4GQBB

Crystal structure of the human prmt5:mep50 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
309
structure length
303
Chain Sequence
PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
publication title Crystal structure of the human PRMT5:MEP50 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 303
sequence length 309
ec nomenclature
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gqbB00
4D0KA 4BL0A 4Y7RA 2HKMA 3UVKA 2OVQB 1GOTB 3I8CA 4N14A 4XYHA 4O3UB 3DXMC 2AGWA 3JROA 4A7JA 3PSLA 2B5LA 2YMUA 2IUVA 2HJBA 3OKWA 2J57G 3SMRA 3IIWA 3JRPA 5B4WA 3P4FA 2AQ5A 5EAMA 2XL2A 3SJLD 2H6KA 1MG3A 5CXCB 1SQ9A 1K32A 5C2WB 4ZOYA 2TRCB 3MMYA 4PBZA 3CFSB 2W18A 4A11B 1N6FA 4PSWB 2PM9B 3EI1A 5THAA 4A2MA 1B9XA 1GXRA 4R7AB 4OWRA 3RSEC 2HYEA 3RN1D 3JB9L 4JD2C 4QT8A 2HJ4A 4MK0B 3BWSA 3OTTA 2AH0A 4ERQA 3I2NA 2CE9A 4IA9A 4J0WA 1FWXA 3OKYB 2I3SA 3MKQA 3C5MA 4ZN4A 3I7PA 3IJCA 2H9LA 3OKTA 4GZ8A 3N0EA 4J87A 3L4MD 3SXTD 5EMKB 4D6VA 4A08A 2P9SC 2MTAH 4LG8A 5TDHB 4CY5A 1U4CA 2I0SA 4PC0A 3AL8B 1TYQC 3EI3B 3NVNA 3VA6A 5CXCA 4X60B 4UI9R 4ESGA 3FM0A 2Z2NA 4A11A 5FKQA 3RRMC 3FRXA 3PSCB 4GMBA 3JZHA 1U2VC 4AOWA 2G99A 3MZLA 4CI1A 5C9ZB 4GM8A 4PXWA 2P9LC 3W15A 4U7AA 5JWZA 5TEFA 4BUJC 2P9UC 4G56B 2XL3A 4JT6C 3DM0A 4U1EI 3EMHA 3N0DA 4Z8LA 4H5JA 4I79A 5SXMA 4ES0A 3V9FA 5IGQA 5TF2A 3B7FA 5IJ7E 3HFQA 2IUQA 3E0CA 2AH1A 4ERYA 4K3ID 3UVOA 3AL8A 3EI3A 4CI8A 3PXWD 2OJYA 4A0BA 3FGBA 4FHLA 2YNNA 2O9KA 4A08B 2AGXA 3K27A 3IKOA 3GREA 4K3JB 4CZVA 4O3TB 2H9NA 4A0AB 5CYKB 3SCYA 3AL9A 5I5JA 3MZKA 4J79A 3I89A 4Y5RD 3KRXB 2P9NC 2YNOA 1Q47A 3F3FA 4FB1D 2OK6A 2GC7A 3C75H 5CXBA 1XKSA 2IUPA 3JAMg 3C9CA 3RMZD 4QRJA 2P9KC 4J86A 3EWEA 4J8BA 2G9AA 1MDAH 2I3TA 3OL2B 3SBPA 4CC9A 3I8EA 4FA1D 2YB8B 3PE7A 4J82A 5IC7A 2BCJB 4L3GD 2H47A 3AH8B 3K26A 4GM9A 2HESX 2UZYB 4GQ2P 5I5IA 3UKUC 3PVWB 1NEXB 5C2VB 2AGYA 3J81g 5IGOA 5EMJB 5GMKn 3UR4A 2H6NA 5GXIA 5HQGA 4A0AA 4FAVD 5CYKA 4J8GA 5EMMB 3EG6A 5HE0B 4GQBB 4A2LA 2PBIB 1OMWB 4A0BB 3F3PA 4J78A 2H6QA 4CI3A 5I5MA 3RN0D 4JSXC 3SLED 4GGAA 3I7KA 1OLZA 4GGDA 3VH0A 3MKSB 4OZUA 4ZOZA 1N6DA 4FAND 3SVWD 1S4UX 3NVQA 4HDJA 2IWKA 5FKTA 3ODTA 3OL2A 3SHFA 1PBYB 3BG1A 5AMSA 4FA5D 5A2Qg 5K19A 2HXCA 2CN2A 2IURA 3MXXA 1JJUB 2GNQA 5AJAA 2I0TA 5CXBB 2QC5A 4QL1A 2PM6B 4EWRA 5EM2A 2H68A 1L0QA 4KFMB 2Q7QA 3CIKB 4A09A 2IAAA 1JOFA 3I7LA 4ERZA 3RFGA 1XIPA 3JZGA 4E54B 2CN3A 1YFQA 2P9IC 3EI2A 2XU7A 3PXSD 5FQDA 2J56H 2OVPB 3ULEC 1NR0A 5HE3B 3UVMA 4X61B 4ZOXA 2CE8A 4LG9A 3GFCA 1R5MA 2AGZA 3KRWB 1N6EA 1K8KC 5FKRA 3UKRC 1GP2B 2YBAA 5GSAA 4CY3A 3A0FA 4NSXA 4QQEA 4X63B 4L1QD 3SN6B 4PSXB 2CNXA 3U4YA 3EU7A 4XYIA 3DWLC 3ORVD 4H5IA 1PEVA 2BBKH 2OVRB 4J0XA 3I7NA 2CO0C 3SFZA 4JSVC 1JMZB 3UVNA 3IJ0A 2OK4A 1XHMA 4O1QD 4YVDA 3SBQA 2PM7B 4E54A 1SQJA 1JMXB 2I0RA 3PVUB 4LGNA 3ZWLB 2B5NA 2AGLA 2H14A 5IT9g 5FKSA 3RLMD 5AFU3 4JSPC 3NVXA 3RFHA 5EM2B 4PBYA 2H3XA 4J84A 5GXHA 4IMMA 5KDOB 4A09B 1A0RB 5K1CC 2H9PA 2H9MA 5H17A 5FA5B 3DSMA 4GM3A 1P22A 4FA9D 3PXTD 3EI2B 3JZNA 2GC4A 3OW8A 3C99A 4L9OA 1SHYB 5HE1B 4TZ4A 1PGUA 4E5ZB 3EI4B 4CI2A 5TEEA 4J73A 3V7DB 3L4OD 5H1MA 1GG2B 5EALA 1MG2A 3JPXA 2IWFA 3I7OA 5H14A 1QNIA 4O45A 2UZXB 5IJ8E 3VGZA 5EARA 1RI6A 4FWWA 5EMLB 2OIZA 4J77A 1VYHC 2Z2PA 4PNKB 2PM9A 5EAPA 2YNPA 3IJ1A 3I7HA 2QXVA 1B9YA 4AEZA 3J80g 4JT5C 4JXMA 3SWSD 4XEIC 3BG0A 4ZOVA 2HKRA 3SBRA 3V5WB 2XYIA 2J55H 5HYNB 4CY2A 2H13A 4CZYA 4J81A 4O9DA 5FLXg 5FXYA 3AFCA 4X3EA 3F3GA 4L3HD 3OKYA 4JSNC 2B5MA 2EBSA 4GGCA 2CO0A 2Z2OA 1TBGA 2P9PC 4CY1A 3EI1B 1ERJA 5HE2B 4E5ZA 3DXKC 3EI4A 3UVLA 3CFVA 1PI6A 4GQ1A 2B4EA 3IIYA 4FA4D 4CZXA 4BH6A
chains in the Genus database with same CATH superfamily
4D0KA 4BL0A 4Y7RA 2HKMA 3UVKA 2OVQB 2QR5A 1GOTB 1K3IA 3I8CA 4N14A 4XYHA 4O3UB 3DXMC 2AGWA 1VE7A 3JROA 3NIFA 3IVMA 1JV2A 4A7JA 3PSLA 2VDLA 2B5LA 2YMUA 2IUVA 4AX4A 4O2WA 2HJBA 3OKWA 2EIEA 3GD1I 2J57G 3SMRA 3IIWA 3JRPA 4NENA 5FFGA 3P4FA 5B4WA 2AQ5A 5EAMA 2XL2A 3SJLD 2H6KA 1MG3A 5CXCB 4D9SA 1SQ9A 1K32A 5C2WB 4ZOYA 2TRCB 3MMYA 4PBZA 3CFSB 2W18A 2HU5A 4A11B 1N6FA 4PSWB 2PM9B 3EI1A 5THAA 4A2MA 1B9XA 1GXRA 1GOFA 4R7AB 4OWRA 3RSEC 2HYEA 3RN1D 3JB9L 4G1MA 5M61A 4JD2C 4QT8A 2HJ4A 4MK0B 1C9IA 3BWSA 3OTTA 2AH0A 4ERQA 3I2NA 2CE9A 4IA9A 4J0WA 1FWXA 3OKYB 3ZE2A 2I3SA 3MKQA 3C5MA 4ZN4A 3GC3B 3I7PA 3IJCA 5E6RA 2H9LA 3OKTA 4GZ8A 3N0EA 4J87A 3L4MD 3SXTD 5EMKB 4AN0A 4D6VA 3V4PA 3K71A 4A08A 2EICA 1UOPA 1T2XA 2P9SC 4WK0A 2MTAH 4LG8A 5TDHB 1QFMA 4CY5A 1U4CA 2I0SA 4PC0A 3AL8B 1TYQC 3EI3B 3NVNA 3VA6A 5CXCA 5M5VA 4X60B 1QFSA 4UI9R 4ESGA 3FM0A 2Z2NA 4A11A 5FKQA 3RRMC 3FRXA 3PSCB 4GMBA 3EQ9A 3JZHA 1U2VC 4AOWA 2G99A 3MZLA 4CI1A 2VDPA 5C9ZB 4GM8A 4PXWA 2P9LC 3W15A 2VDMA 4U7AA 5JWZA 2XE4A 3QHYB 5TEFA 4BUJC 2P9UC 4G56B 2XL3A 4JT6C 3DM0A 4U1EI 3EMHA 3T3PA 3N0DA 4Z8LA 4H5JA 4I79A 5SXMA 4ES0A 4G55A 3V9FA 5IGQA 5TF2A 3B7FA 2BKLA 5IJ7E 3HFQA 2IUQA 4RE6A 3E0CA 2AH1A 4ERYA 4K3ID 3UVOA 2VZ1A 3ZE0A 3AL8A 3EI3A 4CI8A 3PXWD 2OJYA 2VDRA 4A0BA 4MMYA 3FGBA 4BCDA 4FHLA 2YNNA 3VI4A 5FFOA 1U8CA 2O9KA 4A08B 2AGXA 3K27A 3IKOA 3GREA 4K3JB 4CZVA 4O3TB 2H9NA 4A0AB 5CYKB 3SCYA 3AL9A 5I5JA 3MZKA 4J79A 3I89A 4Y5RD 3KRXB 3T3MA 2P9NC 2YNOA 1E5TA 1Q47A 3F3FA 4FB1D 4O02A 2OK6A 2GC7A 3C75H 5CXBA 4UM8A 1XKSA 2IUPA 3JAMg 3O4IA 3C9CA 3RMZD 4QRJA 2P9KC 2WQ8A 4J86A 3EWEA 4RE5A 4DNVA 4WK4A 4J8BA 3OF7A 2EIDA 2G9AA 1MDAH 2I3TA 3K6SA 1GOGA 3OL2B 3SBPA 4CC9A 4AMYA 3ZE1A 4NBMA 4DNUA 1M1XA 3I8EA 4FA1D 5E6SA 3IJEA 2YB8B 1L5GA 2VZ3A 3PE7A 4J82A 5IC7A 2BCJB 4L3GD 2H47A 3AH8B 1I2MB 3K26A 4GM9A 2HESX 2UZYB 4GQ2P 5I5IA 3UKUC 3PVWB 1NEXB 5C2VB 2AGYA 3J81g 1H2WA 5IGOA 5EMJB 5GMKn 3UR4A 2H6NA 5GXIA 5HQGA 4A0AA 4FAVD 5CYKA 4J8GA 5EMMB 3EG6A 5HE0B 2HU7A 4GQBB 4A2LA 1GOHA 2PBIB 1OMWB 4A0BB 4BCCA 4BP8A 4QAMA 3F3PA 4J78A 2H6QA 4CI3A 5I5MA 3RN0D 4JSXC 3IUMA 3SLED 4GGAA 3I7KA 1OLZA 4G1EA 4GGDA 3VH0A 3MKSB 4OZUA 3EQ7A 4ZOZA 1N6DA 4UM9A 4FAND 3SVWD 1S4UX 3NVQA 4HDJA 2IWKA 3MVDK 3O4JA 3FCUA 5FKTA 3ODTA 3O4GA 3OL2A 3SHFA 1PBYB 3BG1A 2VDQA 2XDWA 5AMSA 4FA5D 5A2Qg 5K19A 2HXCA 1O6GA 2CN2A 2IURA 3MXXA 1JJUB 2GNQA 5AJAA 2I0TA 5CXBB 2QC5A 4QL1A 2PM6B 4EWRA 5EM2A 2H68A 1L0QA 4KFMB 2Q7QA 3CIKB 4A09A 2IAAA 3ZDZA 1JOFA 2EIBA 3I7LA 4ERZA 3RFGA 1XIPA 3JZGA 4E54B 2CN3A 3K72A 1YFQA 2P9IC 4AN1A 3EI2A 1E8MA 2XU7A 1UOQA 3PXSD 5FQDA 2J56H 2OVPB 3ULEC 4MMXA 1NR0A 5HE3B 5M5UA 3UVMA 5M5RA 4X61B 5M5TA 4ZOXA 2CE8A 3NIDA 4LG9A 3GFCA 1R5MA 2AGZA 4NAAA 3KRWB 1N6EA 4NC4A 1K8KC 4Z7QA 5FKRA 3UKRC 1VE6A 1GP2B 2YBAA 5GSAA 4JHNA 4CY3A 3A0FA 3MUNA 4NSXA 4QQEA 4X63B 4L1QD 3SN6B 4PSXB 2CNXA 4BP9A 3KCIA 3U4YA 1O6FA 3EU7A 4XYIA 3QI0A 3ZDXA 5M5SA 3DWLC 3ORVD 3FCSA 4H5IA 4L1MA 1PEVA 2BBKH 2OVRB 4J0XA 4IRZA 3I7NA 3IURA 2CO0C 3SFZA 4JSVC 1JMZB 3IUQA 1C9LA 3UVNA 1UTCA 3IJ0A 2OK4A 1XHMA 4O1QD 4YVDA 3SBQA 2PM7B 4E54A 2HU8A 3IUNA 5C92A 1SQJA 4DNWA 1JMXB 2I0RA 3PVUB 4LGNA 3ZWLB 2B5NA 2AGLA 2H14A 5IT9g 5FKSA 3RLMD 5AFU3 4JSPC 3ZDYA 3NVXA 3RFHA 5EM2B 4PBYA 2H3XA 1YR2A 4J84A 5GXHA 1UOOA 4Z7OA 4IMMA 5KDOB 5C86A 3VI3A 4A09B 1A0RB 1H2ZA 3IULA 5K1CC 4Z7NA 3V4VA 2H9PA 2H9MA 3IUJA 5H17A 5FA5B 3DSMA 4GM3A 1P22A 4FA9D 3PXTD 3EI2B 2XZGA 3JZNA 1JTDB 2GC4A 3OW8A 3C99A 3EQ8A 4L9OA 1SHYB 5E6UA 5HE1B 4BCBA 4WJKA 4TZ4A 1PGUA 2VDNA 3EI4B 4E5ZB 4CI2A 5TEEA 3NIGA 4J73A 1A12A 3V7DB 4AMZA 3L4OD 5H1MA 3O4HA 1GG2B 5EALA 1MG2A 3JPXA 2IWFA 3I7OA 5H14A 3DDUA 1QNIA 4O45A 2UZXB 5IJ8E 3VGZA 2VC2A 5EARA 1RI6A 2VDKA 1VZ3A 4FWWA 5EMLB 1H2YA 2OIZA 4J77A 1VYHC 2Z2PA 4PNKB 2PM9A 5EAPA 2YNPA 3MUOA 1E8NA 3IJ1A 3I7HA 2QXVA 1B9YA 4JHPC 4AEZA 3J80g 4JT5C 4JXMA 3SWSD 2VDOA 4XEIC 3BG0A 4ZOVA 2HKRA 3SBRA 3V5WB 2XYIA 2J55H 1TYEA 5HYNB 4CY2A 2H13A 1BPOA 4CZYA 4J81A 4O9DA 5FLXg 5FXYA 3AFCA 4X3EA 3F3GA 4L3HD 3OKYA 4JSNC 2B5MA 2EBSA 2QZPA 4GGCA 2CO0A 2Z2OA 1TBGA 2P9PC 4CY1A 3EI1B 1ERJA 5HE2B 4WK2A 4E5ZA 3DXKC 3EI4A 3UVLA 4MMZA 1H2XA 3CFVA 1PI6A 4GQ1A 2B4EA 3IIYA 2JKXA 4FA4D 4CZXA 4BH6A 5HDBA 1VZ2A
chains in the Genus database with same CATH topology
4D0KA 4BL0A 4Y7RA 2HKMA 3UVKA 2OVQB 1GOTB 3I8CA 4N14A 4XYHA 4O3UB 3DXMC 2AGWA 3JROA 4A7JA 3PSLA 2B5LA 2YMUA 2IUVA 2HJBA 3OKWA 2J57G 3SMRA 3IIWA 3JRPA 5B4WA 3P4FA 2AQ5A 5EAMA 2XL2A 3SJLD 2H6KA 1MG3A 5CXCB 1SQ9A 1K32A 5C2WB 4ZOYA 2TRCB 3MMYA 4PBZA 3CFSB 2W18A 4A11B 1N6FA 4PSWB 2PM9B 3EI1A 5THAA 4A2MA 1B9XA 1GXRA 4R7AB 4OWRA 3RSEC 2HYEA 3RN1D 3JB9L 4JD2C 4QT8A 2HJ4A 4MK0B 3BWSA 3OTTA 2AH0A 4ERQA 3I2NA 2CE9A 4IA9A 4J0WA 1FWXA 3OKYB 2I3SA 3MKQA 3C5MA 4ZN4A 3I7PA 3IJCA 2H9LA 3OKTA 4GZ8A 3N0EA 4J87A 3L4MD 3SXTD 5EMKB 4D6VA 4A08A 2P9SC 2MTAH 4LG8A 5TDHB 4CY5A 1U4CA 2I0SA 4PC0A 3AL8B 1TYQC 3EI3B 3NVNA 3VA6A 5CXCA 4X60B 4UI9R 4ESGA 3FM0A 2Z2NA 4A11A 5FKQA 3RRMC 3FRXA 3PSCB 4GMBA 3JZHA 1U2VC 4AOWA 2G99A 3MZLA 4CI1A 5C9ZB 4GM8A 4PXWA 2P9LC 3W15A 4U7AA 5JWZA 5TEFA 4BUJC 2P9UC 4G56B 2XL3A 4JT6C 3DM0A 4U1EI 3EMHA 3N0DA 4Z8LA 4H5JA 4I79A 5SXMA 4ES0A 3V9FA 5IGQA 5TF2A 3B7FA 5IJ7E 3HFQA 2IUQA 3E0CA 2AH1A 4ERYA 4K3ID 3UVOA 3AL8A 3EI3A 4CI8A 3PXWD 2OJYA 4A0BA 3FGBA 4FHLA 2YNNA 2O9KA 4A08B 2AGXA 3K27A 3IKOA 3GREA 4K3JB 4CZVA 4O3TB 2H9NA 4A0AB 5CYKB 3SCYA 3AL9A 5I5JA 3MZKA 4J79A 3I89A 4Y5RD 3KRXB 2P9NC 2YNOA 1Q47A 3F3FA 4FB1D 2OK6A 2GC7A 3C75H 5CXBA 1XKSA 2IUPA 3JAMg 3C9CA 3RMZD 4QRJA 2P9KC 4J86A 3EWEA 4J8BA 2G9AA 1MDAH 2I3TA 3OL2B 3SBPA 4CC9A 3I8EA 4FA1D 2YB8B 3PE7A 4J82A 5IC7A 2BCJB 4L3GD 2H47A 3AH8B 3K26A 4GM9A 2HESX 2UZYB 4GQ2P 5I5IA 3UKUC 3PVWB 1NEXB 5C2VB 2AGYA 3J81g 5IGOA 5EMJB 5GMKn 3UR4A 2H6NA 5GXIA 5HQGA 4A0AA 4FAVD 5CYKA 4J8GA 5EMMB 3EG6A 5HE0B 4GQBB 4A2LA 2PBIB 1OMWB 4A0BB 3F3PA 4J78A 2H6QA 4CI3A 5I5MA 3RN0D 4JSXC 3SLED 4GGAA 3I7KA 1OLZA 4GGDA 3VH0A 3MKSB 4OZUA 4ZOZA 1N6DA 4FAND 3SVWD 1S4UX 3NVQA 4HDJA 2IWKA 5FKTA 3ODTA 3OL2A 3SHFA 1PBYB 3BG1A 5AMSA 4FA5D 5A2Qg 5K19A 2HXCA 2CN2A 2IURA 3MXXA 1JJUB 2GNQA 5AJAA 2I0TA 5CXBB 2QC5A 4QL1A 2PM6B 4EWRA 5EM2A 2H68A 1L0QA 4KFMB 2Q7QA 3CIKB 4A09A 2IAAA 1JOFA 3I7LA 4ERZA 3RFGA 1XIPA 3JZGA 4E54B 2CN3A 1YFQA 2P9IC 3EI2A 2XU7A 3PXSD 5FQDA 2J56H 2OVPB 3ULEC 1NR0A 5HE3B 3UVMA 4X61B 4ZOXA 2CE8A 4LG9A 3GFCA 1R5MA 2AGZA 3KRWB 1N6EA 1K8KC 5FKRA 3UKRC 1GP2B 2YBAA 5GSAA 4CY3A 3A0FA 4NSXA 4QQEA 4X63B 4L1QD 3SN6B 4PSXB 2CNXA 3U4YA 3EU7A 4XYIA 3DWLC 3ORVD 4H5IA 1PEVA 2BBKH 2OVRB 4J0XA 3I7NA 2CO0C 3SFZA 4JSVC 1JMZB 3UVNA 3IJ0A 2OK4A 1XHMA 4O1QD 4YVDA 3SBQA 2PM7B 4E54A 1SQJA 1JMXB 2I0RA 3PVUB 4LGNA 3ZWLB 2B5NA 2AGLA 2H14A 5IT9g 5FKSA 3RLMD 5AFU3 4JSPC 3NVXA 3RFHA 5EM2B 4PBYA 2H3XA 4J84A 5GXHA 4IMMA 5KDOB 4A09B 1A0RB 5K1CC 2H9PA 2H9MA 5H17A 5FA5B 3DSMA 4GM3A 1P22A 4FA9D 3PXTD 3EI2B 3JZNA 2GC4A 3OW8A 3C99A 4L9OA 1SHYB 5HE1B 4TZ4A 1PGUA 4E5ZB 3EI4B 4CI2A 5TEEA 4J73A 3V7DB 3L4OD 5H1MA 1GG2B 5EALA 1MG2A 3JPXA 2IWFA 3I7OA 5H14A 1QNIA 4O45A 2UZXB 5IJ8E 3VGZA 5EARA 1RI6A 4FWWA 5EMLB 2OIZA 4J77A 1VYHC 2Z2PA 4PNKB 2PM9A 5EAPA 2YNPA 3IJ1A 3I7HA 2QXVA 1B9YA 4AEZA 3J80g 4JT5C 4JXMA 3SWSD 4XEIC 3BG0A 4ZOVA 2HKRA 3SBRA 3V5WB 2XYIA 2J55H 5HYNB 4CY2A 2H13A 4CZYA 4J81A 4O9DA 5FLXg 5FXYA 3AFCA 4X3EA 3F3GA 4L3HD 3OKYA 4JSNC 2B5MA 2EBSA 4GGCA 2CO0A 2Z2OA 1TBGA 2P9PC 4CY1A 3EI1B 1ERJA 5HE2B 4E5ZA 3DXKC 3EI4A 3UVLA 3CFVA 1PI6A 4GQ1A 2B4EA 3IIYA 4FA4D 4CZXA 4BH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0K A;  4BL0 A;  4Y7R A;  2HKM A;  3UVK A;  2OVQ B;  1GOT B;  3I8C A;  4N14 A;  4XYH A;  4O3U B;  3DXM C;  2AGW A;  3JRO A;  4A7J A;  3PSL A;  2B5L A;  2YMU A;  2IUV A;  2HJB A;  3OKW A;  2J57 G;  3SMR A;  3IIW A;  3JRP A;  5B4W A;  3P4F A;  2AQ5 A;  5EAM A;  2XL2 A;  3SJL D;  2H6K A;  1MG3 A;  5CXC B;  1SQ9 A;  1K32 A;  5C2W B;  4ZOY A;  2TRC B;  3MMY A;  4PBZ A;  3CFS B;  2W18 A;  4A11 B;  1N6F A;  4PSW B;  2PM9 B;  3EI1 A;  5THA A;  4A2M A;  1B9X A;  1GXR A;  4R7A B;  4OWR A;  3RSE C;  2HYE A;  3RN1 D;  3JB9 L;  4JD2 C;  4QT8 A;  2HJ4 A;  4MK0 B;  3BWS A;  3OTT A;  2AH0 A;  4ERQ A;  3I2N A;  2CE9 A;  4IA9 A;  4J0W A;  1FWX A;  3OKY B;  2I3S A;  3MKQ A;  3C5M A;  4ZN4 A;  3I7P A;  3IJC A;  2H9L A;  3OKT A;  4GZ8 A;  3N0E A;  4J87 A;  3L4M D;  3SXT D;  5EMK B;  4D6V A;  4A08 A;  2P9S C;  2MTA H;  4LG8 A;  5TDH B;  4CY5 A;  1U4C A;  2I0S A;  4PC0 A;  3AL8 B;  1TYQ C;  3EI3 B;  3NVN A;  3VA6 A;  5CXC A;  4X60 B;  4UI9 R;  4ESG A;  3FM0 A;  2Z2N A;  4A11 A;  5FKQ A;  3RRM C;  3FRX A;  3PSC B;  4GMB A;  3JZH A;  1U2V C;  4AOW A;  2G99 A;  3MZL A;  4CI1 A;  5C9Z B;  4GM8 A;  4PXW A;  2P9L C;  3W15 A;  4U7A A;  5JWZ A;  5TEF A;  4BUJ C;  2P9U C;  4G56 B;  2XL3 A;  4JT6 C;  3DM0 A;  4U1E I;  3EMH A;  3N0D A;  4Z8L A;  4H5J A;  4I79 A;  5SXM A;  4ES0 A;  3V9F A;  5IGQ A;  5TF2 A;  3B7F A;  5IJ7 E;  3HFQ A;  2IUQ A;  3E0C A;  2AH1 A;  4ERY A;  4K3I D;  3UVO A;  3AL8 A;  3EI3 A;  4CI8 A;  3PXW D;  2OJY A;  4A0B A;  3FGB A;  4FHL A;  2YNN A;  2O9K A;  4A08 B;  2AGX A;  3K27 A;  3IKO A;  3GRE A;  4K3J B;  4CZV A;  4O3T B;  2H9N A;  4A0A B;  5CYK B;  3SCY A;  3AL9 A;  5I5J A;  3MZK A;  4J79 A;  3I89 A;  4Y5R D;  3KRX B;  2P9N C;  2YNO A;  1Q47 A;  3F3F A;  4FB1 D;  2OK6 A;  2GC7 A;  3C75 H;  5CXB A;  1XKS A;  2IUP A;  3JAM g;  3C9C A;  3RMZ D;  4QRJ A;  2P9K C;  4J86 A;  3EWE A;  4J8B A;  2G9A A;  1MDA H;  2I3T A;  3OL2 B;  3SBP A;  4CC9 A;  3I8E A;  4FA1 D;  2YB8 B;  3PE7 A;  4J82 A;  5IC7 A;  2BCJ B;  4L3G D;  2H47 A;  3AH8 B;  3K26 A;  4GM9 A;  2HES X;  2UZY B;  4GQ2 P;  5I5I A;  3UKU C;  3PVW B;  1NEX B;  5C2V B;  2AGY A;  3J81 g;  5IGO A;  5EMJ B;  5GMK n;  3UR4 A;  2H6N A;  5GXI A;  5HQG A;  4A0A A;  4FAV D;  5CYK A;  4J8G A;  5EMM B;  3EG6 A;  5HE0 B;  4GQB B;  4A2L A;  2PBI B;  1OMW B;  4A0B B;  3F3P A;  4J78 A;  2H6Q A;  4CI3 A;  5I5M A;  3RN0 D;  4JSX C;  3SLE D;  4GGA A;  3I7K A;  1OLZ A;  4GGD A;  3VH0 A;  3MKS B;  4OZU A;  4ZOZ A;  1N6D A;  4FAN D;  3SVW D;  1S4U X;  3NVQ A;  4HDJ A;  2IWK A;  5FKT A;  3ODT A;  3OL2 A;  3SHF A;  1PBY B;  3BG1 A;  5AMS A;  4FA5 D;  5A2Q g;  5K19 A;  2HXC A;  2CN2 A;  2IUR A;  3MXX A;  1JJU B;  2GNQ A;  5AJA A;  2I0T A;  5CXB B;  2QC5 A;  4QL1 A;  2PM6 B;  4EWR A;  5EM2 A;  2H68 A;  1L0Q A;  4KFM B;  2Q7Q A;  3CIK B;  4A09 A;  2IAA A;  1JOF A;  3I7L A;  4ERZ A;  3RFG A;  1XIP A;  3JZG A;  4E54 B;  2CN3 A;  1YFQ A;  2P9I C;  3EI2 A;  2XU7 A;  3PXS D;  5FQD A;  2J56 H;  2OVP B;  3ULE C;  1NR0 A;  5HE3 B;  3UVM A;  4X61 B;  4ZOX A;  2CE8 A;  4LG9 A;  3GFC A;  1R5M A;  2AGZ A;  3KRW B;  1N6E A;  1K8K C;  5FKR A;  3UKR C;  1GP2 B;  2YBA A;  5GSA A;  4CY3 A;  3A0F A;  4NSX A;  4QQE A;  4X63 B;  4L1Q D;  3SN6 B;  4PSX B;  2CNX A;  3U4Y A;  3EU7 A;  4XYI A;  3DWL C;  3ORV D;  4H5I A;  1PEV A;  2BBK H;  2OVR B;  4J0X A;  3I7N A;  2CO0 C;  3SFZ A;  4JSV C;  1JMZ B;  3UVN A;  3IJ0 A;  2OK4 A;  1XHM A;  4O1Q D;  4YVD A;  3SBQ A;  2PM7 B;  4E54 A;  1SQJ A;  1JMX B;  2I0R A;  3PVU B;  4LGN A;  3ZWL B;  2B5N A;  2AGL A;  2H14 A;  5IT9 g;  5FKS A;  3RLM D;  5AFU 3;  4JSP C;  3NVX A;  3RFH A;  5EM2 B;  4PBY A;  2H3X A;  4J84 A;  5GXH A;  4IMM A;  5KDO B;  4A09 B;  1A0R B;  5K1C C;  2H9P A;  2H9M A;  5H17 A;  5FA5 B;  3DSM A;  4GM3 A;  1P22 A;  4FA9 D;  3PXT D;  3EI2 B;  3JZN A;  2GC4 A;  3OW8 A;  3C99 A;  4L9O A;  1SHY B;  5HE1 B;  4TZ4 A;  1PGU A;  4E5Z B;  3EI4 B;  4CI2 A;  5TEE A;  4J73 A;  3V7D B;  3L4O D;  5H1M A;  1GG2 B;  5EAL A;  1MG2 A;  3JPX A;  2IWF A;  3I7O A;  5H14 A;  1QNI A;  4O45 A;  2UZX B;  5IJ8 E;  3VGZ A;  5EAR A;  1RI6 A;  4FWW A;  5EML B;  2OIZ A;  4J77 A;  1VYH C;  2Z2P A;  4PNK B;  2PM9 A;  5EAP A;  2YNP A;  3IJ1 A;  3I7H A;  2QXV A;  1B9Y A;  4AEZ A;  3J80 g;  4JT5 C;  4JXM A;  3SWS D;  4XEI C;  3BG0 A;  4ZOV A;  2HKR A;  3SBR A;  3V5W B;  2XYI A;  2J55 H;  5HYN B;  4CY2 A;  2H13 A;  4CZY A;  4J81 A;  4O9D A;  5FLX g;  5FXY A;  3AFC A;  4X3E A;  3F3G A;  4L3H D;  3OKY A;  4JSN C;  2B5M A;  2EBS A;  4GGC A;  2CO0 A;  2Z2O A;  1TBG A;  2P9P C;  4CY1 A;  3EI1 B;  1ERJ A;  5HE2 B;  4E5Z A;  3DXK C;  3EI4 A;  3UVL A;  3CFV A;  1PI6 A;  4GQ1 A;  2B4E A;  3IIY A;  4FA4 D;  4CZX A;  4BH6 A; 
#chains in the Genus database with same CATH topology
 4D0K A;  4BL0 A;  4Y7R A;  2HKM A;  3UVK A;  2OVQ B;  2QR5 A;  1GOT B;  1K3I A;  3I8C A;  4N14 A;  4XYH A;  4O3U B;  3DXM C;  2AGW A;  1VE7 A;  3JRO A;  3NIF A;  3IVM A;  1JV2 A;  4A7J A;  3PSL A;  2VDL A;  2B5L A;  2YMU A;  2IUV A;  4AX4 A;  4O2W A;  2HJB A;  3OKW A;  2EIE A;  3GD1 I;  2J57 G;  3SMR A;  3IIW A;  3JRP A;  4NEN A;  5FFG A;  3P4F A;  5B4W A;  2AQ5 A;  5EAM A;  2XL2 A;  3SJL D;  2H6K A;  1MG3 A;  5CXC B;  4D9S A;  1SQ9 A;  1K32 A;  5C2W B;  4ZOY A;  2TRC B;  3MMY A;  4PBZ A;  3CFS B;  2W18 A;  2HU5 A;  4A11 B;  1N6F A;  4PSW B;  2PM9 B;  3EI1 A;  5THA A;  4A2M A;  1B9X A;  1GXR A;  1GOF A;  4R7A B;  4OWR A;  3RSE C;  2HYE A;  3RN1 D;  3JB9 L;  4G1M A;  5M61 A;  4JD2 C;  4QT8 A;  2HJ4 A;  4MK0 B;  1C9I A;  3BWS A;  3OTT A;  2AH0 A;  4ERQ A;  3I2N A;  2CE9 A;  4IA9 A;  4J0W A;  1FWX A;  3OKY B;  3ZE2 A;  2I3S A;  3MKQ A;  3C5M A;  4ZN4 A;  3GC3 B;  3I7P A;  3IJC A;  5E6R A;  2H9L A;  3OKT A;  4GZ8 A;  3N0E A;  4J87 A;  3L4M D;  3SXT D;  5EMK B;  4AN0 A;  4D6V A;  3V4P A;  3K71 A;  4A08 A;  2EIC A;  1UOP A;  1T2X A;  2P9S C;  4WK0 A;  2MTA H;  4LG8 A;  5TDH B;  1QFM A;  4CY5 A;  1U4C A;  2I0S A;  4PC0 A;  3AL8 B;  1TYQ C;  3EI3 B;  3NVN A;  3VA6 A;  5CXC A;  5M5V A;  4X60 B;  1QFS A;  4UI9 R;  4ESG A;  3FM0 A;  2Z2N A;  4A11 A;  5FKQ A;  3RRM C;  3FRX A;  3PSC B;  4GMB A;  3EQ9 A;  3JZH A;  1U2V C;  4AOW A;  2G99 A;  3MZL A;  4CI1 A;  2VDP A;  5C9Z B;  4GM8 A;  4PXW A;  2P9L C;  3W15 A;  2VDM A;  4U7A A;  5JWZ A;  2XE4 A;  3QHY B;  5TEF A;  4BUJ C;  2P9U C;  4G56 B;  2XL3 A;  4JT6 C;  3DM0 A;  4U1E I;  3EMH A;  3T3P A;  3N0D A;  4Z8L A;  4H5J A;  4I79 A;  5SXM A;  4ES0 A;  4G55 A;  3V9F A;  5IGQ A;  5TF2 A;  3B7F A;  2BKL A;  5IJ7 E;  3HFQ A;  2IUQ A;  4RE6 A;  3E0C A;  2AH1 A;  4ERY A;  4K3I D;  3UVO A;  2VZ1 A;  3ZE0 A;  3AL8 A;  3EI3 A;  4CI8 A;  3PXW D;  2OJY A;  2VDR A;  4A0B A;  4MMY A;  3FGB A;  4BCD A;  4FHL A;  2YNN A;  3VI4 A;  5FFO A;  1U8C A;  2O9K A;  4A08 B;  2AGX A;  3K27 A;  3IKO A;  3GRE A;  4K3J B;  4CZV A;  4O3T B;  2H9N A;  4A0A B;  5CYK B;  3SCY A;  3AL9 A;  5I5J A;  3MZK A;  4J79 A;  3I89 A;  4Y5R D;  3KRX B;  3T3M A;  2P9N C;  2YNO A;  1E5T A;  1Q47 A;  3F3F A;  4FB1 D;  4O02 A;  2OK6 A;  2GC7 A;  3C75 H;  5CXB A;  4UM8 A;  1XKS A;  2IUP A;  3JAM g;  3O4I A;  3C9C A;  3RMZ D;  4QRJ A;  2P9K C;  2WQ8 A;  4J86 A;  3EWE A;  4RE5 A;  4DNV A;  4WK4 A;  4J8B A;  3OF7 A;  2EID A;  2G9A A;  1MDA H;  2I3T A;  3K6S A;  1GOG A;  3OL2 B;  3SBP A;  4CC9 A;  4AMY A;  3ZE1 A;  4NBM A;  4DNU A;  1M1X A;  3I8E A;  4FA1 D;  5E6S A;  3IJE A;  2YB8 B;  1L5G A;  2VZ3 A;  3PE7 A;  4J82 A;  5IC7 A;  2BCJ B;  4L3G D;  2H47 A;  3AH8 B;  1I2M B;  3K26 A;  4GM9 A;  2HES X;  2UZY B;  4GQ2 P;  5I5I A;  3UKU C;  3PVW B;  1NEX B;  5C2V B;  2AGY A;  3J81 g;  1H2W A;  5IGO A;  5EMJ B;  5GMK n;  3UR4 A;  2H6N A;  5GXI A;  5HQG A;  4A0A A;  4FAV D;  5CYK A;  4J8G A;  5EMM B;  3EG6 A;  5HE0 B;  2HU7 A;  4GQB B;  4A2L A;  1GOH A;  2PBI B;  1OMW B;  4A0B B;  4BCC A;  4BP8 A;  4QAM A;  3F3P A;  4J78 A;  2H6Q A;  4CI3 A;  5I5M A;  3RN0 D;  4JSX C;  3IUM A;  3SLE D;  4GGA A;  3I7K A;  1OLZ A;  4G1E A;  4GGD A;  3VH0 A;  3MKS B;  4OZU A;  3EQ7 A;  4ZOZ A;  1N6D A;  4UM9 A;  4FAN D;  3SVW D;  1S4U X;  3NVQ A;  4HDJ A;  2IWK A;  3MVD K;  3O4J A;  3FCU A;  5FKT A;  3ODT A;  3O4G A;  3OL2 A;  3SHF A;  1PBY B;  3BG1 A;  2VDQ A;  2XDW A;  5AMS A;  4FA5 D;  5A2Q g;  5K19 A;  2HXC A;  1O6G A;  2CN2 A;  2IUR A;  3MXX A;  1JJU B;  2GNQ A;  5AJA A;  2I0T A;  5CXB B;  2QC5 A;  4QL1 A;  2PM6 B;  4EWR A;  5EM2 A;  2H68 A;  1L0Q A;  4KFM B;  2Q7Q A;  3CIK B;  4A09 A;  2IAA A;  3ZDZ A;  1JOF A;  2EIB A;  3I7L A;  4ERZ A;  3RFG A;  1XIP A;  3JZG A;  4E54 B;  2CN3 A;  3K72 A;  1YFQ A;  2P9I C;  4AN1 A;  3EI2 A;  1E8M A;  2XU7 A;  1UOQ A;  3PXS D;  5FQD A;  2J56 H;  2OVP B;  3ULE C;  4MMX A;  1NR0 A;  5HE3 B;  5M5U A;  3UVM A;  5M5R A;  4X61 B;  5M5T A;  4ZOX A;  2CE8 A;  3NID A;  4LG9 A;  3GFC A;  1R5M A;  2AGZ A;  4NAA A;  3KRW B;  1N6E A;  4NC4 A;  1K8K C;  4Z7Q A;  5FKR A;  3UKR C;  1VE6 A;  1GP2 B;  2YBA A;  5GSA A;  4JHN A;  4CY3 A;  3A0F A;  3MUN A;  4NSX A;  4QQE A;  4X63 B;  4L1Q D;  3SN6 B;  4PSX B;  2CNX A;  4BP9 A;  3KCI A;  3U4Y A;  1O6F A;  3EU7 A;  4XYI A;  3QI0 A;  3ZDX A;  5M5S A;  3DWL C;  3ORV D;  3FCS A;  4H5I A;  4L1M A;  1PEV A;  2BBK H;  2OVR B;  4J0X A;  4IRZ A;  3I7N A;  3IUR A;  2CO0 C;  3SFZ A;  4JSV C;  1JMZ B;  3IUQ A;  1C9L A;  3UVN A;  1UTC A;  3IJ0 A;  2OK4 A;  1XHM A;  4O1Q D;  4YVD A;  3SBQ A;  2PM7 B;  4E54 A;  2HU8 A;  3IUN A;  5C92 A;  1SQJ A;  4DNW A;  1JMX B;  2I0R A;  3PVU B;  4LGN A;  3ZWL B;  2B5N A;  2AGL A;  2H14 A;  5IT9 g;  5FKS A;  3RLM D;  5AFU 3;  4JSP C;  3ZDY A;  3NVX A;  3RFH A;  5EM2 B;  4PBY A;  2H3X A;  1YR2 A;  4J84 A;  5GXH A;  1UOO A;  4Z7O A;  4IMM A;  5KDO B;  5C86 A;  3VI3 A;  4A09 B;  1A0R B;  1H2Z A;  3IUL A;  5K1C C;  4Z7N A;  3V4V A;  2H9P A;  2H9M A;  3IUJ A;  5H17 A;  5FA5 B;  3DSM A;  4GM3 A;  1P22 A;  4FA9 D;  3PXT D;  3EI2 B;  2XZG A;  3JZN A;  1JTD B;  2GC4 A;  3OW8 A;  3C99 A;  3EQ8 A;  4L9O A;  1SHY B;  5E6U A;  5HE1 B;  4BCB A;  4WJK A;  4TZ4 A;  1PGU A;  2VDN A;  3EI4 B;  4E5Z B;  4CI2 A;  5TEE A;  3NIG A;  4J73 A;  1A12 A;  3V7D B;  4AMZ A;  3L4O D;  5H1M A;  3O4H A;  1GG2 B;  5EAL A;  1MG2 A;  3JPX A;  2IWF A;  3I7O A;  5H14 A;  3DDU A;  1QNI A;  4O45 A;  2UZX B;  5IJ8 E;  3VGZ A;  2VC2 A;  5EAR A;  1RI6 A;  2VDK A;  1VZ3 A;  4FWW A;  5EML B;  1H2Y A;  2OIZ A;  4J77 A;  1VYH C;  2Z2P A;  4PNK B;  2PM9 A;  5EAP A;  2YNP A;  3MUO A;  1E8N A;  3IJ1 A;  3I7H A;  2QXV A;  1B9Y A;  4JHP C;  4AEZ A;  3J80 g;  4JT5 C;  4JXM A;  3SWS D;  2VDO A;  4XEI C;  3BG0 A;  4ZOV A;  2HKR A;  3SBR A;  3V5W B;  2XYI A;  2J55 H;  1TYE A;  5HYN B;  4CY2 A;  2H13 A;  1BPO A;  4CZY A;  4J81 A;  4O9D A;  5FLX g;  5FXY A;  3AFC A;  4X3E A;  3F3G A;  4L3H D;  3OKY A;  4JSN C;  2B5M A;  2EBS A;  2QZP A;  4GGC A;  2CO0 A;  2Z2O A;  1TBG A;  2P9P C;  4CY1 A;  3EI1 B;  1ERJ A;  5HE2 B;  4WK2 A;  4E5Z A;  3DXK C;  3EI4 A;  3UVL A;  4MMZ A;  1H2X A;  3CFV A;  1PI6 A;  4GQ1 A;  2B4E A;  3IIY A;  2JKX A;  4FA4 D;  4CZX A;  4BH6 A;  5HDB A;  1VZ2 A; 
#chains in the Genus database with same CATH homology
 4D0K A;  4BL0 A;  4Y7R A;  2HKM A;  3UVK A;  2OVQ B;  1GOT B;  3I8C A;  4N14 A;  4XYH A;  4O3U B;  3DXM C;  2AGW A;  3JRO A;  4A7J A;  3PSL A;  2B5L A;  2YMU A;  2IUV A;  2HJB A;  3OKW A;  2J57 G;  3SMR A;  3IIW A;  3JRP A;  5B4W A;  3P4F A;  2AQ5 A;  5EAM A;  2XL2 A;  3SJL D;  2H6K A;  1MG3 A;  5CXC B;  1SQ9 A;  1K32 A;  5C2W B;  4ZOY A;  2TRC B;  3MMY A;  4PBZ A;  3CFS B;  2W18 A;  4A11 B;  1N6F A;  4PSW B;  2PM9 B;  3EI1 A;  5THA A;  4A2M A;  1B9X A;  1GXR A;  4R7A B;  4OWR A;  3RSE C;  2HYE A;  3RN1 D;  3JB9 L;  4JD2 C;  4QT8 A;  2HJ4 A;  4MK0 B;  3BWS A;  3OTT A;  2AH0 A;  4ERQ A;  3I2N A;  2CE9 A;  4IA9 A;  4J0W A;  1FWX A;  3OKY B;  2I3S A;  3MKQ A;  3C5M A;  4ZN4 A;  3I7P A;  3IJC A;  2H9L A;  3OKT A;  4GZ8 A;  3N0E A;  4J87 A;  3L4M D;  3SXT D;  5EMK B;  4D6V A;  4A08 A;  2P9S C;  2MTA H;  4LG8 A;  5TDH B;  4CY5 A;  1U4C A;  2I0S A;  4PC0 A;  3AL8 B;  1TYQ C;  3EI3 B;  3NVN A;  3VA6 A;  5CXC A;  4X60 B;  4UI9 R;  4ESG A;  3FM0 A;  2Z2N A;  4A11 A;  5FKQ A;  3RRM C;  3FRX A;  3PSC B;  4GMB A;  3JZH A;  1U2V C;  4AOW A;  2G99 A;  3MZL A;  4CI1 A;  5C9Z B;  4GM8 A;  4PXW A;  2P9L C;  3W15 A;  4U7A A;  5JWZ A;  5TEF A;  4BUJ C;  2P9U C;  4G56 B;  2XL3 A;  4JT6 C;  3DM0 A;  4U1E I;  3EMH A;  3N0D A;  4Z8L A;  4H5J A;  4I79 A;  5SXM A;  4ES0 A;  3V9F A;  5IGQ A;  5TF2 A;  3B7F A;  5IJ7 E;  3HFQ A;  2IUQ A;  3E0C A;  2AH1 A;  4ERY A;  4K3I D;  3UVO A;  3AL8 A;  3EI3 A;  4CI8 A;  3PXW D;  2OJY A;  4A0B A;  3FGB A;  4FHL A;  2YNN A;  2O9K A;  4A08 B;  2AGX A;  3K27 A;  3IKO A;  3GRE A;  4K3J B;  4CZV A;  4O3T B;  2H9N A;  4A0A B;  5CYK B;  3SCY A;  3AL9 A;  5I5J A;  3MZK A;  4J79 A;  3I89 A;  4Y5R D;  3KRX B;  2P9N C;  2YNO A;  1Q47 A;  3F3F A;  4FB1 D;  2OK6 A;  2GC7 A;  3C75 H;  5CXB A;  1XKS A;  2IUP A;  3JAM g;  3C9C A;  3RMZ D;  4QRJ A;  2P9K C;  4J86 A;  3EWE A;  4J8B A;  2G9A A;  1MDA H;  2I3T A;  3OL2 B;  3SBP A;  4CC9 A;  3I8E A;  4FA1 D;  2YB8 B;  3PE7 A;  4J82 A;  5IC7 A;  2BCJ B;  4L3G D;  2H47 A;  3AH8 B;  3K26 A;  4GM9 A;  2HES X;  2UZY B;  4GQ2 P;  5I5I A;  3UKU C;  3PVW B;  1NEX B;  5C2V B;  2AGY A;  3J81 g;  5IGO A;  5EMJ B;  5GMK n;  3UR4 A;  2H6N A;  5GXI A;  5HQG A;  4A0A A;  4FAV D;  5CYK A;  4J8G A;  5EMM B;  3EG6 A;  5HE0 B;  4GQB B;  4A2L A;  2PBI B;  1OMW B;  4A0B B;  3F3P A;  4J78 A;  2H6Q A;  4CI3 A;  5I5M A;  3RN0 D;  4JSX C;  3SLE D;  4GGA A;  3I7K A;  1OLZ A;  4GGD A;  3VH0 A;  3MKS B;  4OZU A;  4ZOZ A;  1N6D A;  4FAN D;  3SVW D;  1S4U X;  3NVQ A;  4HDJ A;  2IWK A;  5FKT A;  3ODT A;  3OL2 A;  3SHF A;  1PBY B;  3BG1 A;  5AMS A;  4FA5 D;  5A2Q g;  5K19 A;  2HXC A;  2CN2 A;  2IUR A;  3MXX A;  1JJU B;  2GNQ A;  5AJA A;  2I0T A;  5CXB B;  2QC5 A;  4QL1 A;  2PM6 B;  4EWR A;  5EM2 A;  2H68 A;  1L0Q A;  4KFM B;  2Q7Q A;  3CIK B;  4A09 A;  2IAA A;  1JOF A;  3I7L A;  4ERZ A;  3RFG A;  1XIP A;  3JZG A;  4E54 B;  2CN3 A;  1YFQ A;  2P9I C;  3EI2 A;  2XU7 A;  3PXS D;  5FQD A;  2J56 H;  2OVP B;  3ULE C;  1NR0 A;  5HE3 B;  3UVM A;  4X61 B;  4ZOX A;  2CE8 A;  4LG9 A;  3GFC A;  1R5M A;  2AGZ A;  3KRW B;  1N6E A;  1K8K C;  5FKR A;  3UKR C;  1GP2 B;  2YBA A;  5GSA A;  4CY3 A;  3A0F A;  4NSX A;  4QQE A;  4X63 B;  4L1Q D;  3SN6 B;  4PSX B;  2CNX A;  3U4Y A;  3EU7 A;  4XYI A;  3DWL C;  3ORV D;  4H5I A;  1PEV A;  2BBK H;  2OVR B;  4J0X A;  3I7N A;  2CO0 C;  3SFZ A;  4JSV C;  1JMZ B;  3UVN A;  3IJ0 A;  2OK4 A;  1XHM A;  4O1Q D;  4YVD A;  3SBQ A;  2PM7 B;  4E54 A;  1SQJ A;  1JMX B;  2I0R A;  3PVU B;  4LGN A;  3ZWL B;  2B5N A;  2AGL A;  2H14 A;  5IT9 g;  5FKS A;  3RLM D;  5AFU 3;  4JSP C;  3NVX A;  3RFH A;  5EM2 B;  4PBY A;  2H3X A;  4J84 A;  5GXH A;  4IMM A;  5KDO B;  4A09 B;  1A0R B;  5K1C C;  2H9P A;  2H9M A;  5H17 A;  5FA5 B;  3DSM A;  4GM3 A;  1P22 A;  4FA9 D;  3PXT D;  3EI2 B;  3JZN A;  2GC4 A;  3OW8 A;  3C99 A;  4L9O A;  1SHY B;  5HE1 B;  4TZ4 A;  1PGU A;  4E5Z B;  3EI4 B;  4CI2 A;  5TEE A;  4J73 A;  3V7D B;  3L4O D;  5H1M A;  1GG2 B;  5EAL A;  1MG2 A;  3JPX A;  2IWF A;  3I7O A;  5H14 A;  1QNI A;  4O45 A;  2UZX B;  5IJ8 E;  3VGZ A;  5EAR A;  1RI6 A;  4FWW A;  5EML B;  2OIZ A;  4J77 A;  1VYH C;  2Z2P A;  4PNK B;  2PM9 A;  5EAP A;  2YNP A;  3IJ1 A;  3I7H A;  2QXV A;  1B9Y A;  4AEZ A;  3J80 g;  4JT5 C;  4JXM A;  3SWS D;  4XEI C;  3BG0 A;  4ZOV A;  2HKR A;  3SBR A;  3V5W B;  2XYI A;  2J55 H;  5HYN B;  4CY2 A;  2H13 A;  4CZY A;  4J81 A;  4O9D A;  5FLX g;  5FXY A;  3AFC A;  4X3E A;  3F3G A;  4L3H D;  3OKY A;  4JSN C;  2B5M A;  2EBS A;  4GGC A;  2CO0 A;  2Z2O A;  1TBG A;  2P9P C;  4CY1 A;  3EI1 B;  1ERJ A;  5HE2 B;  4E5Z A;  3DXK C;  3EI4 A;  3UVL A;  3CFV A;  1PI6 A;  4GQ1 A;  2B4E A;  3IIY A;  4FA4 D;  4CZX A;  4BH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...