1JMXB

Crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
346
structure length
339
Chain Sequence
b'GPALKAGHEYMIVTNYPNNLHVVDVASDTVYKSCVMPDKFGPGTAMMAPDNRTAYVLNNHYGDIYGIDLDTCKNTFHANLSSVPGEVGRSMYSFAISPDGKEVYATVNPTQRLNDHYVVKPPRLEVFSTADGLEAKPVRTFPMPRQVYLMRAADDGSLYVAGPDIYKMDVKTGKYTVALPLRNWNRKGYSAPDVLYFWPHQSPRHEFSMLYTIARFATADLLYGYLSVDLKTGKTHTQEFADLTELYFTGLRSPKDPNQIYGVLNRLAKYDLKQRKLIKAANLDHTYYCVAFDKKGDKLYLGGTFNDLAVFNPDTLEKVKNIKLPGGDMSTTTPQVFIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amine Dehydrogenase
publication title Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 87
structure length 339
sequence length 346
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1jmxB00
4ESGA 2AGXA 1S4UX 3CIKB 5FXYA 3SFZA 4QRJA 4QT8A 2BCJB 3IIYA 1GXRA 3DWLC 4Z8LA 3I8EA 3PVUB 2HKRA 3I2NA 2UZYB 4CI3A 3UKUC 2QXVA 4FHLA 5FLXg 4CC9A 4L1QD 2IWKA 1XKSA 5HE3B 3C75H 4FA1D 3EMHA 3SWSD 2J56H 1Q47A 2CE9A 3A0FA 4X63B 4QL1A 3RRMC 5H14A 3UVMA 4LG8A 4JXMA 3DSMA 4J79A 3I7LA 5FKSA 1VYHC 3JRPA 4PNKB 3OKWA 5EM2A 2CO0A 4Y5RD 1MG2A 4MK0B 3MZKA 1OMWB 2TRCB 2P9IC 5C2VB 2O9KA 3V5WB 3SHFA 4GQ2P 3SJLD 2PM7B 4PSWB 3RMZD 3ULEC 3OKTA 3V9FA 4IMMA 1B9XA 1MDAH 2GC4A 2Z2OA 5AMSA 4PBZA 4O3UB 2XU7A 4CI2A 5H17A 2G9AA 4CZXA 3J81g 2HYEA 5K1CC 3UVLA 1RI6A 2Z2PA 2AH1A 4K3JB 5GXIA 4O3TB 2AH0A 1B9YA 3I7PA 4U1EI 2B5LA 3RFGA 3N0DA 4N14A 4Y7RA 5TF2A 3IJ1A 5EM2B 3EU7A 1XHMA 5EMLB 3RSEC 1JMXB 3SVWD 3JAMg 1NEXB 4GM9A 4ERQA 3DXKC 3FM0A 3NVXA 2QC5A 3I89A 5K19A 4JSNC 3K27A 4I79A 3KRWB 1PEVA 5AJAA 1SQJA 2CO0C 4J78A 4IA9A 4A0AA 1GP2B 1PI6A 1PBYB 4L3HD 4LGNA 3SMRA 2I0TA 5TDHB 4D6VA 2H6NA 5CYKA 2XL3A 1A0RB 2YB8B 4J73A 4J77A 3MKQA 2OIZA 2MTAH 2P9PC 2GC7A 5FA5B 5CXCA 4BH6A 3RLMD 3JZNA 2OK6A 5EARA 3UKRC 2I3SA 3AFCA 4A0BA 1GOTB 4O45A 4O1QD 2P9KC 3V7DB 4K3ID 4A2MA 4J0WA 4J82A 3ODTA 3DXMC 4U7AA 4JSPC 2G99A 2AQ5A 2I3TA 1XIPA 5EAPA 4JT6C 1JOFA 5EAMA 3W15A 4H5JA 4QQEA 2AGLA 3FGBA 1TBGA 3PE7A 3IJ0A 4H5IA 4AEZA 4CY1A 3SLED 2HJ4A 3NVNA 3EG6A 3OW8A 4A0AB 4TZ4A 4J8BA 3EI4A 2I0RA 4GZ8A 4ES0A 4ZOYA 2H6KA 1K8KC 2CN3A 1JMZB 3F3PA 2Q7QA 5CYKB 3P4FA 4A11A 1L0QA 1SQ9A 2P9SC 4GQ1A 4FA4D 4GGAA 1ERJA 2YMUA 3VA6A 2GNQA 3OKYA 5IJ8E 3MMYA 5CXCB 1YFQA 2PM9A 3GREA 5TEFA 2W18A 4A09A 1N6FA 4A0BB 3L4MD 4YVDA 4J81A 3SCYA 4J8GA 3ZWLB 4O9DA 2Z2NA 4J0XA 4X61B 3SXTD 3JZGA 2HESX 4CY3A 4PXWA 3IKOA 3MKSB 2P9NC 2IUQA 5EALA 5KDOB 1N6DA 2H14A 1U4CA 4KFMB 4L9OA 5IGOA 2CNXA 3PXTD 4X3EA 2H47A 2J55H 2YBAA 4FAVD 5JWZA 3B7FA 4E54A 2B5NA 3IJCA 3UVOA 3EI4B 1TYQC 3PSLA 2P9LC 2H68A 3UVNA 2H9PA 3JPXA 4HDJA 1NR0A 5HE2B 4BUJC 3SBPA 1QNIA 4CY5A 5IC7A 4FA5D 4GM3A 3N0EA 3C9CA 3RN0D 4CZYA 4FWWA 4UI9R 5GXHA 3VGZA 2H6QA 2PM9B 2XL2A 3KRXB 2OVQB 3EI1A 4A09B 4FB1D 5I5MA 4GMBA 3IIWA 3EI2A 2PM6B 4G56B 2OVPB 1U2VC 3F3FA 3I7HA 5A2Qg 5IT9g 5CXBA 3U4YA 4XEIC 3I7NA 2AGWA 4R7AB 3UVKA 4CI8A 4AOWA 3MXXA 3J80g 3NVQA 3BG0A 4ERZA 5FKTA 3K26A 4E54B 3VH0A 3SBQA 2UZXB 4ZOXA 3AL9A 2YNNA 3HFQA 1PGUA 5EMMB 3RFHA 3JZHA 5IGQA 2IAAA 3CFVA 2I0SA 2OJYA 2OVRB 1P22A 4A08A 5B4WA 2YNPA 1GG2B 4NSXA 4BL0A 2YNOA 2BBKH 3EI1B 4A2LA 2J57G 3AH8B 3EI3A 4PSXB 5C9ZB 5C2WB 3EI2B 4A7JA 1JJUB 4E5ZA 3I7KA 3BWSA 5SXMA 5IJ7E 3L4OD 2IUPA 4ZN4A 5CXBB 1MG3A 5FKQA 5FQDA 3I7OA 3OL2A 2HKMA 3F3GA 3PXSD 3C5MA 5EMKB 2IURA 3JROA 3ORVD 4FA9D 5AFU3 4CZVA 2IWFA 4ERYA 3I8CA 5HE0B 2H9NA 4ZOZA 4LG9A 4J86A 5TEEA 4PBYA 2H9LA 4FAND 4CI1A 3SBRA 4PC0A 2XYIA 3C99A 2B5MA 2B4EA 4J84A 2H9MA 4XYHA 3PXWD 3AL8A 4JSXC 4A08B 3BG1A 3DM0A 4GGDA 4JD2C 4EWRA 2HXCA 2H3XA 3EWEA 2EBSA 1N6EA 3EI3B 4L3GD 5H1MA 4XYIA 4GGCA 5GSAA 3CFSB 4GQBB 1FWXA 4E5ZB 2H13A 5THAA 2IUVA 4J87A 4A11B 1SHYB 3OL2B 4CY2A 3JB9L 2AGZA 2CE8A 4OZUA 5GMKn 5FKRA 3OKYB 2AGYA 3OTTA 3GFCA 5EMJB 4X60B 3MZLA 4D0KA 5HE1B 1K32A 2CN2A 2P9UC 2PBIB 3UR4A 4OWRA 3FRXA 3AL8B 3PSCB 3SN6B 4GM8A 5HYNB 5HQGA 4JSVC 1OLZA 3RN1D 2HJBA 2OK4A 3PVWB 4JT5C 5I5IA 5I5JA 3E0CA 4ZOVA 1R5MA
chains in the Genus database with same CATH superfamily
4ESGA 1E5TA 2AGXA 1S4UX 3CIKB 5FXYA 3SFZA 4QRJA 4QT8A 2HU5A 5E6UA 2BCJB 3IIYA 4NBMA 1GXRA 1E8MA 3DWLC 1A12A 4Z8LA 3I8EA 3PVUB 2HKRA 3I2NA 2UZYB 4CI3A 3UKUC 2QXVA 3IULA 3K72A 4FHLA 4G55A 5FLXg 3ZDYA 4CC9A 4L1QD 2IWKA 1XKSA 2VDLA 5HE3B 3C75H 4FA1D 3EMHA 3SWSD 2J56H 1Q47A 2CE9A 3A0FA 4X63B 4QL1A 3RRMC 5H14A 3UVMA 4LG8A 5E6SA 4JXMA 3DSMA 4J79A 1UOOA 5HDBA 3EQ9A 3I7LA 5FKSA 1VYHC 3JRPA 4PNKB 3QHYB 3OKWA 4JHNA 4QAMA 5EM2A 2CO0A 4Y5RD 1MG2A 4MK0B 3MZKA 1OMWB 2TRCB 2P9IC 5C2VB 2O9KA 3MUOA 3V5WB 3SHFA 4GQ2P 3SJLD 4DNVA 2PM7B 2BKLA 5FFGA 4PSWB 3RMZD 3ULEC 3OKTA 3V9FA 4IMMA 1MDAH 1B9XA 2GC4A 2Z2OA 5AMSA 3GD1I 4PBZA 4O3UB 2XU7A 4CI2A 5H17A 2G9AA 4CZXA 3J81g 2HYEA 5K1CC 1I2MB 3UVLA 2VDPA 1RI6A 1GOGA 2Z2PA 2AH1A 2HU8A 4K3JB 5M5VA 3ZDZA 5GXIA 4O3TB 2AH0A 3KCIA 1B9YA 1H2ZA 3I7PA 4U1EI 3ZE0A 4BCDA 2B5LA 3RFGA 3N0DA 4N14A 4Y7RA 5TF2A 3IJ1A 5EM2B 3EU7A 3MVDK 1XHMA 4WK2A 5EMLB 3RSEC 2VDRA 1JMXB 3O4GA 3SVWD 3JAMg 1NEXB 4GM9A 5M5RA 4ERQA 4L1MA 3DXKC 3FM0A 4BP8A 3NVXA 1UOQA 2QC5A 4NAAA 3IUJA 4AN0A 3I89A 5K19A 4JSNC 3K27A 4I79A 3KRWB 1PEVA 4O02A 1SQJA 5AJAA 2CO0C 5M5UA 5M5SA 4J78A 4IA9A 1TYEA 4JHPC 4A0AA 1GP2B 1PI6A 1PBYB 4L3HD 4LGNA 2XZGA 1YR2A 3SMRA 2I0TA 2EIBA 5TDHB 4D6VA 2H6NA 4MMYA 1H2WA 5CYKA 4WJKA 2XL3A 4BCCA 1A0RB 2YB8B 4J73A 4J77A 4Z7NA 3MKQA 2OIZA 1C9LA 2MTAH 2P9PC 2VC2A 4BP9A 2GC7A 5FA5B 5CXCA 1VZ2A 3FCUA 4BH6A 3RLMD 3DDUA 2OK6A 3JZNA 1QFSA 5EARA 3UKRC 2I3SA 3AFCA 3VI4A 4A0BA 4G1MA 1GOTB 2EIDA 3O4JA 4NENA 4O45A 4O1QD 2XE4A 2P9KC 3V7DB 4K3ID 4A2MA 4J0WA 4J82A 2JKXA 3ODTA 3DXMC 4U7AA 4JSPC 2G99A 3GC3B 2AQ5A 2I3TA 1XIPA 5M5TA 5EAPA 4JT6C 1JOFA 5EAMA 3IUNA 3W15A 4H5JA 4QQEA 2AGLA 3FGBA 1TBGA 3PE7A 1U8CA 3ZE1A 3IJ0A 3O4HA 4H5IA 4AEZA 4CY1A 3SLED 2HJ4A 3NVNA 3EG6A 3OW8A 4A0AB 2WQ8A 4TZ4A 4J8BA 3EI4A 2I0RA 4GZ8A 4ES0A 4ZOYA 2H6KA 3K6SA 1K8KC 2CN3A 1JMZB 1UTCA 3F3PA 2Q7QA 2EIEA 4MMXA 5CYKB 3P4FA 4A11A 1L0QA 2QR5A 3T3PA 1VE6A 1SQ9A 1JTDB 2P9SC 4GQ1A 4FA4D 4GGAA 1ERJA 2VZ3A 2YMUA 1T2XA 2GNQA 3VA6A 3OKYA 5IJ8E 3MMYA 5CXCB 1YFQA 2PM9A 3GREA 5TEFA 2W18A 4A09A 1N6FA 4A0BB 3L4MD 4YVDA 4J81A 3SCYA 4IRZA 4J8GA 5FFOA 3ZWLB 4O9DA 2Z2NA 1VZ3A 4J0XA 4X61B 3SXTD 3JZGA 2HESX 5E6RA 4CY3A 4PXWA 3IKOA 3IUQA 3MKSB 2P9NC 2IUQA 5EALA 2VDKA 4G1EA 5KDOB 1N6DA 2H14A 1U4CA 4KFMB 4L9OA 5IGOA 4AN1A 2CNXA 3PXTD 4X3EA 4NC4A 2H47A 2J55H 2YBAA 4FAVD 5JWZA 3B7FA 4E54A 3IVMA 2B5NA 3IJCA 2VDMA 3UVOA 3EI4B 1TYQC 3IURA 3PSLA 2XDWA 5M61A 2P9LC 2H68A 3UVNA 1H2XA 3IUMA 2H9PA 3JPXA 4HDJA 3QI0A 1NR0A 5HE2B 4BUJC 2VZ1A 3SBPA 4WK0A 1QNIA 4CY5A 4UM9A 1E8NA 5IC7A 4FA5D 4GM3A 2VDOA 3EQ8A 3N0EA 3C9CA 3EQ7A 3RN0D 4CZYA 4FWWA 4UI9R 5GXHA 4RE5A 1O6GA 2H6QA 2PM9B 3VGZA 2XL2A 3KRXB 2OVQB 3EI1A 4A09B 4FB1D 5I5MA 4GMBA 3IIWA 3EI2A 3NIFA 2PM6B 4G56B 1UOPA 4WK4A 2OVPB 4AX4A 1U2VC 3F3FA 3I7HA 5A2Qg 5IT9g 5CXBA 4O2WA 3U4YA 4XEIC 3I7NA 2AGWA 4R7AB 3UVKA 1K3IA 3K71A 4CI8A 4AOWA 3MXXA 3J80g 3NVQA 3BG0A 4ERZA 5FKTA 3K26A 4E54B 3VH0A 3SBQA 2UZXB 4ZOXA 3AL9A 2YNNA 3FCSA 3HFQA 1PGUA 5EMMB 3RFHA 3JZHA 5IGQA 1O6FA 2IAAA 3CFVA 2I0SA 1JV2A 4DNUA 2OJYA 4BCBA 2OVRB 3O4IA 1H2YA 4MMZA 4Z7OA 1P22A 4A08A 5B4WA 2EICA 2YNPA 1GG2B 4NSXA 4BL0A 1M1XA 2YNOA 4AMZA 2BBKH 3EI1B 4A2LA 2J57G 3AH8B 3EI3A 4PSXB 5C9ZB 5C86A 5C2WB 3EI2B 4A7JA 1GOFA 1JJUB 1BPOA 4E5ZA 3I7KA 3BWSA 5SXMA 5C92A 5IJ7E 3L4OD 2IUPA 4ZN4A 5CXBB 1MG3A 5FKQA 5FQDA 3I7OA 3OL2A 2HKMA 3F3GA 3PXSD 3C5MA 3VI3A 5EMKB 3IJEA 2IURA 3JROA 3ORVD 4FA9D 5AFU3 4CZVA 2IWFA 4ERYA 3I8CA 5HE0B 1GOHA 2H9NA 1L5GA 4ZOZA 4LG9A 4J86A 2QZPA 5TEEA 4PBYA 2H9LA 4FAND 4CI1A 3SBRA 4PC0A 2XYIA 3C99A 2B5MA 2B4EA 4RE6A 4J84A 2H9MA 4XYHA 3PXWD 3AL8A 1C9IA 4JSXC 4A08B 3BG1A 4AMYA 3DM0A 2HU7A 4GGDA 4JD2C 3NIGA 4EWRA 2HXCA 2H3XA 3EWEA 2EBSA 1N6EA 3EI3B 4L3GD 5H1MA 3ZE2A 4XYIA 4GGCA 1VE7A 5GSAA 3CFSB 2VDNA 3V4VA 4GQBB 1FWXA 4E5ZB 2H13A 5THAA 2IUVA 4J87A 4UM8A 4A11B 1SHYB 4Z7QA 3NIDA 3OL2B 4CY2A 4DNWA 3JB9L 2AGZA 2CE8A 4OZUA 5GMKn 5FKRA 3OKYB 2AGYA 3OTTA 3GFCA 3MUNA 5EMJB 4X60B 3MZLA 4D0KA 5HE1B 4D9SA 1K32A 2CN2A 2P9UC 3T3MA 2PBIB 1QFMA 3UR4A 2VDQA 4OWRA 3FRXA 3AL8B 3PSCB 3SN6B 4GM8A 5HYNB 5HQGA 4JSVC 1OLZA 3RN1D 3V4PA 2HJBA 3OF7A 2OK4A 3ZDXA 3PVWB 4JT5C 5I5IA 5I5JA 3E0CA 4ZOVA 1R5MA
chains in the Genus database with same CATH topology
4ESGA 2AGXA 1S4UX 3CIKB 5FXYA 3SFZA 4QRJA 4QT8A 2BCJB 3IIYA 1GXRA 3DWLC 4Z8LA 3I8EA 3PVUB 2HKRA 3I2NA 2UZYB 4CI3A 3UKUC 2QXVA 4FHLA 5FLXg 4CC9A 4L1QD 2IWKA 1XKSA 5HE3B 3C75H 4FA1D 3EMHA 3SWSD 2J56H 1Q47A 2CE9A 3A0FA 4X63B 4QL1A 3RRMC 5H14A 3UVMA 4LG8A 4JXMA 3DSMA 4J79A 3I7LA 5FKSA 1VYHC 3JRPA 4PNKB 3OKWA 5EM2A 2CO0A 4Y5RD 1MG2A 4MK0B 3MZKA 1OMWB 2TRCB 2P9IC 5C2VB 2O9KA 3V5WB 3SHFA 4GQ2P 3SJLD 2PM7B 4PSWB 3RMZD 3ULEC 3OKTA 3V9FA 4IMMA 1B9XA 1MDAH 2GC4A 2Z2OA 5AMSA 4PBZA 4O3UB 2XU7A 4CI2A 5H17A 2G9AA 4CZXA 3J81g 2HYEA 5K1CC 3UVLA 1RI6A 2Z2PA 2AH1A 4K3JB 5GXIA 4O3TB 2AH0A 1B9YA 3I7PA 4U1EI 2B5LA 3RFGA 3N0DA 4N14A 4Y7RA 5TF2A 3IJ1A 5EM2B 3EU7A 1XHMA 5EMLB 3RSEC 1JMXB 3SVWD 3JAMg 1NEXB 4GM9A 4ERQA 3DXKC 3FM0A 3NVXA 2QC5A 3I89A 5K19A 4JSNC 3K27A 4I79A 3KRWB 1PEVA 5AJAA 1SQJA 2CO0C 4J78A 4IA9A 4A0AA 1GP2B 1PI6A 1PBYB 4L3HD 4LGNA 3SMRA 2I0TA 5TDHB 4D6VA 2H6NA 5CYKA 2XL3A 1A0RB 2YB8B 4J73A 4J77A 3MKQA 2OIZA 2MTAH 2P9PC 2GC7A 5FA5B 5CXCA 4BH6A 3RLMD 3JZNA 2OK6A 5EARA 3UKRC 2I3SA 3AFCA 4A0BA 1GOTB 4O45A 4O1QD 2P9KC 3V7DB 4K3ID 4A2MA 4J0WA 4J82A 3ODTA 3DXMC 4U7AA 4JSPC 2G99A 2AQ5A 2I3TA 1XIPA 5EAPA 4JT6C 1JOFA 5EAMA 3W15A 4H5JA 4QQEA 2AGLA 3FGBA 1TBGA 3PE7A 3IJ0A 4H5IA 4AEZA 4CY1A 3SLED 2HJ4A 3NVNA 3EG6A 3OW8A 4A0AB 4TZ4A 4J8BA 3EI4A 2I0RA 4GZ8A 4ES0A 4ZOYA 2H6KA 1K8KC 2CN3A 1JMZB 3F3PA 2Q7QA 5CYKB 3P4FA 4A11A 1L0QA 1SQ9A 2P9SC 4GQ1A 4FA4D 4GGAA 1ERJA 2YMUA 3VA6A 2GNQA 3OKYA 5IJ8E 3MMYA 5CXCB 1YFQA 2PM9A 3GREA 5TEFA 2W18A 4A09A 1N6FA 4A0BB 3L4MD 4YVDA 4J81A 3SCYA 4J8GA 3ZWLB 4O9DA 2Z2NA 4J0XA 4X61B 3SXTD 3JZGA 2HESX 4CY3A 4PXWA 3IKOA 3MKSB 2P9NC 2IUQA 5EALA 5KDOB 1N6DA 2H14A 1U4CA 4KFMB 4L9OA 5IGOA 2CNXA 3PXTD 4X3EA 2H47A 2J55H 2YBAA 4FAVD 5JWZA 3B7FA 4E54A 2B5NA 3IJCA 3UVOA 3EI4B 1TYQC 3PSLA 2P9LC 2H68A 3UVNA 2H9PA 3JPXA 4HDJA 1NR0A 5HE2B 4BUJC 3SBPA 1QNIA 4CY5A 5IC7A 4FA5D 4GM3A 3N0EA 3C9CA 3RN0D 4CZYA 4FWWA 4UI9R 5GXHA 3VGZA 2H6QA 2PM9B 2XL2A 3KRXB 2OVQB 3EI1A 4A09B 4FB1D 5I5MA 4GMBA 3IIWA 3EI2A 2PM6B 4G56B 2OVPB 1U2VC 3F3FA 3I7HA 5A2Qg 5IT9g 5CXBA 3U4YA 4XEIC 3I7NA 2AGWA 4R7AB 3UVKA 4CI8A 4AOWA 3MXXA 3J80g 3NVQA 3BG0A 4ERZA 5FKTA 3K26A 4E54B 3VH0A 3SBQA 2UZXB 4ZOXA 3AL9A 2YNNA 3HFQA 1PGUA 5EMMB 3RFHA 3JZHA 5IGQA 2IAAA 3CFVA 2I0SA 2OJYA 2OVRB 1P22A 4A08A 5B4WA 2YNPA 1GG2B 4NSXA 4BL0A 2YNOA 2BBKH 3EI1B 4A2LA 2J57G 3AH8B 3EI3A 4PSXB 5C9ZB 5C2WB 3EI2B 4A7JA 1JJUB 4E5ZA 3I7KA 3BWSA 5SXMA 5IJ7E 3L4OD 2IUPA 4ZN4A 5CXBB 1MG3A 5FKQA 5FQDA 3I7OA 3OL2A 2HKMA 3F3GA 3PXSD 3C5MA 5EMKB 2IURA 3JROA 3ORVD 4FA9D 5AFU3 4CZVA 2IWFA 4ERYA 3I8CA 5HE0B 2H9NA 4ZOZA 4LG9A 4J86A 5TEEA 4PBYA 2H9LA 4FAND 4CI1A 3SBRA 4PC0A 2XYIA 3C99A 2B5MA 2B4EA 4J84A 2H9MA 4XYHA 3PXWD 3AL8A 4JSXC 4A08B 3BG1A 3DM0A 4GGDA 4JD2C 4EWRA 2HXCA 2H3XA 3EWEA 2EBSA 1N6EA 3EI3B 4L3GD 5H1MA 4XYIA 4GGCA 5GSAA 3CFSB 4GQBB 1FWXA 4E5ZB 2H13A 5THAA 2IUVA 4J87A 4A11B 1SHYB 3OL2B 4CY2A 3JB9L 2AGZA 2CE8A 4OZUA 5GMKn 5FKRA 3OKYB 2AGYA 3OTTA 3GFCA 5EMJB 4X60B 3MZLA 4D0KA 5HE1B 1K32A 2CN2A 2P9UC 2PBIB 3UR4A 4OWRA 3FRXA 3AL8B 3PSCB 3SN6B 4GM8A 5HYNB 5HQGA 4JSVC 1OLZA 3RN1D 2HJBA 2OK4A 3PVWB 4JT5C 5I5IA 5I5JA 3E0CA 4ZOVA 1R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESG A;  2AGX A;  1S4U X;  3CIK B;  5FXY A;  3SFZ A;  4QRJ A;  4QT8 A;  2BCJ B;  3IIY A;  1GXR A;  3DWL C;  4Z8L A;  3I8E A;  3PVU B;  2HKR A;  3I2N A;  2UZY B;  4CI3 A;  3UKU C;  2QXV A;  4FHL A;  5FLX g;  4CC9 A;  4L1Q D;  2IWK A;  1XKS A;  5HE3 B;  3C75 H;  4FA1 D;  3EMH A;  3SWS D;  2J56 H;  1Q47 A;  2CE9 A;  3A0F A;  4X63 B;  4QL1 A;  3RRM C;  5H14 A;  3UVM A;  4LG8 A;  4JXM A;  3DSM A;  4J79 A;  3I7L A;  5FKS A;  1VYH C;  3JRP A;  4PNK B;  3OKW A;  5EM2 A;  2CO0 A;  4Y5R D;  1MG2 A;  4MK0 B;  3MZK A;  1OMW B;  2TRC B;  2P9I C;  5C2V B;  2O9K A;  3V5W B;  3SHF A;  4GQ2 P;  3SJL D;  2PM7 B;  4PSW B;  3RMZ D;  3ULE C;  3OKT A;  3V9F A;  4IMM A;  1B9X A;  1MDA H;  2GC4 A;  2Z2O A;  5AMS A;  4PBZ A;  4O3U B;  2XU7 A;  4CI2 A;  5H17 A;  2G9A A;  4CZX A;  3J81 g;  2HYE A;  5K1C C;  3UVL A;  1RI6 A;  2Z2P A;  2AH1 A;  4K3J B;  5GXI A;  4O3T B;  2AH0 A;  1B9Y A;  3I7P A;  4U1E I;  2B5L A;  3RFG A;  3N0D A;  4N14 A;  4Y7R A;  5TF2 A;  3IJ1 A;  5EM2 B;  3EU7 A;  1XHM A;  5EML B;  3RSE C;  1JMX B;  3SVW D;  3JAM g;  1NEX B;  4GM9 A;  4ERQ A;  3DXK C;  3FM0 A;  3NVX A;  2QC5 A;  3I89 A;  5K19 A;  4JSN C;  3K27 A;  4I79 A;  3KRW B;  1PEV A;  5AJA A;  1SQJ A;  2CO0 C;  4J78 A;  4IA9 A;  4A0A A;  1GP2 B;  1PI6 A;  1PBY B;  4L3H D;  4LGN A;  3SMR A;  2I0T A;  5TDH B;  4D6V A;  2H6N A;  5CYK A;  2XL3 A;  1A0R B;  2YB8 B;  4J73 A;  4J77 A;  3MKQ A;  2OIZ A;  2MTA H;  2P9P C;  2GC7 A;  5FA5 B;  5CXC A;  4BH6 A;  3RLM D;  3JZN A;  2OK6 A;  5EAR A;  3UKR C;  2I3S A;  3AFC A;  4A0B A;  1GOT B;  4O45 A;  4O1Q D;  2P9K C;  3V7D B;  4K3I D;  4A2M A;  4J0W A;  4J82 A;  3ODT A;  3DXM C;  4U7A A;  4JSP C;  2G99 A;  2AQ5 A;  2I3T A;  1XIP A;  5EAP A;  4JT6 C;  1JOF A;  5EAM A;  3W15 A;  4H5J A;  4QQE A;  2AGL A;  3FGB A;  1TBG A;  3PE7 A;  3IJ0 A;  4H5I A;  4AEZ A;  4CY1 A;  3SLE D;  2HJ4 A;  3NVN A;  3EG6 A;  3OW8 A;  4A0A B;  4TZ4 A;  4J8B A;  3EI4 A;  2I0R A;  4GZ8 A;  4ES0 A;  4ZOY A;  2H6K A;  1K8K C;  2CN3 A;  1JMZ B;  3F3P A;  2Q7Q A;  5CYK B;  3P4F A;  4A11 A;  1L0Q A;  1SQ9 A;  2P9S C;  4GQ1 A;  4FA4 D;  4GGA A;  1ERJ A;  2YMU A;  3VA6 A;  2GNQ A;  3OKY A;  5IJ8 E;  3MMY A;  5CXC B;  1YFQ A;  2PM9 A;  3GRE A;  5TEF A;  2W18 A;  4A09 A;  1N6F A;  4A0B B;  3L4M D;  4YVD A;  4J81 A;  3SCY A;  4J8G A;  3ZWL B;  4O9D A;  2Z2N A;  4J0X A;  4X61 B;  3SXT D;  3JZG A;  2HES X;  4CY3 A;  4PXW A;  3IKO A;  3MKS B;  2P9N C;  2IUQ A;  5EAL A;  5KDO B;  1N6D A;  2H14 A;  1U4C A;  4KFM B;  4L9O A;  5IGO A;  2CNX A;  3PXT D;  4X3E A;  2H47 A;  2J55 H;  2YBA A;  4FAV D;  5JWZ A;  3B7F A;  4E54 A;  2B5N A;  3IJC A;  3UVO A;  3EI4 B;  1TYQ C;  3PSL A;  2P9L C;  2H68 A;  3UVN A;  2H9P A;  3JPX A;  4HDJ A;  1NR0 A;  5HE2 B;  4BUJ C;  3SBP A;  1QNI A;  4CY5 A;  5IC7 A;  4FA5 D;  4GM3 A;  3N0E A;  3C9C A;  3RN0 D;  4CZY A;  4FWW A;  4UI9 R;  5GXH A;  3VGZ A;  2H6Q A;  2PM9 B;  2XL2 A;  3KRX B;  2OVQ B;  3EI1 A;  4A09 B;  4FB1 D;  5I5M A;  4GMB A;  3IIW A;  3EI2 A;  2PM6 B;  4G56 B;  2OVP B;  1U2V C;  3F3F A;  3I7H A;  5A2Q g;  5IT9 g;  5CXB A;  3U4Y A;  4XEI C;  3I7N A;  2AGW A;  4R7A B;  3UVK A;  4CI8 A;  4AOW A;  3MXX A;  3J80 g;  3NVQ A;  3BG0 A;  4ERZ A;  5FKT A;  3K26 A;  4E54 B;  3VH0 A;  3SBQ A;  2UZX B;  4ZOX A;  3AL9 A;  2YNN A;  3HFQ A;  1PGU A;  5EMM B;  3RFH A;  3JZH A;  5IGQ A;  2IAA A;  3CFV A;  2I0S A;  2OJY A;  2OVR B;  1P22 A;  4A08 A;  5B4W A;  2YNP A;  1GG2 B;  4NSX A;  4BL0 A;  2YNO A;  2BBK H;  3EI1 B;  4A2L A;  2J57 G;  3AH8 B;  3EI3 A;  4PSX B;  5C9Z B;  5C2W B;  3EI2 B;  4A7J A;  1JJU B;  4E5Z A;  3I7K A;  3BWS A;  5SXM A;  5IJ7 E;  3L4O D;  2IUP A;  4ZN4 A;  5CXB B;  1MG3 A;  5FKQ A;  5FQD A;  3I7O A;  3OL2 A;  2HKM A;  3F3G A;  3PXS D;  3C5M A;  5EMK B;  2IUR A;  3JRO A;  3ORV D;  4FA9 D;  5AFU 3;  4CZV A;  2IWF A;  4ERY A;  3I8C A;  5HE0 B;  2H9N A;  4ZOZ A;  4LG9 A;  4J86 A;  5TEE A;  4PBY A;  2H9L A;  4FAN D;  4CI1 A;  3SBR A;  4PC0 A;  2XYI A;  3C99 A;  2B5M A;  2B4E A;  4J84 A;  2H9M A;  4XYH A;  3PXW D;  3AL8 A;  4JSX C;  4A08 B;  3BG1 A;  3DM0 A;  4GGD A;  4JD2 C;  4EWR A;  2HXC A;  2H3X A;  3EWE A;  2EBS A;  1N6E A;  3EI3 B;  4L3G D;  5H1M A;  4XYI A;  4GGC A;  5GSA A;  3CFS B;  4GQB B;  1FWX A;  4E5Z B;  2H13 A;  5THA A;  2IUV A;  4J87 A;  4A11 B;  1SHY B;  3OL2 B;  4CY2 A;  3JB9 L;  2AGZ A;  2CE8 A;  4OZU A;  5GMK n;  5FKR A;  3OKY B;  2AGY A;  3OTT A;  3GFC A;  5EMJ B;  4X60 B;  3MZL A;  4D0K A;  5HE1 B;  1K32 A;  2CN2 A;  2P9U C;  2PBI B;  3UR4 A;  4OWR A;  3FRX A;  3AL8 B;  3PSC B;  3SN6 B;  4GM8 A;  5HYN B;  5HQG A;  4JSV C;  1OLZ A;  3RN1 D;  2HJB A;  2OK4 A;  3PVW B;  4JT5 C;  5I5I A;  5I5J A;  3E0C A;  4ZOV A;  1R5M A; 
#chains in the Genus database with same CATH topology
 4ESG A;  1E5T A;  2AGX A;  1S4U X;  3CIK B;  5FXY A;  3SFZ A;  4QRJ A;  4QT8 A;  2HU5 A;  5E6U A;  2BCJ B;  3IIY A;  4NBM A;  1GXR A;  1E8M A;  3DWL C;  1A12 A;  4Z8L A;  3I8E A;  3PVU B;  2HKR A;  3I2N A;  2UZY B;  4CI3 A;  3UKU C;  2QXV A;  3IUL A;  3K72 A;  4FHL A;  4G55 A;  5FLX g;  3ZDY A;  4CC9 A;  4L1Q D;  2IWK A;  1XKS A;  2VDL A;  5HE3 B;  3C75 H;  4FA1 D;  3EMH A;  3SWS D;  2J56 H;  1Q47 A;  2CE9 A;  3A0F A;  4X63 B;  4QL1 A;  3RRM C;  5H14 A;  3UVM A;  4LG8 A;  5E6S A;  4JXM A;  3DSM A;  4J79 A;  1UOO A;  5HDB A;  3EQ9 A;  3I7L A;  5FKS A;  1VYH C;  3JRP A;  4PNK B;  3QHY B;  3OKW A;  4JHN A;  4QAM A;  5EM2 A;  2CO0 A;  4Y5R D;  1MG2 A;  4MK0 B;  3MZK A;  1OMW B;  2TRC B;  2P9I C;  5C2V B;  2O9K A;  3MUO A;  3V5W B;  3SHF A;  4GQ2 P;  3SJL D;  4DNV A;  2PM7 B;  2BKL A;  5FFG A;  4PSW B;  3RMZ D;  3ULE C;  3OKT A;  3V9F A;  4IMM A;  1MDA H;  1B9X A;  2GC4 A;  2Z2O A;  5AMS A;  3GD1 I;  4PBZ A;  4O3U B;  2XU7 A;  4CI2 A;  5H17 A;  2G9A A;  4CZX A;  3J81 g;  2HYE A;  5K1C C;  1I2M B;  3UVL A;  2VDP A;  1RI6 A;  1GOG A;  2Z2P A;  2AH1 A;  2HU8 A;  4K3J B;  5M5V A;  3ZDZ A;  5GXI A;  4O3T B;  2AH0 A;  3KCI A;  1B9Y A;  1H2Z A;  3I7P A;  4U1E I;  3ZE0 A;  4BCD A;  2B5L A;  3RFG A;  3N0D A;  4N14 A;  4Y7R A;  5TF2 A;  3IJ1 A;  5EM2 B;  3EU7 A;  3MVD K;  1XHM A;  4WK2 A;  5EML B;  3RSE C;  2VDR A;  1JMX B;  3O4G A;  3SVW D;  3JAM g;  1NEX B;  4GM9 A;  5M5R A;  4ERQ A;  4L1M A;  3DXK C;  3FM0 A;  4BP8 A;  3NVX A;  1UOQ A;  2QC5 A;  4NAA A;  3IUJ A;  4AN0 A;  3I89 A;  5K19 A;  4JSN C;  3K27 A;  4I79 A;  3KRW B;  1PEV A;  4O02 A;  1SQJ A;  5AJA A;  2CO0 C;  5M5U A;  5M5S A;  4J78 A;  4IA9 A;  1TYE A;  4JHP C;  4A0A A;  1GP2 B;  1PI6 A;  1PBY B;  4L3H D;  4LGN A;  2XZG A;  1YR2 A;  3SMR A;  2I0T A;  2EIB A;  5TDH B;  4D6V A;  2H6N A;  4MMY A;  1H2W A;  5CYK A;  4WJK A;  2XL3 A;  4BCC A;  1A0R B;  2YB8 B;  4J73 A;  4J77 A;  4Z7N A;  3MKQ A;  2OIZ A;  1C9L A;  2MTA H;  2P9P C;  2VC2 A;  4BP9 A;  2GC7 A;  5FA5 B;  5CXC A;  1VZ2 A;  3FCU A;  4BH6 A;  3RLM D;  3DDU A;  2OK6 A;  3JZN A;  1QFS A;  5EAR A;  3UKR C;  2I3S A;  3AFC A;  3VI4 A;  4A0B A;  4G1M A;  1GOT B;  2EID A;  3O4J A;  4NEN A;  4O45 A;  4O1Q D;  2XE4 A;  2P9K C;  3V7D B;  4K3I D;  4A2M A;  4J0W A;  4J82 A;  2JKX A;  3ODT A;  3DXM C;  4U7A A;  4JSP C;  2G99 A;  3GC3 B;  2AQ5 A;  2I3T A;  1XIP A;  5M5T A;  5EAP A;  4JT6 C;  1JOF A;  5EAM A;  3IUN A;  3W15 A;  4H5J A;  4QQE A;  2AGL A;  3FGB A;  1TBG A;  3PE7 A;  1U8C A;  3ZE1 A;  3IJ0 A;  3O4H A;  4H5I A;  4AEZ A;  4CY1 A;  3SLE D;  2HJ4 A;  3NVN A;  3EG6 A;  3OW8 A;  4A0A B;  2WQ8 A;  4TZ4 A;  4J8B A;  3EI4 A;  2I0R A;  4GZ8 A;  4ES0 A;  4ZOY A;  2H6K A;  3K6S A;  1K8K C;  2CN3 A;  1JMZ B;  1UTC A;  3F3P A;  2Q7Q A;  2EIE A;  4MMX A;  5CYK B;  3P4F A;  4A11 A;  1L0Q A;  2QR5 A;  3T3P A;  1VE6 A;  1SQ9 A;  1JTD B;  2P9S C;  4GQ1 A;  4FA4 D;  4GGA A;  1ERJ A;  2VZ3 A;  2YMU A;  1T2X A;  2GNQ A;  3VA6 A;  3OKY A;  5IJ8 E;  3MMY A;  5CXC B;  1YFQ A;  2PM9 A;  3GRE A;  5TEF A;  2W18 A;  4A09 A;  1N6F A;  4A0B B;  3L4M D;  4YVD A;  4J81 A;  3SCY A;  4IRZ A;  4J8G A;  5FFO A;  3ZWL B;  4O9D A;  2Z2N A;  1VZ3 A;  4J0X A;  4X61 B;  3SXT D;  3JZG A;  2HES X;  5E6R A;  4CY3 A;  4PXW A;  3IKO A;  3IUQ A;  3MKS B;  2P9N C;  2IUQ A;  5EAL A;  2VDK A;  4G1E A;  5KDO B;  1N6D A;  2H14 A;  1U4C A;  4KFM B;  4L9O A;  5IGO A;  4AN1 A;  2CNX A;  3PXT D;  4X3E A;  4NC4 A;  2H47 A;  2J55 H;  2YBA A;  4FAV D;  5JWZ A;  3B7F A;  4E54 A;  3IVM A;  2B5N A;  3IJC A;  2VDM A;  3UVO A;  3EI4 B;  1TYQ C;  3IUR A;  3PSL A;  2XDW A;  5M61 A;  2P9L C;  2H68 A;  3UVN A;  1H2X A;  3IUM A;  2H9P A;  3JPX A;  4HDJ A;  3QI0 A;  1NR0 A;  5HE2 B;  4BUJ C;  2VZ1 A;  3SBP A;  4WK0 A;  1QNI A;  4CY5 A;  4UM9 A;  1E8N A;  5IC7 A;  4FA5 D;  4GM3 A;  2VDO A;  3EQ8 A;  3N0E A;  3C9C A;  3EQ7 A;  3RN0 D;  4CZY A;  4FWW A;  4UI9 R;  5GXH A;  4RE5 A;  1O6G A;  2H6Q A;  2PM9 B;  3VGZ A;  2XL2 A;  3KRX B;  2OVQ B;  3EI1 A;  4A09 B;  4FB1 D;  5I5M A;  4GMB A;  3IIW A;  3EI2 A;  3NIF A;  2PM6 B;  4G56 B;  1UOP A;  4WK4 A;  2OVP B;  4AX4 A;  1U2V C;  3F3F A;  3I7H A;  5A2Q g;  5IT9 g;  5CXB A;  4O2W A;  3U4Y A;  4XEI C;  3I7N A;  2AGW A;  4R7A B;  3UVK A;  1K3I A;  3K71 A;  4CI8 A;  4AOW A;  3MXX A;  3J80 g;  3NVQ A;  3BG0 A;  4ERZ A;  5FKT A;  3K26 A;  4E54 B;  3VH0 A;  3SBQ A;  2UZX B;  4ZOX A;  3AL9 A;  2YNN A;  3FCS A;  3HFQ A;  1PGU A;  5EMM B;  3RFH A;  3JZH A;  5IGQ A;  1O6F A;  2IAA A;  3CFV A;  2I0S A;  1JV2 A;  4DNU A;  2OJY A;  4BCB A;  2OVR B;  3O4I A;  1H2Y A;  4MMZ A;  4Z7O A;  1P22 A;  4A08 A;  5B4W A;  2EIC A;  2YNP A;  1GG2 B;  4NSX A;  4BL0 A;  1M1X A;  2YNO A;  4AMZ A;  2BBK H;  3EI1 B;  4A2L A;  2J57 G;  3AH8 B;  3EI3 A;  4PSX B;  5C9Z B;  5C86 A;  5C2W B;  3EI2 B;  4A7J A;  1GOF A;  1JJU B;  1BPO A;  4E5Z A;  3I7K A;  3BWS A;  5SXM A;  5C92 A;  5IJ7 E;  3L4O D;  2IUP A;  4ZN4 A;  5CXB B;  1MG3 A;  5FKQ A;  5FQD A;  3I7O A;  3OL2 A;  2HKM A;  3F3G A;  3PXS D;  3C5M A;  3VI3 A;  5EMK B;  3IJE A;  2IUR A;  3JRO A;  3ORV D;  4FA9 D;  5AFU 3;  4CZV A;  2IWF A;  4ERY A;  3I8C A;  5HE0 B;  1GOH A;  2H9N A;  1L5G A;  4ZOZ A;  4LG9 A;  4J86 A;  2QZP A;  5TEE A;  4PBY A;  2H9L A;  4FAN D;  4CI1 A;  3SBR A;  4PC0 A;  2XYI A;  3C99 A;  2B5M A;  2B4E A;  4RE6 A;  4J84 A;  2H9M A;  4XYH A;  3PXW D;  3AL8 A;  1C9I A;  4JSX C;  4A08 B;  3BG1 A;  4AMY A;  3DM0 A;  2HU7 A;  4GGD A;  4JD2 C;  3NIG A;  4EWR A;  2HXC A;  2H3X A;  3EWE A;  2EBS A;  1N6E A;  3EI3 B;  4L3G D;  5H1M A;  3ZE2 A;  4XYI A;  4GGC A;  1VE7 A;  5GSA A;  3CFS B;  2VDN A;  3V4V A;  4GQB B;  1FWX A;  4E5Z B;  2H13 A;  5THA A;  2IUV A;  4J87 A;  4UM8 A;  4A11 B;  1SHY B;  4Z7Q A;  3NID A;  3OL2 B;  4CY2 A;  4DNW A;  3JB9 L;  2AGZ A;  2CE8 A;  4OZU A;  5GMK n;  5FKR A;  3OKY B;  2AGY A;  3OTT A;  3GFC A;  3MUN A;  5EMJ B;  4X60 B;  3MZL A;  4D0K A;  5HE1 B;  4D9S A;  1K32 A;  2CN2 A;  2P9U C;  3T3M A;  2PBI B;  1QFM A;  3UR4 A;  2VDQ A;  4OWR A;  3FRX A;  3AL8 B;  3PSC B;  3SN6 B;  4GM8 A;  5HYN B;  5HQG A;  4JSV C;  1OLZ A;  3RN1 D;  3V4P A;  2HJB A;  3OF7 A;  2OK4 A;  3ZDX A;  3PVW B;  4JT5 C;  5I5I A;  5I5J A;  3E0C A;  4ZOV A;  1R5M A; 
#chains in the Genus database with same CATH homology
 4ESG A;  2AGX A;  1S4U X;  3CIK B;  5FXY A;  3SFZ A;  4QRJ A;  4QT8 A;  2BCJ B;  3IIY A;  1GXR A;  3DWL C;  4Z8L A;  3I8E A;  3PVU B;  2HKR A;  3I2N A;  2UZY B;  4CI3 A;  3UKU C;  2QXV A;  4FHL A;  5FLX g;  4CC9 A;  4L1Q D;  2IWK A;  1XKS A;  5HE3 B;  3C75 H;  4FA1 D;  3EMH A;  3SWS D;  2J56 H;  1Q47 A;  2CE9 A;  3A0F A;  4X63 B;  4QL1 A;  3RRM C;  5H14 A;  3UVM A;  4LG8 A;  4JXM A;  3DSM A;  4J79 A;  3I7L A;  5FKS A;  1VYH C;  3JRP A;  4PNK B;  3OKW A;  5EM2 A;  2CO0 A;  4Y5R D;  1MG2 A;  4MK0 B;  3MZK A;  1OMW B;  2TRC B;  2P9I C;  5C2V B;  2O9K A;  3V5W B;  3SHF A;  4GQ2 P;  3SJL D;  2PM7 B;  4PSW B;  3RMZ D;  3ULE C;  3OKT A;  3V9F A;  4IMM A;  1B9X A;  1MDA H;  2GC4 A;  2Z2O A;  5AMS A;  4PBZ A;  4O3U B;  2XU7 A;  4CI2 A;  5H17 A;  2G9A A;  4CZX A;  3J81 g;  2HYE A;  5K1C C;  3UVL A;  1RI6 A;  2Z2P A;  2AH1 A;  4K3J B;  5GXI A;  4O3T B;  2AH0 A;  1B9Y A;  3I7P A;  4U1E I;  2B5L A;  3RFG A;  3N0D A;  4N14 A;  4Y7R A;  5TF2 A;  3IJ1 A;  5EM2 B;  3EU7 A;  1XHM A;  5EML B;  3RSE C;  1JMX B;  3SVW D;  3JAM g;  1NEX B;  4GM9 A;  4ERQ A;  3DXK C;  3FM0 A;  3NVX A;  2QC5 A;  3I89 A;  5K19 A;  4JSN C;  3K27 A;  4I79 A;  3KRW B;  1PEV A;  5AJA A;  1SQJ A;  2CO0 C;  4J78 A;  4IA9 A;  4A0A A;  1GP2 B;  1PI6 A;  1PBY B;  4L3H D;  4LGN A;  3SMR A;  2I0T A;  5TDH B;  4D6V A;  2H6N A;  5CYK A;  2XL3 A;  1A0R B;  2YB8 B;  4J73 A;  4J77 A;  3MKQ A;  2OIZ A;  2MTA H;  2P9P C;  2GC7 A;  5FA5 B;  5CXC A;  4BH6 A;  3RLM D;  3JZN A;  2OK6 A;  5EAR A;  3UKR C;  2I3S A;  3AFC A;  4A0B A;  1GOT B;  4O45 A;  4O1Q D;  2P9K C;  3V7D B;  4K3I D;  4A2M A;  4J0W A;  4J82 A;  3ODT A;  3DXM C;  4U7A A;  4JSP C;  2G99 A;  2AQ5 A;  2I3T A;  1XIP A;  5EAP A;  4JT6 C;  1JOF A;  5EAM A;  3W15 A;  4H5J A;  4QQE A;  2AGL A;  3FGB A;  1TBG A;  3PE7 A;  3IJ0 A;  4H5I A;  4AEZ A;  4CY1 A;  3SLE D;  2HJ4 A;  3NVN A;  3EG6 A;  3OW8 A;  4A0A B;  4TZ4 A;  4J8B A;  3EI4 A;  2I0R A;  4GZ8 A;  4ES0 A;  4ZOY A;  2H6K A;  1K8K C;  2CN3 A;  1JMZ B;  3F3P A;  2Q7Q A;  5CYK B;  3P4F A;  4A11 A;  1L0Q A;  1SQ9 A;  2P9S C;  4GQ1 A;  4FA4 D;  4GGA A;  1ERJ A;  2YMU A;  3VA6 A;  2GNQ A;  3OKY A;  5IJ8 E;  3MMY A;  5CXC B;  1YFQ A;  2PM9 A;  3GRE A;  5TEF A;  2W18 A;  4A09 A;  1N6F A;  4A0B B;  3L4M D;  4YVD A;  4J81 A;  3SCY A;  4J8G A;  3ZWL B;  4O9D A;  2Z2N A;  4J0X A;  4X61 B;  3SXT D;  3JZG A;  2HES X;  4CY3 A;  4PXW A;  3IKO A;  3MKS B;  2P9N C;  2IUQ A;  5EAL A;  5KDO B;  1N6D A;  2H14 A;  1U4C A;  4KFM B;  4L9O A;  5IGO A;  2CNX A;  3PXT D;  4X3E A;  2H47 A;  2J55 H;  2YBA A;  4FAV D;  5JWZ A;  3B7F A;  4E54 A;  2B5N A;  3IJC A;  3UVO A;  3EI4 B;  1TYQ C;  3PSL A;  2P9L C;  2H68 A;  3UVN A;  2H9P A;  3JPX A;  4HDJ A;  1NR0 A;  5HE2 B;  4BUJ C;  3SBP A;  1QNI A;  4CY5 A;  5IC7 A;  4FA5 D;  4GM3 A;  3N0E A;  3C9C A;  3RN0 D;  4CZY A;  4FWW A;  4UI9 R;  5GXH A;  3VGZ A;  2H6Q A;  2PM9 B;  2XL2 A;  3KRX B;  2OVQ B;  3EI1 A;  4A09 B;  4FB1 D;  5I5M A;  4GMB A;  3IIW A;  3EI2 A;  2PM6 B;  4G56 B;  2OVP B;  1U2V C;  3F3F A;  3I7H A;  5A2Q g;  5IT9 g;  5CXB A;  3U4Y A;  4XEI C;  3I7N A;  2AGW A;  4R7A B;  3UVK A;  4CI8 A;  4AOW A;  3MXX A;  3J80 g;  3NVQ A;  3BG0 A;  4ERZ A;  5FKT A;  3K26 A;  4E54 B;  3VH0 A;  3SBQ A;  2UZX B;  4ZOX A;  3AL9 A;  2YNN A;  3HFQ A;  1PGU A;  5EMM B;  3RFH A;  3JZH A;  5IGQ A;  2IAA A;  3CFV A;  2I0S A;  2OJY A;  2OVR B;  1P22 A;  4A08 A;  5B4W A;  2YNP A;  1GG2 B;  4NSX A;  4BL0 A;  2YNO A;  2BBK H;  3EI1 B;  4A2L A;  2J57 G;  3AH8 B;  3EI3 A;  4PSX B;  5C9Z B;  5C2W B;  3EI2 B;  4A7J A;  1JJU B;  4E5Z A;  3I7K A;  3BWS A;  5SXM A;  5IJ7 E;  3L4O D;  2IUP A;  4ZN4 A;  5CXB B;  1MG3 A;  5FKQ A;  5FQD A;  3I7O A;  3OL2 A;  2HKM A;  3F3G A;  3PXS D;  3C5M A;  5EMK B;  2IUR A;  3JRO A;  3ORV D;  4FA9 D;  5AFU 3;  4CZV A;  2IWF A;  4ERY A;  3I8C A;  5HE0 B;  2H9N A;  4ZOZ A;  4LG9 A;  4J86 A;  5TEE A;  4PBY A;  2H9L A;  4FAN D;  4CI1 A;  3SBR A;  4PC0 A;  2XYI A;  3C99 A;  2B5M A;  2B4E A;  4J84 A;  2H9M A;  4XYH A;  3PXW D;  3AL8 A;  4JSX C;  4A08 B;  3BG1 A;  3DM0 A;  4GGD A;  4JD2 C;  4EWR A;  2HXC A;  2H3X A;  3EWE A;  2EBS A;  1N6E A;  3EI3 B;  4L3G D;  5H1M A;  4XYI A;  4GGC A;  5GSA A;  3CFS B;  4GQB B;  1FWX A;  4E5Z B;  2H13 A;  5THA A;  2IUV A;  4J87 A;  4A11 B;  1SHY B;  3OL2 B;  4CY2 A;  3JB9 L;  2AGZ A;  2CE8 A;  4OZU A;  5GMK n;  5FKR A;  3OKY B;  2AGY A;  3OTT A;  3GFC A;  5EMJ B;  4X60 B;  3MZL A;  4D0K A;  5HE1 B;  1K32 A;  2CN2 A;  2P9U C;  2PBI B;  3UR4 A;  4OWR A;  3FRX A;  3AL8 B;  3PSC B;  3SN6 B;  4GM8 A;  5HYN B;  5HQG A;  4JSV C;  1OLZ A;  3RN1 D;  2HJB A;  2OK4 A;  3PVW B;  4JT5 C;  5I5I A;  5I5J A;  3E0C A;  4ZOV A;  1R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...