA 3W15A 4CC9A 4ZOVA 5A2Qg 4A7JA 2XL3A 5AJAA 3ZDYA 4O9DA 3E0CA 4PSWB 4QRJA 3RFHA 4O02A 3MKSB 2PM9A 4KFMB 2CN3A 2HKMA 2XDWA 4L9OA 3VI3A 2H3XA 3KCIA 5CXBA 3JZHA 3RFGA 4CY3A 4GM9A 4G1EA 5I5IA 4PXWA 2BKLA 3UKUC 3K71A 5FKTA 2Z2NA 3IULA 4MK0B 2GC4A 5H1MA 3ZDXA 5E6RA 2HU8A 3PSLA 4XYIA 4J78A 1H2ZA 2JKXA 5HQGA 1E5TA 4N14A 1B9YA 3AH8B 4ZOXA 2YMUA 1I2MB 3OKTA 3IUJA 3OW8A 3NVNA 2B5NA 5M5VA 4X60B 4FWWA
chains in the Genus database with same CATH topology
4X3EA 4ESGA 3V9FA 3FRXA 3IJ0A 4GGDA 3SLED 4A0AA 1PI6A 4A09B 3IJ1A 5FKRA 5FA5B 4J0WA 2I0TA 3DM0A 4GMBA 4A08B 3OL2B 5H14A 3EI4A 4Z8LA 2O9KA 3RN1D 2J56H 2IAAA 4QT8A 3OKYB 2H6KA 2OVPB 4A2MA 5CXCA 3C9CA 3RN0D 5FXYA 4D6VA 2OVRB 3C75H 5EM2B 3I8CA 4L3HD 3CFSB 5FKQA 4FA5D 3I7KA 1PBYB 3F3FA 3MXXA 3HFQA 3JB9L 1YFQA 5EMKB 3EI3A 4FA4D 2I3SA 4A11B 4ZOZA 4ERQA 4FAVD 2P9SC 4BUJC 3FM0A 2H9NA 4CY1A 1ERJA 4J81A 4FA1D 2EBSA 3DXKC 4E54A 4LGNA 3L4OD 3JROA 5GXIA 2P9NC 5I5MA 5IC7A 2G9AA 4AEZA 4FAND 4PSXB 2Q7QA 3KRWB 2H14A 2H6NA 4GQ1A 3EMHA 2PBIB 2H6QA 4I79A 4ERYA 3SBPA 3EI2A 4CI3A 5GXHA 2P9PC 1MDAH 4J87A 4AOWA 1GG2B 4E5ZA 2OK4A 2CE9A 2AGZA 3AL8A 3PSCB 3I7OA 4H5JA 4FA9D 2AGXA 1TBGA 3JAMg 3SHFA 2J55H 2HJBA 3SWSD 3SBRA 3I8EA 3MMYA 2CO0C 3RRMC 1U2VC 2I3TA 2YBAA 4CY2A 4A0BB 3C5MA 4D0KA 5B4WA 2H68A 5IJ7E 3EI1B 5IGQA 4FB1D 4ES0A 2HESX 4A09A 5GMKn 4Y5RD 3F3GA 3N0EA 3VH0A 4LG9A 3K27A 3EU7A 4X61B 2IURA 5FQDA 3EG6A 3IIWA 5SXMA 5TEEA 2BCJB 3NVXA 4JSPC 1XKSA 3CFVA 3DSMA 4GM3A 1OMWB 1NR0A 2AGLA 3F3PA 2P9LC 4PBYA 1JJUB 4U7AA 5EAPA 5CYKA 2AH1A 4OZUA 1GOTB 3MZLA 2H9MA 2UZXB 3PXSD 4CZVA 4K3JB 4LG8A 2PM9B 4L3GD 1R5MA 4CZYA 3JRPA 4JSXC 3V5WB 2GC7A 2TRCB 1SQJA 1NEXB 3J81g 3BG1A 4UI9R 2I0RA 4GGAA 4ZOYA 2P9KC 3DWLC 3B7FA 2HKRA 2H47A 2W18A 3UVLA 3GREA 5EALA 4E54B 4A2LA 2IWKA 4JT6C 2B5MA 4O45A 3SJLD 1GP2B 4X63B 3L4MD 4J8BA 1A0RB 3ZWLB 4YVDA 2IUQA 5H17A 3SBQA 4NSXA 3VGZA 2BBKH 4ERZA 1QNIA 5EAMA 3I7HA 1XIPA 4QL1A 4FHLA 2IUVA 4EWRA 2MTAH 1SHYB 3SVWD 1N6DA 2G99A 5EMJB 2XL2A 5AFU3 4JT5C 1B9XA 3DXMC 3OL2A 5JWZA 3IKOA 1U4CA 3OKYA 3OTTA 4R7AB 2AH0A 4A0AB 5THAA 5HE2B 5CXCB 3GFCA 1FWXA 3KRXB 5C2VB 4OWRA 5IT9g 4GGCA 2HXCA 5EM2A 3EI4B 4PBZA 2CNXA 3JPXA 3PXWD 5K1CC 3EI1A 1GXRA 4CI1A 4J8GA 2PM6B 2J57G 1N6FA 5EMMB 1TYQC 5C2WB 1JMXB 2P9IC 4XEIC 2P9UC 4J73A 2QXVA 2AGYA 3SMRA 3J80g 4O3UB 5I5JA 4U1EI 2YB8B 2CE8A 1MG3A 2H9LA 4O1QD 4BL0A 5CXBB 3FGBA 4J82A 2H13A 2HYEA 1K32A 3EI3B 3PVUB 4A11A 4PC0A 3OKWA 4JSNC 4L1QD 1PGUA 5FKSA 2HJ4A 3RMZD 5AMSA 1P22A 3UVOA 1Q47A 3A0FA 3PXTD 5KDOB 4J86A 2OIZA 3K26A 3JZNA 2XYIA 3U4YA 2H9PA 4XYHA 4H5IA 2OK6A 3I89A 3AL8B 4GM8A 5K19A 4CZXA 3EI2B 4JD2C 1S4UX 3PE7A 4TZ4A 5HE3B 4QQEA 5HYNB 3P4FA 3V7DB 1XHMA 3EWEA 4E5ZB 4J84A 3I7PA 3PVWB 4A08A 3ORVD 5TF2A 5HE0B 1JOFA 4A0BA 3ULEC 2I0SA 3AFCA 2IWFA 3UVKA 3I2NA 3RSEC 3I7LA 5FLXg 4Y7RA 2Z2PA 2B4EA 2YNOA 2IUPA 2GNQA 2AQ5A 4IA9A 1RI6A 2Z2OA 1N6EA 2YNNA 2YNPA 3NVQA 4CI2A 2CN2A 3I7NA 3SFZA 2CO0A 4ZN4A 2AGWA 4IMMA 3BG0A 4GQ2P 4BH6A 5TEFA 2OJYA 4JSVC 3CIKB 1SQ9A 3ODTA 1JMZB 5HE1B 3SXTD 2XU7A 3MKQA 3RLMD 4GQBB 4J0XA 3VA6A 3BWSA 1L0QA 4G56B 4O3TB 3C99A 1PEVA 1OLZA 5IJ8E 2PM7B 4J79A 3SN6B 5EARA 3AL9A 4JXMA 5GSAA 4HDJA 2B5LA 3SCYA 4CY5A 3MZKA 3IJCA 2OVQB 3UVMA 2QC5A 5TDHB 1VYHC 5EMLB 3N0DA 4GZ8A 4K3ID 1K8KC 3UR4A 1MG2A 4J77A 5IGOA 3JZGA 3UVNA 2UZYB 5CYKB 3UKRC 5C9ZB 4PNKB 4CI8A 3IIYA 3W15A 4CC9A 4ZOVA 5A2Qg 4A7JA 2XL3A 5AJAA 4O9DA 3E0CA 4PSWB 4QRJA 3RFHA 3MKSB 2PM9A 4KFMB 2CN3A 2HKMA 4L9OA 2H3XA 5CXBA 3JZHA 3RFGA 4CY3A 4GM9A 5I5IA 4PXWA 3UKUC 5FKTA 2Z2NA 4MK0B 2GC4A 5H1MA 3PSLA 4XYIA 4J78A 5HQGA 4N14A 1B9YA 3AH8B 4ZOXA 2YMUA 3OKTA 3OW8A 3NVNA 2B5NA 4X60B 4FWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3E A;  4ESG A;  3V9F A;  3FRX A;  3IJ0 A;  4GGD A;  3SLE D;  4A0A A;  1PI6 A;  4A09 B;  3IJ1 A;  5FKR A;  5FA5 B;  4J0W A;  2I0T A;  3DM0 A;  4GMB A;  4A08 B;  3OL2 B;  5H14 A;  3EI4 A;  4Z8L A;  2O9K A;  3RN1 D;  2J56 H;  2IAA A;  4QT8 A;  3OKY B;  2H6K A;  2OVP B;  4A2M A;  5CXC A;  3C9C A;  3RN0 D;  5FXY A;  4D6V A;  2OVR B;  3C75 H;  5EM2 B;  3I8C A;  4L3H D;  3CFS B;  5FKQ A;  4FA5 D;  3I7K A;  1PBY B;  3F3F A;  3MXX A;  3HFQ A;  3JB9 L;  1YFQ A;  5EMK B;  3EI3 A;  4FA4 D;  2I3S A;  4A11 B;  4ZOZ A;  4ERQ A;  4FAV D;  2P9S C;  4BUJ C;  3FM0 A;  2H9N A;  4CY1 A;  1ERJ A;  4J81 A;  4FA1 D;  2EBS A;  3DXK C;  4E54 A;  4LGN A;  3L4O D;  3JRO A;  5GXI A;  2P9N C;  5I5M A;  5IC7 A;  2G9A A;  4AEZ A;  4FAN D;  4PSX B;  2Q7Q A;  3KRW B;  2H14 A;  2H6N A;  4GQ1 A;  3EMH A;  2PBI B;  2H6Q A;  4I79 A;  4ERY A;  3SBP A;  3EI2 A;  4CI3 A;  5GXH A;  2P9P C;  1MDA H;  4J87 A;  4AOW A;  1GG2 B;  4E5Z A;  2OK4 A;  2CE9 A;  2AGZ A;  3AL8 A;  3PSC B;  3I7O A;  4H5J A;  4FA9 D;  2AGX A;  1TBG A;  3JAM g;  3SHF A;  2J55 H;  2HJB A;  3SWS D;  3SBR A;  3I8E A;  3MMY A;  2CO0 C;  3RRM C;  1U2V C;  2I3T A;  2YBA A;  4CY2 A;  4A0B B;  3C5M A;  4D0K A;  5B4W A;  2H68 A;  5IJ7 E;  3EI1 B;  5IGQ A;  4FB1 D;  4ES0 A;  2HES X;  4A09 A;  5GMK n;  4Y5R D;  3F3G A;  3N0E A;  3VH0 A;  4LG9 A;  3K27 A;  3EU7 A;  4X61 B;  2IUR A;  5FQD A;  3EG6 A;  3IIW A;  5SXM A;  5TEE A;  2BCJ B;  3NVX A;  4JSP C;  1XKS A;  3CFV A;  3DSM A;  4GM3 A;  1OMW B;  1NR0 A;  2AGL A;  3F3P A;  2P9L C;  4PBY A;  1JJU B;  4U7A A;  5EAP A;  5CYK A;  2AH1 A;  4OZU A;  1GOT B;  3MZL A;  2H9M A;  2UZX B;  3PXS D;  4CZV A;  4K3J B;  4LG8 A;  2PM9 B;  4L3G D;  1R5M A;  4CZY A;  3JRP A;  4JSX C;  3V5W B;  2GC7 A;  2TRC B;  1SQJ A;  1NEX B;  3J81 g;  3BG1 A;  4UI9 R;  2I0R A;  4GGA A;  4ZOY A;  2P9K C;  3DWL C;  3B7F A;  2HKR A;  2H47 A;  2W18 A;  3UVL A;  3GRE A;  5EAL A;  4E54 B;  4A2L A;  2IWK A;  4JT6 C;  2B5M A;  4O45 A;  3SJL D;  1GP2 B;  4X63 B;  3L4M D;  4J8B A;  1A0R B;  3ZWL B;  4YVD A;  2IUQ A;  5H17 A;  3SBQ A;  4NSX A;  3VGZ A;  2BBK H;  4ERZ A;  1QNI A;  5EAM A;  3I7H A;  1XIP A;  4QL1 A;  4FHL A;  2IUV A;  4EWR A;  2MTA H;  1SHY B;  3SVW D;  1N6D A;  2G99 A;  5EMJ B;  2XL2 A;  5AFU 3;  4JT5 C;  1B9X A;  3DXM C;  3OL2 A;  5JWZ A;  3IKO A;  1U4C A;  3OKY A;  3OTT A;  4R7A B;  2AH0 A;  4A0A B;  5THA A;  5HE2 B;  5CXC B;  3GFC A;  1FWX A;  3KRX B;  5C2V B;  4OWR A;  5IT9 g;  4GGC A;  2HXC A;  5EM2 A;  3EI4 B;  4PBZ A;  2CNX A;  3JPX A;  3PXW D;  5K1C C;  3EI1 A;  1GXR A;  4CI1 A;  4J8G A;  2PM6 B;  2J57 G;  1N6F A;  5EMM B;  1TYQ C;  5C2W B;  1JMX B;  2P9I C;  4XEI C;  2P9U C;  4J73 A;  2QXV A;  2AGY A;  3SMR A;  3J80 g;  4O3U B;  5I5J A;  4U1E I;  2YB8 B;  2CE8 A;  1MG3 A;  2H9L A;  4O1Q D;  4BL0 A;  5CXB B;  3FGB A;  4J82 A;  2H13 A;  2HYE A;  1K32 A;  3EI3 B;  3PVU B;  4A11 A;  4PC0 A;  3OKW A;  4JSN C;  4L1Q D;  1PGU A;  5FKS A;  2HJ4 A;  3RMZ D;  5AMS A;  1P22 A;  3UVO A;  1Q47 A;  3A0F A;  3PXT D;  5KDO B;  4J86 A;  2OIZ A;  3K26 A;  3JZN A;  2XYI A;  3U4Y A;  2H9P A;  4XYH A;  4H5I A;  2OK6 A;  3I89 A;  3AL8 B;  4GM8 A;  5K19 A;  4CZX A;  3EI2 B;  4JD2 C;  1S4U X;  3PE7 A;  4TZ4 A;  5HE3 B;  4QQE A;  5HYN B;  3P4F A;  3V7D B;  1XHM A;  3EWE A;  4E5Z B;  4J84 A;  3I7P A;  3PVW B;  4A08 A;  3ORV D;  5TF2 A;  5HE0 B;  1JOF A;  4A0B A;  3ULE C;  2I0S A;  3AFC A;  2IWF A;  3UVK A;  3I2N A;  3RSE C;  3I7L A;  5FLX g;  4Y7R A;  2Z2P A;  2B4E A;  2YNO A;  2IUP A;  2GNQ A;  2AQ5 A;  4IA9 A;  1RI6 A;  2Z2O A;  1N6E A;  2YNN A;  2YNP A;  3NVQ A;  4CI2 A;  2CN2 A;  3I7N A;  3SFZ A;  2CO0 A;  4ZN4 A;  2AGW A;  4IMM A;  3BG0 A;  4GQ2 P;  4BH6 A;  5TEF A;  2OJY A;  4JSV C;  3CIK B;  1SQ9 A;  3ODT A;  1JMZ B;  5HE1 B;  3SXT D;  2XU7 A;  3MKQ A;  3RLM D;  4GQB B;  4J0X A;  3VA6 A;  3BWS A;  1L0Q A;  4G56 B;  4O3T B;  3C99 A;  1PEV A;  1OLZ A;  5IJ8 E;  2PM7 B;  4J79 A;  3SN6 B;  5EAR A;  3AL9 A;  4JXM A;  5GSA A;  4HDJ A;  2B5L A;  3SCY A;  4CY5 A;  3MZK A;  3IJC A;  2OVQ B;  3UVM A;  2QC5 A;  5TDH B;  1VYH C;  5EML B;  3N0D A;  4GZ8 A;  4K3I D;  1K8K C;  3UR4 A;  1MG2 A;  4J77 A;  5IGO A;  3JZG A;  3UVN A;  2UZY B;  5CYK B;  3UKR C;  5C9Z B;  4PNK B;  4CI8 A;  3IIY A;  3W15 A;  4CC9 A;  4ZOV A;  5A2Q g;  4A7J A;  2XL3 A;  5AJA A;  4O9D A;  3E0C A;  4PSW B;  4QRJ A;  3RFH A;  3MKS B;  2PM9 A;  4KFM B;  2CN3 A;  2HKM A;  4L9O A;  2H3X A;  5CXB A;  3JZH A;  3RFG A;  4CY3 A;  4GM9 A;  5I5I A;  4PXW A;  3UKU C;  5FKT A;  2Z2N A;  4MK0 B;  2GC4 A;  5H1M A;  3PSL A;  4XYI A;  4J78 A;  5HQG A;  4N14 A;  1B9Y A;  3AH8 B;  4ZOX A;  2YMU A;  3OKT A;  3OW8 A;  3NVN A;  2B5N A;  4X60 B;  4FWW A; 
#chains in the Genus database with same CATH topology
 4X3E A;  5M5R A;  1H2Y A;  4ESG A;  4NEN A;  3V9F A;  3FRX A;  1L5G A;  3IJ0 A;  4WK2 A;  4G55 A;  4GGD A;  4MMZ A;  3SLE D;  4A0A A;  1PI6 A;  4A09 B;  3IJ1 A;  5FKR A;  5FA5 B;  4J0W A;  2I0T A;  3DM0 A;  1GOH A;  4GMB A;  3ZE0 A;  5FFG A;  4A08 B;  3OL2 B;  5H14 A;  4UM9 A;  3EI4 A;  4Z8L A;  2O9K A;  3RN1 D;  2J56 H;  2IAA A;  4QT8 A;  3OKY B;  2H6K A;  2OVP B;  4A2M A;  5CXC A;  3C9C A;  3RN0 D;  2VZ1 A;  4L1M A;  4NBM A;  5FXY A;  4D6V A;  2OVR B;  2VDR A;  3C75 H;  5EM2 B;  3I8C A;  4L3H D;  3CFS B;  1M1X A;  5FKQ A;  4FA5 D;  3I7K A;  1PBY B;  3F3F A;  2VZ3 A;  3O4J A;  3MXX A;  3HFQ A;  1H2X A;  3JB9 L;  1YFQ A;  2QR5 A;  1C9I A;  5EMK B;  4O2W A;  3EI3 A;  4FA4 D;  2I3S A;  4A11 B;  4ZOZ A;  4ERQ A;  4FAV D;  2P9S C;  4BUJ C;  3FM0 A;  5M5U A;  2H9N A;  4CY1 A;  1H2W A;  1ERJ A;  2EID A;  4J81 A;  4FA1 D;  1TYE A;  2EBS A;  3DXK C;  4E54 A;  4LGN A;  3L4O D;  3JRO A;  5GXI A;  2VDP A;  2P9N C;  5I5M A;  5IC7 A;  2G9A A;  4AEZ A;  4FAN D;  4PSX B;  2Q7Q A;  3KRW B;  2H14 A;  2H6N A;  4GQ1 A;  3EMH A;  2PBI B;  2VDQ A;  2H6Q A;  4I79 A;  4ERY A;  3SBP A;  3EI2 A;  4CI3 A;  5GXH A;  2P9P C;  1MDA H;  4J87 A;  3O4I A;  3MVD K;  4AOW A;  1GG2 B;  4E5Z A;  2OK4 A;  2VDN A;  2CE9 A;  2AGZ A;  3AL8 A;  3PSC B;  3I7O A;  4H5J A;  4FA9 D;  2AGX A;  1TBG A;  4Z7N A;  3JAM g;  3SHF A;  2J55 H;  2HJB A;  3SWS D;  3SBR A;  3I8E A;  1O6F A;  3MMY A;  2CO0 C;  3RRM C;  1U2V C;  2I3T A;  2YBA A;  2QZP A;  4CY2 A;  4A0B B;  2VC2 A;  3C5M A;  3FCU A;  4D0K A;  5B4W A;  4BCC A;  2H68 A;  4WK4 A;  5IJ7 E;  3EI1 B;  2VDK A;  1GOG A;  4UM8 A;  5IGQ A;  4DNV A;  4FB1 D;  4ES0 A;  2HES X;  2EIB A;  1K3I A;  2EIE A;  4A09 A;  5GMK n;  4Y5R D;  3F3G A;  3N0E A;  3VH0 A;  4LG9 A;  3K27 A;  3EU7 A;  4X61 B;  2IUR A;  5FQD A;  3EG6 A;  3IIW A;  5C92 A;  5SXM A;  3EQ7 A;  5TEE A;  2BCJ B;  3NVX A;  4IRZ A;  1XKS A;  3CFV A;  4JSP C;  3DSM A;  3GC3 B;  5C86 A;  1UOO A;  4GM3 A;  1OMW B;  1NR0 A;  2AGL A;  3F3P A;  1QFM A;  2P9L C;  4PBY A;  1JJU B;  4U7A A;  5HDB A;  5EAP A;  5CYK A;  2AH1 A;  4OZU A;  1GOT B;  3MZL A;  2H9M A;  2UZX B;  3PXS D;  4CZV A;  4QAM A;  4K3J B;  3NIG A;  4LG8 A;  4BCD A;  2PM9 B;  1JV2 A;  1VE7 A;  4L3G D;  1E8N A;  1R5M A;  4CZY A;  1O6G A;  1U8C A;  3JRP A;  4JSX C;  3V5W B;  4AX4 A;  2GC7 A;  2TRC B;  1SQJ A;  1NEX B;  3J81 g;  3EQ8 A;  3BG1 A;  4UI9 R;  2I0R A;  4GGA A;  4ZOY A;  4BP8 A;  2P9K C;  3MUO A;  3ZDZ A;  4DNW A;  3DWL C;  1E8M A;  2VDO A;  3B7F A;  3ZE1 A;  2HKR A;  2H47 A;  3IVM A;  3O4H A;  2W18 A;  3UVL A;  3GRE A;  5EAL A;  1UTC A;  4E54 B;  4A2L A;  2IWK A;  4JT6 C;  2B5M A;  4O45 A;  3K6S A;  3SJL D;  1GP2 B;  4X63 B;  3L4M D;  4J8B A;  1A0R B;  3ZWL B;  4YVD A;  2IUQ A;  5H17 A;  4MMX A;  4NSX A;  3SBQ A;  3EQ9 A;  3VGZ A;  2BBK H;  4ERZ A;  1QNI A;  5EAM A;  3I7H A;  1XIP A;  4QL1 A;  3IUR A;  4FHL A;  3QHY B;  2IUV A;  4EWR A;  2MTA H;  1SHY B;  3V4V A;  3SVW D;  1N6D A;  2G99 A;  5EMJ B;  2XL2 A;  5FFO A;  5AFU 3;  4JT5 C;  1B9X A;  3DXM C;  3OL2 A;  4BCB A;  5JWZ A;  2XE4 A;  3IKO A;  3ZE2 A;  2EIC A;  1U4C A;  3OKY A;  3OTT A;  4R7A B;  2AH0 A;  4A0A B;  2VDL A;  5THA A;  5HE2 B;  5CXC B;  4WK0 A;  3GFC A;  5E6S A;  1FWX A;  3KRX B;  5C2V B;  4OWR A;  5IT9 g;  4GGC A;  2HXC A;  5EM2 A;  2HU7 A;  3EI4 B;  4PBZ A;  2CNX A;  1VZ3 A;  3JPX A;  3PXW D;  3T3P A;  5K1C C;  3EI1 A;  1GXR A;  3T3M A;  4CI1 A;  4MMY A;  3IUM A;  4J8G A;  3V4P A;  2PM6 B;  2J57 G;  1N6F A;  5EMM B;  1TYQ C;  5C2W B;  1JMX B;  2P9I C;  3MUN A;  4G1M A;  4JHP C;  4XEI C;  2P9U C;  4J73 A;  2QXV A;  2AGY A;  3SMR A;  4AMZ A;  3J80 g;  4O3U B;  5I5J A;  4U1E I;  1C9L A;  2YB8 B;  2CE8 A;  1MG3 A;  2H9L A;  4O1Q D;  4BL0 A;  4WJK A;  5CXB B;  3FGB A;  4J82 A;  2H13 A;  2HYE A;  1K32 A;  3EI3 B;  3PVU B;  1UOQ A;  3QI0 A;  4A11 A;  4PC0 A;  3OKW A;  4JSN C;  4L1Q D;  1PGU A;  3DDU A;  5FKS A;  2HJ4 A;  3RMZ D;  5AMS A;  1P22 A;  3UVO A;  1Q47 A;  3A0F A;  3PXT D;  5KDO B;  4J86 A;  1JTD B;  2OIZ A;  3K26 A;  5M5S A;  3JZN A;  2XYI A;  3U4Y A;  4Z7O A;  1UOP A;  3NID A;  1T2X A;  3IUN A;  5E6U A;  3OF7 A;  2H9P A;  4XYH A;  4H5I A;  2OK6 A;  3I89 A;  3AL8 B;  4GM8 A;  5M5T A;  5K19 A;  1VE6 A;  4CZX A;  3EI2 B;  4JD2 C;  1S4U X;  3PE7 A;  4TZ4 A;  4Z7Q A;  5HE3 B;  4QQE A;  5HYN B;  1BPO A;  3P4F A;  4DNU A;  3V7D B;  1XHM A;  3EWE A;  4E5Z B;  3IUQ A;  4J84 A;  3I7P A;  3PVW B;  4A08 A;  3ORV D;  5TF2 A;  1GOF A;  4AN0 A;  5HE0 B;  1JOF A;  4NC4 A;  1VZ2 A;  4A0B A;  5M61 A;  3ULE C;  3IJE A;  2I0S A;  4AN1 A;  3AFC A;  2IWF A;  3UVK A;  3I2N A;  3RSE C;  3I7L A;  5FLX g;  4AMY A;  4Y7R A;  4JHN A;  2Z2P A;  2B4E A;  2YNO A;  2IUP A;  2GNQ A;  2AQ5 A;  4IA9 A;  1RI6 A;  2Z2O A;  1N6E A;  2YNN A;  2YNP A;  3NVQ A;  4CI2 A;  2CN2 A;  3I7N A;  3SFZ A;  1YR2 A;  2CO0 A;  4BP9 A;  4ZN4 A;  2AGW A;  4IMM A;  3BG0 A;  4GQ2 P;  4BH6 A;  5TEF A;  2OJY A;  3FCS A;  3CIK B;  4JSV C;  3O4G A;  1SQ9 A;  2HU5 A;  1JMZ B;  3ODT A;  4RE6 A;  2VDM A;  5HE1 B;  3SXT D;  2XU7 A;  3MKQ A;  3RLM D;  4GQB B;  4J0X A;  3VA6 A;  3BWS A;  1L0Q A;  4G56 B;  4O3T B;  3C99 A;  1PEV A;  3GD1 I;  1QFS A;  1OLZ A;  5IJ8 E;  2PM7 B;  4J79 A;  3SN6 B;  5EAR A;  3AL9 A;  4JXM A;  5GSA A;  4HDJ A;  4RE5 A;  2B5L A;  3NIF A;  3SCY A;  2XZG A;  4CY5 A;  3MZK A;  3IJC A;  2OVQ B;  3UVM A;  2QC5 A;  5TDH B;  1VYH C;  5EML B;  3N0D A;  4GZ8 A;  4K3I D;  4NAA A;  1K8K C;  3UR4 A;  1MG2 A;  4D9S A;  1A12 A;  4J77 A;  5IGO A;  3K72 A;  3JZG A;  3UVN A;  2UZY B;  5CYK B;  3UKR C;  2WQ8 A;  5C9Z B;  4PNK B;  4CI8 A;  3VI4 A;  3IIY A;  3W15 A;  4CC9 A;  4ZOV A;  5A2Q g;  4A7J A;  2XL3 A;  5AJA A;  3ZDY A;  4O9D A;  3E0C A;  4PSW B;  4QRJ A;  3RFH A;  4O02 A;  3MKS B;  2PM9 A;  4KFM B;  2CN3 A;  2HKM A;  2XDW A;  4L9O A;  3VI3 A;  2H3X A;  3KCI A;  5CXB A;  3JZH A;  3RFG A;  4CY3 A;  4GM9 A;  4G1E A;  5I5I A;  4PXW A;  2BKL A;  3UKU C;  3K71 A;  5FKT A;  2Z2N A;  3IUL A;  4MK0 B;  2GC4 A;  5H1M A;  3ZDX A;  5E6R A;  2HU8 A;  3PSL A;  4XYI A;  4J78 A;  1H2Z A;  2JKX A;  5HQG A;  1E5T A;  4N14 A;  1B9Y A;  3AH8 B;  4ZOX A;  2YMU A;  1I2M B;  3OKT A;  3IUJ A;  3OW8 A;  3NVN A;  2B5N A;  5M5V A;  4X60 B;  4FWW A; 
#chains in the Genus database with same CATH homology
 4X3E A;  4ESG A;  3V9F A;  3FRX A;  3IJ0 A;  4GGD A;  3SLE D;  4A0A A;  1PI6 A;  4A09 B;  3IJ1 A;  5FKR A;  5FA5 B;  4J0W A;  2I0T A;  3DM0 A;  4GMB A;  4A08 B;  3OL2 B;  5H14 A;  3EI4 A;  4Z8L A;  2O9K A;  3RN1 D;  2J56 H;  2IAA A;  4QT8 A;  3OKY B;  2H6K A;  2OVP B;  4A2M A;  5CXC A;  3C9C A;  3RN0 D;  5FXY A;  4D6V A;  2OVR B;  3C75 H;  5EM2 B;  3I8C A;  4L3H D;  3CFS B;  5FKQ A;  4FA5 D;  3I7K A;  1PBY B;  3F3F A;  3MXX A;  3HFQ A;  3JB9 L;  1YFQ A;  5EMK B;  3EI3 A;  4FA4 D;  2I3S A;  4A11 B;  4ZOZ A;  4ERQ A;  4FAV D;  2P9S C;  4BUJ C;  3FM0 A;  2H9N A;  4CY1 A;  1ERJ A;  4J81 A;  4FA1 D;  2EBS A;  3DXK C;  4E54 A;  4LGN A;  3L4O D;  3JRO A;  5GXI A;  2P9N C;  5I5M A;  5IC7 A;  2G9A A;  4AEZ A;  4FAN D;  4PSX B;  2Q7Q A;  3KRW B;  2H14 A;  2H6N A;  4GQ1 A;  3EMH A;  2PBI B;  2H6Q A;  4I79 A;  4ERY A;  3SBP A;  3EI2 A;  4CI3 A;  5GXH A;  2P9P C;  1MDA H;  4J87 A;  4AOW A;  1GG2 B;  4E5Z A;  2OK4 A;  2CE9 A;  2AGZ A;  3AL8 A;  3PSC B;  3I7O A;  4H5J A;  4FA9 D;  2AGX A;  1TBG A;  3JAM g;  3SHF A;  2J55 H;  2HJB A;  3SWS D;  3SBR A;  3I8E A;  3MMY A;  2CO0 C;  3RRM C;  1U2V C;  2I3T A;  2YBA A;  4CY2 A;  4A0B B;  3C5M A;  4D0K A;  5B4W A;  2H68 A;  5IJ7 E;  3EI1 B;  5IGQ A;  4FB1 D;  4ES0 A;  2HES X;  4A09 A;  5GMK n;  4Y5R D;  3F3G A;  3N0E A;  3VH0 A;  4LG9 A;  3K27 A;  3EU7 A;  4X61 B;  2IUR A;  5FQD A;  3EG6 A;  3IIW A;  5SXM A;  5TEE A;  2BCJ B;  3NVX A;  4JSP C;  1XKS A;  3CFV A;  3DSM A;  4GM3 A;  1OMW B;  1NR0 A;  2AGL A;  3F3P A;  2P9L C;  4PBY A;  1JJU B;  4U7A A;  5EAP A;  5CYK A;  2AH1 A;  4OZU A;  1GOT B;  3MZL A;  2H9M A;  2UZX B;  3PXS D;  4CZV A;  4K3J B;  4LG8 A;  2PM9 B;  4L3G D;  1R5M A;  4CZY A;  3JRP A;  4JSX C;  3V5W B;  2GC7 A;  2TRC B;  1SQJ A;  1NEX B;  3J81 g;  3BG1 A;  4UI9 R;  2I0R A;  4GGA A;  4ZOY A;  2P9K C;  3DWL C;  3B7F A;  2HKR A;  2H47 A;  2W18 A;  3UVL A;  3GRE A;  5EAL A;  4E54 B;  4A2L A;  2IWK A;  4JT6 C;  2B5M A;  4O45 A;  3SJL D;  1GP2 B;  4X63 B;  3L4M D;  4J8B A;  1A0R B;  3ZWL B;  4YVD A;  2IUQ A;  5H17 A;  3SBQ A;  4NSX A;  3VGZ A;  2BBK H;  4ERZ A;  1QNI A;  5EAM A;  3I7H A;  1XIP A;  4QL1 A;  4FHL A;  2IUV A;  4EWR A;  2MTA H;  1SHY B;  3SVW D;  1N6D A;  2G99 A;  5EMJ B;  2XL2 A;  5AFU 3;  4JT5 C;  1B9X A;  3DXM C;  3OL2 A;  5JWZ A;  3IKO A;  1U4C A;  3OKY A;  3OTT A;  4R7A B;  2AH0 A;  4A0A B;  5THA A;  5HE2 B;  5CXC B;  3GFC A;  1FWX A;  3KRX B;  5C2V B;  4OWR A;  5IT9 g;  4GGC A;  2HXC A;  5EM2 A;  3EI4 B;  4PBZ A;  2CNX A;  3JPX A;  3PXW D;  5K1C C;  3EI1 A;  1GXR A;  4CI1 A;  4J8G A;  2PM6 B;  2J57 G;  1N6F A;  5EMM B;  1TYQ C;  5C2W B;  1JMX B;  2P9I C;  4XEI C;  2P9U C;  4J73 A;  2QXV A;  2AGY A;  3SMR A;  3J80 g;  4O3U B;  5I5J A;  4U1E I;  2YB8 B;  2CE8 A;  1MG3 A;  2H9L A;  4O1Q D;  4BL0 A;  5CXB B;  3FGB A;  4J82 A;  2H13 A;  2HYE A;  1K32 A;  3EI3 B;  3PVU B;  4A11 A;  4PC0 A;  3OKW A;  4JSN C;  4L1Q D;  1PGU A;  5FKS A;  2HJ4 A;  3RMZ D;  5AMS A;  1P22 A;  3UVO A;  1Q47 A;  3A0F A;  3PXT D;  5KDO B;  4J86 A;  2OIZ A;  3K26 A;  3JZN A;  2XYI A;  3U4Y A;  2H9P A;  4XYH A;  4H5I A;  2OK6 A;  3I89 A;  3AL8 B;  4GM8 A;  5K19 A;  4CZX A;  3EI2 B;  4JD2 C;  1S4U X;  3PE7 A;  4TZ4 A;  5HE3 B;  4QQE A;  5HYN B;  3P4F A;  3V7D B;  1XHM A;  3EWE A;  4E5Z B;  4J84 A;  3I7P A;  3PVW B;  4A08 A;  3ORV D;  5TF2 A;  5HE0 B;  1JOF A;  4A0B A;  3ULE C;  2I0S A;  3AFC A;  2IWF A;  3UVK A;  3I2N A;  3RSE C;  3I7L A;  5FLX g;  4Y7R A;  2Z2P A;  2B4E A;  2YNO A;  2IUP A;  2GNQ A;  2AQ5 A;  4IA9 A;  1RI6 A;  2Z2O A;  1N6E A;  2YNN A;  2YNP A;  3NVQ A;  4CI2 A;  2CN2 A;  3I7N A;  3SFZ A;  2CO0 A;  4ZN4 A;  2AGW A;  4IMM A;  3BG0 A;  4GQ2 P;  4BH6 A;  5TEF A;  2OJY A;  4JSV C;  3CIK B;  1SQ9 A;  3ODT A;  1JMZ B;  5HE1 B;  3SXT D;  2XU7 A;  3MKQ A;  3RLM D;  4GQB B;  4J0X A;  3VA6 A;  3BWS A;  1L0Q A;  4G56 B;  4O3T B;  3C99 A;  1PEV A;  1OLZ A;  5IJ8 E;  2PM7 B;  4J79 A;  3SN6 B;  5EAR A;  3AL9 A;  4JXM A;  5GSA A;  4HDJ A;  2B5L A;  3SCY A;  4CY5 A;  3MZK A;  3IJC A;  2OVQ B;  3UVM A;  2QC5 A;  5TDH B;  1VYH C;  5EML B;  3N0D A;  4GZ8 A;  4K3I D;  1K8K C;  3UR4 A;  1MG2 A;  4J77 A;  5IGO A;  3JZG A;  3UVN A;  2UZY B;  5CYK B;  3UKR C;  5C9Z B;  4PNK B;  4CI8 A;  3IIY A;  3W15 A;  4CC9 A;  4ZOV A;  5A2Q g;  4A7J A;  2XL3 A;  5AJA A;  4O9D A;  3E0C A;  4PSW B;  4QRJ A;  3RFH A;  3MKS B;  2PM9 A;  4KFM B;  2CN3 A;  2HKM A;  4L9O A;  2H3X A;  5CXB A;  3JZH A;  3RFG A;  4CY3 A;  4GM9 A;  5I5I A;  4PXW A;  3UKU C;  5FKT A;  2Z2N A;  4MK0 B;  2GC4 A;  5H1M A;  3PSL A;  4XYI A;  4J78 A;  5HQG A;  4N14 A;  1B9Y A;  3AH8 B;  4ZOX A;  2YMU A;  3OKT A;  3OW8 A;  3NVN A;  2B5N A;  4X60 B;  4FWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...