1JMXB

Crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
346
structure length
339
Chain Sequence
GPALKAGHEYMIVTNYPNNLHVVDVASDTVYKSCVMPDKFGPGTAMMAPDNRTAYVLNNHYGDIYGIDLDTCKNTFHANLSSVPGEVGRSMYSFAISPDGKEVYATVNPTQRLNDHYVVKPPRLEVFSTADGLEAKPVRTFPMPRQVYLMRAADDGSLYVAGPDIYKMDVKTGKYTVALPLRNWNRKGYSAPDVLYFWPHQSPRHEFSMLYTIARFATADLLYGYLSVDLKTGKTHTQEFADLTELYFTGLRSPKDPNQIYGVLNRLAKYDLKQRKLIKAANLDHTYYCVAFDKKGDKLYLGGTFNDLAVFNPDTLEKVKNIKLPGGDMSTTTPQVFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Amine Dehydrogenase
publication title Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges.
pubmed doi rcsb
total genus 87
structure length 339
sequence length 346
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1jmxB00
3JZGA 3JZNA 5CXCA 4CY5A 4IMMA 2H47A 4J8BA 3UVNA 1PGUA 2B4EA 3AL9A 3N0DA 4XEIC 4FWWA 4J73A 1FWXA 2AGLA 2I3SA 2PM9B 3I2NA 4ERYA 4ZN4A 3U4YA 4H5IA 3MKSB 2P9UC 5KDOB 4JD2C 4LG9A 4PC0A 1N6EA 3RSEC 1MG3A 3GFCA 3VH0A 5TF2A 4J0WA 4JT5C 3SMRA 3ODTA 2XU7A 1K32A 4L3HD 2PM6B 4K3JB 1A0RB 4GM8A 5H1MA 2I0SA 3ZWLB 2H6KA 3SXTD 4L3GD 1L0QA 2P9SC 3VGZA 2IUPA 3I7OA 4O3UB 4A08A 1OMWB 4LG8A 1QNIA 3PXTD 3IJ1A 2H9LA 2H3XA 2OVQB 5I5IA 1JMXB 5HE1B 4JSPC 3UVLA 4X3EA 4OZUA 3RFGA 3F3FA 4OWRA 5HQGA 2H6QA 3C5MA 4O1QD 4HDJA 4ZOZA 3JRPA 3J81g 4JSVC 3FRXA 4CY3A 3SBQA 4AOWA 2OIZA 3OL2B 5EAPA 3SVWD 2CNXA 2Z2OA 3NVNA 4CI2A 2H6NA 3OKTA 4LGNA 2BBKH 3GREA 5H14A 2J55H 3EMHA 4QL1A 1SQ9A 2MTAH 2OJYA 2B5MA 4L1QD 4D6VA 2IUVA 2P9PC 4ERZA 4R7AB 3I7HA 5GMKn 2CE9A 4E54B 3IJCA 4J87A 3PSCB 1GG2B 3HFQA 3C99A 4K3ID 5GXIA 4GM3A 5CXCB 4FAND 3OL2A 1PI6A 2H9NA 2HESX 3IIWA 4EWRA 2IUQA 3I8EA 3EI2A 5FKRA 3UR4A 4ZOYA 4KFMB 4NSXA 2CE8A 4FA5D 5EMJB 2YNNA 4J81A 4FAVD 2IURA 4CY1A 3RFHA 5HE2B 3I7NA 4ZOVA 5H17A 2HKMA 4UI9R 4CY2A 2J56H 4U7AA 3ORVD 5EMLB 2XL3A 1OLZA 1JMZB 3RRMC 5GSAA 4A2LA 4GGAA 2H68A 4Z8LA 3RN1D 3E0CA 2UZYB 4I79A 4GM9A 2IWFA 4O3TB 5FXYA 5FKSA 2HJBA 4A08B 4CI3A 3JPXA 5IT9g 4MK0B 5B4WA 1JOFA 3KRXB 4E5ZB 4O9DA 4GGDA 4XYHA 4A0AB 2TRCB 4BL0A 5GXHA 1VYHC 3BG1A 4JT6C 3OW8A 4J79A 2HXCA 2AH0A 2G99A 2YMUA 4J77A 3B7FA 3MZLA 2P9NC 4ES0A 4QT8A 4QRJA 2I0TA 2AQ5A 5TEFA 2EBSA 3AH8B 4CI1A 3PSLA 3C75H 3RMZD 4E5ZA 3EI4B 3AL8A 4AEZA 4A0AA 3MZKA 5IJ7E 4ESGA 4A2MA 2H14A 3MMYA 5HYNB 5I5JA 4A7JA 4PBYA 3IKOA 4J84A 3J80g 2CN3A 4O45A 3SBRA 3SLED 3V9FA 3UVOA 3EI2B 5AMSA 1PBYB 3CFVA 1SQJA 3DXKC 1PEVA 3N0EA 2YNOA 2O9KA 5EMMB 4X63B 4A0BB 5TEEA 3V7DB 5CXBA 3CFSB 3EI4A 4Y7RA 3I89A 4FA4D 4A11B 5EARA 1TYQC 2AH1A 2H9PA 5IGQA 3EU7A 5CYKB 3I7PA 3V5WB 1XKSA 2OVRB 2AGZA 2PBIB 3SCYA 3KRWB 5K1CC 2GNQA 2QC5A 3VA6A 3EG6A 2H9MA 4PBZA 4A0BA 2P9LC 3DSMA 3OKWA 3SN6B 4CZYA 3JB9L 2GC4A 1MG2A 2XL2A 3IIYA 3BWSA 1SHYB 5THAA 4GQ1A 5CYKA 2Z2PA 4J82A 5TDHB 1GP2B 1P22A 3EWEA 4X60B 2PM7B 4CZVA 2HJ4A 1K8KC 4CC9A 5FKQA 5A2Qg 3SWSD 4PSXB 4PSWB 1N6FA 3I8CA 4IA9A 2GC7A 3F3GA 4PNKB 3SJLD 4JSNC 4X61B 2CO0C 2OVPB 5FQDA 1RI6A 5EM2B 3EI1B 5FLXg 4GQ2P 1Q47A 4ZOXA 2B5LA 2Q7QA 3PE7A 5AJAA 2I3TA 4PXWA 3SFZA 4BH6A 2G9AA 3F3PA 4FHLA 4CI8A 4GQBB 4FA9D 3P4FA 4TZ4A 3UKRC 2CO0A 2XYIA 3L4OD 3JROA 5IC7A 1MDAH 2I0RA 5HE0B 3AL8B 3PXSD 4U1EI 5C2VB 3IJ0A 4A09B 5EM2A 3EI1A 3I7KA 2CN2A 5IJ8E 5JWZA 3OKYB 4A11A 1XHMA 4ERQA 5K19A 2AGXA 1B9YA 3RN0D 4J8GA 2IWKA 1U2VC 2J57G 4JSXC 2P9KC 4H5JA 4N14A 4FB1D 5EALA 4GZ8A 2IAAA 3RLMD 4J78A 5CXBB 5EMKB 1NEXB 1R5MA 4GGCA 3JZHA 2PM9A 5IGOA 1B9XA 3C9CA 3JAMg 4A09A 4XYIA 3A0FA 3DXMC 3PVUB 3OKYA 4Y5RD 1U4CA 5I5MA 1JJUB 5FA5B 3NVQA 2B5NA 2OK4A 2UZXB 4GMBA 4J86A 2YB8B 3FM0A 3SHFA 4CZXA 3SBPA 5HE3B 2HKRA 1TBGA 2AGYA 3AFCA 5SXMA 4BUJC 3NVXA 3BG0A 3MKQA 3CIKB 2W18A 1YFQA 4FA1D 3EI3B 4J0XA 3UVMA 5FKTA 1ERJA 2BCJB 1S4UX 2OK6A 3DM0A 1NR0A 4L9OA 3UVKA 1GXRA 5AFU3 2H13A 1XIPA 3I7LA 3PVWB 3FGBA 3PXWD 3MXXA 3DWLC 1N6DA 4G56B 3UKUC 3ULEC 4QQEA 5C9ZB 2P9IC 2QXVA 2YBAA 4JXMA 5C2WB 2AGWA 3EI3A 3W15A 4YVDA 3OTTA 4D0KA 4E54A 3L4MD 5EAMA 3K27A 2HYEA 3K26A 2YNPA 1GOTB 2Z2NA
chains in the Genus database with same CATH superfamily
2EIEA 3JZGA 5E6RA 2VDRA 3JZNA 1JV2A 5CXCA 4CY5A 4IMMA 2H47A 4J8BA 3UVNA 1PGUA 2B4EA 3AL9A 3O4JA 3GD1I 3N0DA 4XEIC 4FWWA 4J73A 4IRZA 1FWXA 2AGLA 2I3SA 2PM9B 3I2NA 2VDKA 4ERYA 4ZN4A 3U4YA 4H5IA 3MKSB 2P9UC 3DDUA 5KDOB 4JD2C 4LG9A 4NENA 2XE4A 4PC0A 1N6EA 3VI4A 3RSEC 1MG3A 1L5GA 4WK0A 1TYEA 4BP9A 3GFCA 4DNVA 3VH0A 4WK2A 5TF2A 4J0WA 4JT5C 3SMRA 1QFSA 3ODTA 2XU7A 1E5TA 3V4PA 1K32A 4L3HD 2PM6B 4K3JB 1A0RB 4GM8A 5H1MA 2I0SA 2JKXA 3ZWLB 3MUOA 1UOPA 2H6KA 4RE5A 3SXTD 1GOHA 1L0QA 2P9SC 2VDLA 4L3GD 3VGZA 2IUPA 3I7OA 4O3UB 4A08A 1OMWB 4LG8A 1QNIA 3PXTD 4AN1A 1VZ2A 3IJ1A 2H9LA 2H3XA 2OVQB 5I5IA 1JMXB 5HE1B 4JSPC 3UVLA 2WQ8A 4OZUA 4X3EA 3RFGA 3F3FA 3ZDZA 4OWRA 1VE6A 5HQGA 2H6QA 3C5MA 4O1QD 4HDJA 4ZOZA 3JRPA 3ZE2A 3J81g 4JSVC 3FRXA 1UOQA 4CY3A 3SBQA 4AOWA 2OIZA 3OL2B 5EAPA 3SVWD 2CNXA 2Z2OA 3NVNA 2HU7A 3ZDYA 4CI2A 2H6NA 3OKTA 4LGNA 2BBKH 3GREA 5H14A 2J55H 3EMHA 4QL1A 1SQ9A 2MTAH 2OJYA 2B5MA 3FCSA 4MMYA 4L1QD 4D6VA 2IUVA 2P9PC 2VDMA 4ERZA 4R7AB 3I7HA 5GMKn 2CE9A 4E54B 4MMXA 3IJCA 4J87A 3PSCB 4AMYA 1GG2B 3HFQA 4NC4A 3IUJA 3C99A 4O2WA 2EIDA 4K3ID 5GXIA 4GM3A 5CXCB 4FAND 3OL2A 1PI6A 2H9NA 2HESX 3IIWA 1H2WA 4EWRA 2IUQA 3I8EA 3EI2A 5FKRA 3UR4A 4ZOYA 4NBMA 4KFMB 5M5VA 1E8NA 4NSXA 2CE8A 4AMZA 4FA5D 5EMJB 2YNNA 4J81A 1GOFA 5FFGA 4FAVD 2IURA 4CY1A 3RFHA 5HE2B 3I7NA 3MUNA 3O4HA 4ZOVA 5H17A 4JHPC 5C92A 2HKMA 4UI9R 4CY2A 2J56H 1O6FA 4U7AA 3ORVD 5EMLB 3K6SA 2XL3A 1OLZA 1JMZB 5HDBA 3RRMC 4NAAA 5C86A 5M5RA 5GSAA 4A2LA 4GGAA 2H68A 1T2XA 4Z8LA 3RN1D 3E0CA 2UZYB 4DNWA 4I79A 3O4IA 4GM9A 2IWFA 4O3TB 5FXYA 5FKSA 2HJBA 4A08B 3NIDA 4CI3A 3JPXA 5IT9g 2VC2A 4MK0B 5E6UA 5B4WA 1JOFA 3KRXB 4E5ZB 4O9DA 4GGDA 4XYHA 4A0AB 3O4GA 1C9IA 2TRCB 4BL0A 5GXHA 1VYHC 1BPOA 3BG1A 4JT6C 3OW8A 4J79A 2HXCA 2VDPA 2AH0A 2G99A 2YMUA 3IURA 4J77A 3B7FA 3MZLA 3QHYB 2P9NC 4ES0A 4QT8A 4QRJA 2I0TA 2AQ5A 5TEFA 1H2YA 2EBSA 1U8CA 3FCUA 3ZE1A 3AH8B 4CI1A 2EIBA 3PSLA 3C75H 3RMZD 4E5ZA 3EI4B 3AL8A 4AEZA 4A0AA 3MZKA 5IJ7E 4ESGA 4QAMA 4A2MA 2H14A 3MMYA 5HYNB 5I5JA 4A7JA 3EQ9A 3IKOA 4PBYA 4J84A 3J80g 2CN3A 4O45A 3SBRA 3EQ7A 3SLED 1K3IA 3V9FA 3UVOA 3EI2B 5AMSA 1PBYB 3CFVA 1SQJA 3IVMA 3DXKC 4G55A 1PEVA 3N0EA 2YNOA 2O9KA 5EMMB 4X63B 4A0BB 1I2MB 5TEEA 3V7DB 5CXBA 3CFSB 3EI4A 4Y7RA 3I89A 4FA4D 4A11B 5EARA 1TYQC 2AH1A 1UOOA 2H9PA 5IGQA 3EU7A 5CYKB 3I7PA 3V5WB 1XKSA 2OVRB 2AGZA 2PBIB 3SCYA 4D9SA 3KRWB 5K1CC 2GNQA 2QC5A 3VA6A 3EG6A 3T3MA 2H9MA 4PBZA 4UM9A 4A0BA 2P9LC 3GC3B 3DSMA 3OKWA 2XZGA 3VI3A 3SN6B 3K72A 4CZYA 4G1EA 3JB9L 2GC4A 1MG2A 2XL2A 3IIYA 3BWSA 1SHYB 5THAA 4GQ1A 5CYKA 2Z2PA 4J82A 5TDHB 1GP2B 1P22A 1GOGA 3EWEA 4X60B 4AN0A 2PM7B 4CZVA 2HJ4A 1K8KC 4WJKA 4CC9A 3IULA 5FKQA 5A2Qg 3SWSD 4PSXB 4PSWB 2EICA 1N6FA 3I8CA 4IA9A 2GC7A 3F3GA 4PNKB 3SJLD 4Z7QA 4JSNC 4X61B 2CO0C 2OVPB 5FQDA 2VDQA 1RI6A 5EM2B 3EI1B 5FLXg 4GQ2P 1Q47A 2XDWA 4ZOXA 2B5LA 2Q7QA 3PE7A 5AJAA 2I3TA 1VZ3A 4PXWA 3SFZA 1H2XA 4BH6A 2G9AA 3F3PA 4FHLA 4CI8A 3ZDXA 4GQBB 4FA9D 3P4FA 4TZ4A 3UKRC 2CO0A 2XYIA 3L4OD 3JROA 3KCIA 5IC7A 4L1MA 3EQ8A 1MDAH 2I0RA 5HE0B 3AL8B 3PXSD 3NIFA 4U1EI 5C2VB 3K71A 3IJ0A 4A09B 4UM8A 5EM2A 3EI1A 2QZPA 3IUQA 3I7KA 1QFMA 2CN2A 5IJ8E 5JWZA 3OKYB 4A11A 1XHMA 4JHNA 4ERQA 2AGXA 1B9YA 3QI0A 2VDNA 3RN0D 5K19A 5M61A 4Z7NA 4J8GA 1O6GA 2IWKA 1U2VC 2J57G 5E6SA 3IUMA 4JSXC 2P9KC 1YR2A 4H5JA 4N14A 4FB1D 5EALA 4GZ8A 2IAAA 3RLMD 4J78A 5CXBB 5EMKB 1NEXB 1R5MA 4GGCA 3JZHA 2PM9A 1JTDB 5IGOA 1B9XA 3C9CA 3JAMg 4A09A 4XYIA 4BCBA 1UTCA 3MVDK 3A0FA 3DXMC 3PVUB 3OKYA 4Y5RD 1U4CA 5I5MA 5M5TA 1JJUB 5FA5B 3NVQA 5M5UA 1VE7A 1H2ZA 2B5NA 2OK4A 2UZXB 4GMBA 4J86A 2YB8B 3FM0A 3SHFA 4CZXA 4DNUA 1A12A 4O02A 4RE6A 3SBPA 5HE3B 2HKRA 1TBGA 2AGYA 3AFCA 5SXMA 4BUJC 3NVXA 3BG0A 3MKQA 1E8MA 3CIKB 4BCCA 2W18A 1YFQA 3V4VA 4FA1D 3EI3B 4J0XA 2VDOA 3UVMA 5FKTA 1ERJA 2BCJB 1S4UX 1M1XA 4G1MA 3NIGA 2OK6A 3DM0A 1NR0A 4L9OA 3UVKA 4BCDA 1GXRA 5AFU3 2H13A 1XIPA 3I7LA 3PVWB 3FGBA 3PXWD 3MXXA 3DWLC 1N6DA 4G56B 3UKUC 3IUNA 3ZE0A 3ULEC 2HU5A 4QQEA 5C9ZB 4BP8A 2P9IC 1C9LA 4AX4A 2QXVA 4Z7OA 2YBAA 5FFOA 4JXMA 5C2WB 4MMZA 2AGWA 3EI3A 2VZ3A 4WK4A 3IJEA 3W15A 4YVDA 3OTTA 3T3PA 4D0KA 2BKLA 5M5SA 4E54A 3L4MD 2HU8A 3K27A 5EAMA 2HYEA 3K26A 2YNPA 1GOTB 2QR5A 2Z2NA 2VZ1A 3OF7A
chains in the Genus database with same CATH topology
3JZGA 3JZNA 5CXCA 4CY5A 4IMMA 2H47A 4J8BA 3UVNA 1PGUA 2B4EA 3AL9A 3N0DA 4XEIC 4FWWA 4J73A 1FWXA 2AGLA 2I3SA 2PM9B 3I2NA 4ERYA 4ZN4A 3U4YA 4H5IA 3MKSB 2P9UC 5KDOB 4JD2C 4LG9A 4PC0A 1N6EA 3RSEC 1MG3A 3GFCA 3VH0A 5TF2A 4J0WA 4JT5C 3SMRA 3ODTA 2XU7A 1K32A 4L3HD 2PM6B 4K3JB 1A0RB 4GM8A 5H1MA 2I0SA 3ZWLB 2H6KA 3SXTD 4L3GD 1L0QA 2P9SC 3VGZA 2IUPA 3I7OA 4O3UB 4A08A 1OMWB 4LG8A 1QNIA 3PXTD 3IJ1A 2H9LA 2H3XA 2OVQB 5I5IA 1JMXB 5HE1B 4JSPC 3UVLA 4X3EA 4OZUA 3RFGA 3F3FA 4OWRA 5HQGA 2H6QA 3C5MA 4O1QD 4HDJA 4ZOZA 3JRPA 3J81g 4JSVC 3FRXA 4CY3A 3SBQA 4AOWA 2OIZA 3OL2B 5EAPA 3SVWD 2CNXA 2Z2OA 3NVNA 4CI2A 2H6NA 3OKTA 4LGNA 2BBKH 3GREA 5H14A 2J55H 3EMHA 4QL1A 1SQ9A 2MTAH 2OJYA 2B5MA 4L1QD 4D6VA 2IUVA 2P9PC 4ERZA 4R7AB 3I7HA 5GMKn 2CE9A 4E54B 3IJCA 4J87A 3PSCB 1GG2B 3HFQA 3C99A 4K3ID 5GXIA 4GM3A 5CXCB 4FAND 3OL2A 1PI6A 2H9NA 2HESX 3IIWA 4EWRA 2IUQA 3I8EA 3EI2A 5FKRA 3UR4A 4ZOYA 4KFMB 4NSXA 2CE8A 4FA5D 5EMJB 2YNNA 4J81A 4FAVD 2IURA 4CY1A 3RFHA 5HE2B 3I7NA 4ZOVA 5H17A 2HKMA 4UI9R 4CY2A 2J56H 4U7AA 3ORVD 5EMLB 2XL3A 1OLZA 1JMZB 3RRMC 5GSAA 4A2LA 4GGAA 2H68A 4Z8LA 3RN1D 3E0CA 2UZYB 4I79A 4GM9A 2IWFA 4O3TB 5FXYA 5FKSA 2HJBA 4A08B 4CI3A 3JPXA 5IT9g 4MK0B 5B4WA 1JOFA 3KRXB 4E5ZB 4O9DA 4GGDA 4XYHA 4A0AB 2TRCB 4BL0A 5GXHA 1VYHC 3BG1A 4JT6C 3OW8A 4J79A 2HXCA 2AH0A 2G99A 2YMUA 4J77A 3B7FA 3MZLA 2P9NC 4ES0A 4QT8A 4QRJA 2I0TA 2AQ5A 5TEFA 2EBSA 3AH8B 4CI1A 3PSLA 3C75H 3RMZD 4E5ZA 3EI4B 3AL8A 4AEZA 4A0AA 3MZKA 5IJ7E 4ESGA 4A2MA 2H14A 3MMYA 5HYNB 5I5JA 4A7JA 4PBYA 3IKOA 4J84A 3J80g 2CN3A 4O45A 3SBRA 3SLED 3V9FA 3UVOA 3EI2B 5AMSA 1PBYB 3CFVA 1SQJA 3DXKC 1PEVA 3N0EA 2YNOA 2O9KA 5EMMB 4X63B 4A0BB 5TEEA 3V7DB 5CXBA 3CFSB 3EI4A 4Y7RA 3I89A 4FA4D 4A11B 5EARA 1TYQC 2AH1A 2H9PA 5IGQA 3EU7A 5CYKB 3I7PA 3V5WB 1XKSA 2OVRB 2AGZA 2PBIB 3SCYA 3KRWB 5K1CC 2GNQA 2QC5A 3VA6A 3EG6A 2H9MA 4PBZA 4A0BA 2P9LC 3DSMA 3OKWA 3SN6B 4CZYA 3JB9L 2GC4A 1MG2A 2XL2A 3IIYA 3BWSA 1SHYB 5THAA 4GQ1A 5CYKA 2Z2PA 4J82A 5TDHB 1GP2B 1P22A 3EWEA 4X60B 2PM7B 4CZVA 2HJ4A 1K8KC 4CC9A 5FKQA 5A2Qg 3SWSD 4PSXB 4PSWB 1N6FA 3I8CA 4IA9A 2GC7A 3F3GA 4PNKB 3SJLD 4JSNC 4X61B 2CO0C 2OVPB 5FQDA 1RI6A 5EM2B 3EI1B 5FLXg 4GQ2P 1Q47A 4ZOXA 2B5LA 2Q7QA 3PE7A 5AJAA 2I3TA 4PXWA 3SFZA 4BH6A 2G9AA 3F3PA 4FHLA 4CI8A 4GQBB 4FA9D 3P4FA 4TZ4A 3UKRC 2CO0A 2XYIA 3L4OD 3JROA 5IC7A 1MDAH 2I0RA 5HE0B 3AL8B 3PXSD 4U1EI 5C2VB 3IJ0A 4A09B 5EM2A 3EI1A 3I7KA 2CN2A 5IJ8E 5JWZA 3OKYB 4A11A 1XHMA 4ERQA 5K19A 2AGXA 1B9YA 3RN0D 4J8GA 2IWKA 1U2VC 2J57G 4JSXC 2P9KC 4H5JA 4N14A 4FB1D 5EALA 4GZ8A 2IAAA 3RLMD 4J78A 5CXBB 5EMKB 1NEXB 1R5MA 4GGCA 3JZHA 2PM9A 5IGOA 1B9XA 3C9CA 3JAMg 4A09A 4XYIA 3A0FA 3DXMC 3PVUB 3OKYA 4Y5RD 1U4CA 5I5MA 1JJUB 5FA5B 3NVQA 2B5NA 2OK4A 2UZXB 4GMBA 4J86A 2YB8B 3FM0A 3SHFA 4CZXA 3SBPA 5HE3B 2HKRA 1TBGA 2AGYA 3AFCA 5SXMA 4BUJC 3NVXA 3BG0A 3MKQA 3CIKB 2W18A 1YFQA 4FA1D 3EI3B 4J0XA 3UVMA 5FKTA 1ERJA 2BCJB 1S4UX 2OK6A 3DM0A 1NR0A 4L9OA 3UVKA 1GXRA 5AFU3 2H13A 1XIPA 3I7LA 3PVWB 3FGBA 3PXWD 3MXXA 3DWLC 1N6DA 4G56B 3UKUC 3ULEC 4QQEA 5C9ZB 2P9IC 2QXVA 2YBAA 4JXMA 5C2WB 2AGWA 3EI3A 3W15A 4YVDA 3OTTA 4D0KA 4E54A 3L4MD 5EAMA 3K27A 2HYEA 3K26A 2YNPA 1GOTB 2Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZG A;  3JZN A;  5CXC A;  4CY5 A;  4IMM A;  2H47 A;  4J8B A;  3UVN A;  1PGU A;  2B4E A;  3AL9 A;  3N0D A;  4XEI C;  4FWW A;  4J73 A;  1FWX A;  2AGL A;  2I3S A;  2PM9 B;  3I2N A;  4ERY A;  4ZN4 A;  3U4Y A;  4H5I A;  3MKS B;  2P9U C;  5KDO B;  4JD2 C;  4LG9 A;  4PC0 A;  1N6E A;  3RSE C;  1MG3 A;  3GFC A;  3VH0 A;  5TF2 A;  4J0W A;  4JT5 C;  3SMR A;  3ODT A;  2XU7 A;  1K32 A;  4L3H D;  2PM6 B;  4K3J B;  1A0R B;  4GM8 A;  5H1M A;  2I0S A;  3ZWL B;  2H6K A;  3SXT D;  4L3G D;  1L0Q A;  2P9S C;  3VGZ A;  2IUP A;  3I7O A;  4O3U B;  4A08 A;  1OMW B;  4LG8 A;  1QNI A;  3PXT D;  3IJ1 A;  2H9L A;  2H3X A;  2OVQ B;  5I5I A;  1JMX B;  5HE1 B;  4JSP C;  3UVL A;  4X3E A;  4OZU A;  3RFG A;  3F3F A;  4OWR A;  5HQG A;  2H6Q A;  3C5M A;  4O1Q D;  4HDJ A;  4ZOZ A;  3JRP A;  3J81 g;  4JSV C;  3FRX A;  4CY3 A;  3SBQ A;  4AOW A;  2OIZ A;  3OL2 B;  5EAP A;  3SVW D;  2CNX A;  2Z2O A;  3NVN A;  4CI2 A;  2H6N A;  3OKT A;  4LGN A;  2BBK H;  3GRE A;  5H14 A;  2J55 H;  3EMH A;  4QL1 A;  1SQ9 A;  2MTA H;  2OJY A;  2B5M A;  4L1Q D;  4D6V A;  2IUV A;  2P9P C;  4ERZ A;  4R7A B;  3I7H A;  5GMK n;  2CE9 A;  4E54 B;  3IJC A;  4J87 A;  3PSC B;  1GG2 B;  3HFQ A;  3C99 A;  4K3I D;  5GXI A;  4GM3 A;  5CXC B;  4FAN D;  3OL2 A;  1PI6 A;  2H9N A;  2HES X;  3IIW A;  4EWR A;  2IUQ A;  3I8E A;  3EI2 A;  5FKR A;  3UR4 A;  4ZOY A;  4KFM B;  4NSX A;  2CE8 A;  4FA5 D;  5EMJ B;  2YNN A;  4J81 A;  4FAV D;  2IUR A;  4CY1 A;  3RFH A;  5HE2 B;  3I7N A;  4ZOV A;  5H17 A;  2HKM A;  4UI9 R;  4CY2 A;  2J56 H;  4U7A A;  3ORV D;  5EML B;  2XL3 A;  1OLZ A;  1JMZ B;  3RRM C;  5GSA A;  4A2L A;  4GGA A;  2H68 A;  4Z8L A;  3RN1 D;  3E0C A;  2UZY B;  4I79 A;  4GM9 A;  2IWF A;  4O3T B;  5FXY A;  5FKS A;  2HJB A;  4A08 B;  4CI3 A;  3JPX A;  5IT9 g;  4MK0 B;  5B4W A;  1JOF A;  3KRX B;  4E5Z B;  4O9D A;  4GGD A;  4XYH A;  4A0A B;  2TRC B;  4BL0 A;  5GXH A;  1VYH C;  3BG1 A;  4JT6 C;  3OW8 A;  4J79 A;  2HXC A;  2AH0 A;  2G99 A;  2YMU A;  4J77 A;  3B7F A;  3MZL A;  2P9N C;  4ES0 A;  4QT8 A;  4QRJ A;  2I0T A;  2AQ5 A;  5TEF A;  2EBS A;  3AH8 B;  4CI1 A;  3PSL A;  3C75 H;  3RMZ D;  4E5Z A;  3EI4 B;  3AL8 A;  4AEZ A;  4A0A A;  3MZK A;  5IJ7 E;  4ESG A;  4A2M A;  2H14 A;  3MMY A;  5HYN B;  5I5J A;  4A7J A;  4PBY A;  3IKO A;  4J84 A;  3J80 g;  2CN3 A;  4O45 A;  3SBR A;  3SLE D;  3V9F A;  3UVO A;  3EI2 B;  5AMS A;  1PBY B;  3CFV A;  1SQJ A;  3DXK C;  1PEV A;  3N0E A;  2YNO A;  2O9K A;  5EMM B;  4X63 B;  4A0B B;  5TEE A;  3V7D B;  5CXB A;  3CFS B;  3EI4 A;  4Y7R A;  3I89 A;  4FA4 D;  4A11 B;  5EAR A;  1TYQ C;  2AH1 A;  2H9P A;  5IGQ A;  3EU7 A;  5CYK B;  3I7P A;  3V5W B;  1XKS A;  2OVR B;  2AGZ A;  2PBI B;  3SCY A;  3KRW B;  5K1C C;  2GNQ A;  2QC5 A;  3VA6 A;  3EG6 A;  2H9M A;  4PBZ A;  4A0B A;  2P9L C;  3DSM A;  3OKW A;  3SN6 B;  4CZY A;  3JB9 L;  2GC4 A;  1MG2 A;  2XL2 A;  3IIY A;  3BWS A;  1SHY B;  5THA A;  4GQ1 A;  5CYK A;  2Z2P A;  4J82 A;  5TDH B;  1GP2 B;  1P22 A;  3EWE A;  4X60 B;  2PM7 B;  4CZV A;  2HJ4 A;  1K8K C;  4CC9 A;  5FKQ A;  5A2Q g;  3SWS D;  4PSX B;  4PSW B;  1N6F A;  3I8C A;  4IA9 A;  2GC7 A;  3F3G A;  4PNK B;  3SJL D;  4JSN C;  4X61 B;  2CO0 C;  2OVP B;  5FQD A;  1RI6 A;  5EM2 B;  3EI1 B;  5FLX g;  4GQ2 P;  1Q47 A;  4ZOX A;  2B5L A;  2Q7Q A;  3PE7 A;  5AJA A;  2I3T A;  4PXW A;  3SFZ A;  4BH6 A;  2G9A A;  3F3P A;  4FHL A;  4CI8 A;  4GQB B;  4FA9 D;  3P4F A;  4TZ4 A;  3UKR C;  2CO0 A;  2XYI A;  3L4O D;  3JRO A;  5IC7 A;  1MDA H;  2I0R A;  5HE0 B;  3AL8 B;  3PXS D;  4U1E I;  5C2V B;  3IJ0 A;  4A09 B;  5EM2 A;  3EI1 A;  3I7K A;  2CN2 A;  5IJ8 E;  5JWZ A;  3OKY B;  4A11 A;  1XHM A;  4ERQ A;  5K19 A;  2AGX A;  1B9Y A;  3RN0 D;  4J8G A;  2IWK A;  1U2V C;  2J57 G;  4JSX C;  2P9K C;  4H5J A;  4N14 A;  4FB1 D;  5EAL A;  4GZ8 A;  2IAA A;  3RLM D;  4J78 A;  5CXB B;  5EMK B;  1NEX B;  1R5M A;  4GGC A;  3JZH A;  2PM9 A;  5IGO A;  1B9X A;  3C9C A;  3JAM g;  4A09 A;  4XYI A;  3A0F A;  3DXM C;  3PVU B;  3OKY A;  4Y5R D;  1U4C A;  5I5M A;  1JJU B;  5FA5 B;  3NVQ A;  2B5N A;  2OK4 A;  2UZX B;  4GMB A;  4J86 A;  2YB8 B;  3FM0 A;  3SHF A;  4CZX A;  3SBP A;  5HE3 B;  2HKR A;  1TBG A;  2AGY A;  3AFC A;  5SXM A;  4BUJ C;  3NVX A;  3BG0 A;  3MKQ A;  3CIK B;  2W18 A;  1YFQ A;  4FA1 D;  3EI3 B;  4J0X A;  3UVM A;  5FKT A;  1ERJ A;  2BCJ B;  1S4U X;  2OK6 A;  3DM0 A;  1NR0 A;  4L9O A;  3UVK A;  1GXR A;  5AFU 3;  2H13 A;  1XIP A;  3I7L A;  3PVW B;  3FGB A;  3PXW D;  3MXX A;  3DWL C;  1N6D A;  4G56 B;  3UKU C;  3ULE C;  4QQE A;  5C9Z B;  2P9I C;  2QXV A;  2YBA A;  4JXM A;  5C2W B;  2AGW A;  3EI3 A;  3W15 A;  4YVD A;  3OTT A;  4D0K A;  4E54 A;  3L4M D;  5EAM A;  3K27 A;  2HYE A;  3K26 A;  2YNP A;  1GOT B;  2Z2N A; 
#chains in the Genus database with same CATH topology
 2EIE A;  3JZG A;  5E6R A;  2VDR A;  3JZN A;  1JV2 A;  5CXC A;  4CY5 A;  4IMM A;  2H47 A;  4J8B A;  3UVN A;  1PGU A;  2B4E A;  3AL9 A;  3O4J A;  3GD1 I;  3N0D A;  4XEI C;  4FWW A;  4J73 A;  4IRZ A;  1FWX A;  2AGL A;  2I3S A;  2PM9 B;  3I2N A;  2VDK A;  4ERY A;  4ZN4 A;  3U4Y A;  4H5I A;  3MKS B;  2P9U C;  3DDU A;  5KDO B;  4JD2 C;  4LG9 A;  4NEN A;  2XE4 A;  4PC0 A;  1N6E A;  3VI4 A;  3RSE C;  1MG3 A;  1L5G A;  4WK0 A;  1TYE A;  4BP9 A;  3GFC A;  4DNV A;  3VH0 A;  4WK2 A;  5TF2 A;  4J0W A;  4JT5 C;  3SMR A;  1QFS A;  3ODT A;  2XU7 A;  1E5T A;  3V4P A;  1K32 A;  4L3H D;  2PM6 B;  4K3J B;  1A0R B;  4GM8 A;  5H1M A;  2I0S A;  2JKX A;  3ZWL B;  3MUO A;  1UOP A;  2H6K A;  4RE5 A;  3SXT D;  1GOH A;  1L0Q A;  2P9S C;  2VDL A;  4L3G D;  3VGZ A;  2IUP A;  3I7O A;  4O3U B;  4A08 A;  1OMW B;  4LG8 A;  1QNI A;  3PXT D;  4AN1 A;  1VZ2 A;  3IJ1 A;  2H9L A;  2H3X A;  2OVQ B;  5I5I A;  1JMX B;  5HE1 B;  4JSP C;  3UVL A;  2WQ8 A;  4OZU A;  4X3E A;  3RFG A;  3F3F A;  3ZDZ A;  4OWR A;  1VE6 A;  5HQG A;  2H6Q A;  3C5M A;  4O1Q D;  4HDJ A;  4ZOZ A;  3JRP A;  3ZE2 A;  3J81 g;  4JSV C;  3FRX A;  1UOQ A;  4CY3 A;  3SBQ A;  4AOW A;  2OIZ A;  3OL2 B;  5EAP A;  3SVW D;  2CNX A;  2Z2O A;  3NVN A;  2HU7 A;  3ZDY A;  4CI2 A;  2H6N A;  3OKT A;  4LGN A;  2BBK H;  3GRE A;  5H14 A;  2J55 H;  3EMH A;  4QL1 A;  1SQ9 A;  2MTA H;  2OJY A;  2B5M A;  3FCS A;  4MMY A;  4L1Q D;  4D6V A;  2IUV A;  2P9P C;  2VDM A;  4ERZ A;  4R7A B;  3I7H A;  5GMK n;  2CE9 A;  4E54 B;  4MMX A;  3IJC A;  4J87 A;  3PSC B;  4AMY A;  1GG2 B;  3HFQ A;  4NC4 A;  3IUJ A;  3C99 A;  4O2W A;  2EID A;  4K3I D;  5GXI A;  4GM3 A;  5CXC B;  4FAN D;  3OL2 A;  1PI6 A;  2H9N A;  2HES X;  3IIW A;  1H2W A;  4EWR A;  2IUQ A;  3I8E A;  3EI2 A;  5FKR A;  3UR4 A;  4ZOY A;  4NBM A;  4KFM B;  5M5V A;  1E8N A;  4NSX A;  2CE8 A;  4AMZ A;  4FA5 D;  5EMJ B;  2YNN A;  4J81 A;  1GOF A;  5FFG A;  4FAV D;  2IUR A;  4CY1 A;  3RFH A;  5HE2 B;  3I7N A;  3MUN A;  3O4H A;  4ZOV A;  5H17 A;  4JHP C;  5C92 A;  2HKM A;  4UI9 R;  4CY2 A;  2J56 H;  1O6F A;  4U7A A;  3ORV D;  5EML B;  3K6S A;  2XL3 A;  1OLZ A;  1JMZ B;  5HDB A;  3RRM C;  4NAA A;  5C86 A;  5M5R A;  5GSA A;  4A2L A;  4GGA A;  2H68 A;  1T2X A;  4Z8L A;  3RN1 D;  3E0C A;  2UZY B;  4DNW A;  4I79 A;  3O4I A;  4GM9 A;  2IWF A;  4O3T B;  5FXY A;  5FKS A;  2HJB A;  4A08 B;  3NID A;  4CI3 A;  3JPX A;  5IT9 g;  2VC2 A;  4MK0 B;  5E6U A;  5B4W A;  1JOF A;  3KRX B;  4E5Z B;  4O9D A;  4GGD A;  4XYH A;  4A0A B;  3O4G A;  1C9I A;  2TRC B;  4BL0 A;  5GXH A;  1VYH C;  1BPO A;  3BG1 A;  4JT6 C;  3OW8 A;  4J79 A;  2HXC A;  2VDP A;  2AH0 A;  2G99 A;  2YMU A;  3IUR A;  4J77 A;  3B7F A;  3MZL A;  3QHY B;  2P9N C;  4ES0 A;  4QT8 A;  4QRJ A;  2I0T A;  2AQ5 A;  5TEF A;  1H2Y A;  2EBS A;  1U8C A;  3FCU A;  3ZE1 A;  3AH8 B;  4CI1 A;  2EIB A;  3PSL A;  3C75 H;  3RMZ D;  4E5Z A;  3EI4 B;  3AL8 A;  4AEZ A;  4A0A A;  3MZK A;  5IJ7 E;  4ESG A;  4QAM A;  4A2M A;  2H14 A;  3MMY A;  5HYN B;  5I5J A;  4A7J A;  3EQ9 A;  3IKO A;  4PBY A;  4J84 A;  3J80 g;  2CN3 A;  4O45 A;  3SBR A;  3EQ7 A;  3SLE D;  1K3I A;  3V9F A;  3UVO A;  3EI2 B;  5AMS A;  1PBY B;  3CFV A;  1SQJ A;  3IVM A;  3DXK C;  4G55 A;  1PEV A;  3N0E A;  2YNO A;  2O9K A;  5EMM B;  4X63 B;  4A0B B;  1I2M B;  5TEE A;  3V7D B;  5CXB A;  3CFS B;  3EI4 A;  4Y7R A;  3I89 A;  4FA4 D;  4A11 B;  5EAR A;  1TYQ C;  2AH1 A;  1UOO A;  2H9P A;  5IGQ A;  3EU7 A;  5CYK B;  3I7P A;  3V5W B;  1XKS A;  2OVR B;  2AGZ A;  2PBI B;  3SCY A;  4D9S A;  3KRW B;  5K1C C;  2GNQ A;  2QC5 A;  3VA6 A;  3EG6 A;  3T3M A;  2H9M A;  4PBZ A;  4UM9 A;  4A0B A;  2P9L C;  3GC3 B;  3DSM A;  3OKW A;  2XZG A;  3VI3 A;  3SN6 B;  3K72 A;  4CZY A;  4G1E A;  3JB9 L;  2GC4 A;  1MG2 A;  2XL2 A;  3IIY A;  3BWS A;  1SHY B;  5THA A;  4GQ1 A;  5CYK A;  2Z2P A;  4J82 A;  5TDH B;  1GP2 B;  1P22 A;  1GOG A;  3EWE A;  4X60 B;  4AN0 A;  2PM7 B;  4CZV A;  2HJ4 A;  1K8K C;  4WJK A;  4CC9 A;  3IUL A;  5FKQ A;  5A2Q g;  3SWS D;  4PSX B;  4PSW B;  2EIC A;  1N6F A;  3I8C A;  4IA9 A;  2GC7 A;  3F3G A;  4PNK B;  3SJL D;  4Z7Q A;  4JSN C;  4X61 B;  2CO0 C;  2OVP B;  5FQD A;  2VDQ A;  1RI6 A;  5EM2 B;  3EI1 B;  5FLX g;  4GQ2 P;  1Q47 A;  2XDW A;  4ZOX A;  2B5L A;  2Q7Q A;  3PE7 A;  5AJA A;  2I3T A;  1VZ3 A;  4PXW A;  3SFZ A;  1H2X A;  4BH6 A;  2G9A A;  3F3P A;  4FHL A;  4CI8 A;  3ZDX A;  4GQB B;  4FA9 D;  3P4F A;  4TZ4 A;  3UKR C;  2CO0 A;  2XYI A;  3L4O D;  3JRO A;  3KCI A;  5IC7 A;  4L1M A;  3EQ8 A;  1MDA H;  2I0R A;  5HE0 B;  3AL8 B;  3PXS D;  3NIF A;  4U1E I;  5C2V B;  3K71 A;  3IJ0 A;  4A09 B;  4UM8 A;  5EM2 A;  3EI1 A;  2QZP A;  3IUQ A;  3I7K A;  1QFM A;  2CN2 A;  5IJ8 E;  5JWZ A;  3OKY B;  4A11 A;  1XHM A;  4JHN A;  4ERQ A;  2AGX A;  1B9Y A;  3QI0 A;  2VDN A;  3RN0 D;  5K19 A;  5M61 A;  4Z7N A;  4J8G A;  1O6G A;  2IWK A;  1U2V C;  2J57 G;  5E6S A;  3IUM A;  4JSX C;  2P9K C;  1YR2 A;  4H5J A;  4N14 A;  4FB1 D;  5EAL A;  4GZ8 A;  2IAA A;  3RLM D;  4J78 A;  5CXB B;  5EMK B;  1NEX B;  1R5M A;  4GGC A;  3JZH A;  2PM9 A;  1JTD B;  5IGO A;  1B9X A;  3C9C A;  3JAM g;  4A09 A;  4XYI A;  4BCB A;  1UTC A;  3MVD K;  3A0F A;  3DXM C;  3PVU B;  3OKY A;  4Y5R D;  1U4C A;  5I5M A;  5M5T A;  1JJU B;  5FA5 B;  3NVQ A;  5M5U A;  1VE7 A;  1H2Z A;  2B5N A;  2OK4 A;  2UZX B;  4GMB A;  4J86 A;  2YB8 B;  3FM0 A;  3SHF A;  4CZX A;  4DNU A;  1A12 A;  4O02 A;  4RE6 A;  3SBP A;  5HE3 B;  2HKR A;  1TBG A;  2AGY A;  3AFC A;  5SXM A;  4BUJ C;  3NVX A;  3BG0 A;  3MKQ A;  1E8M A;  3CIK B;  4BCC A;  2W18 A;  1YFQ A;  3V4V A;  4FA1 D;  3EI3 B;  4J0X A;  2VDO A;  3UVM A;  5FKT A;  1ERJ A;  2BCJ B;  1S4U X;  1M1X A;  4G1M A;  3NIG A;  2OK6 A;  3DM0 A;  1NR0 A;  4L9O A;  3UVK A;  4BCD A;  1GXR A;  5AFU 3;  2H13 A;  1XIP A;  3I7L A;  3PVW B;  3FGB A;  3PXW D;  3MXX A;  3DWL C;  1N6D A;  4G56 B;  3UKU C;  3IUN A;  3ZE0 A;  3ULE C;  2HU5 A;  4QQE A;  5C9Z B;  4BP8 A;  2P9I C;  1C9L A;  4AX4 A;  2QXV A;  4Z7O A;  2YBA A;  5FFO A;  4JXM A;  5C2W B;  4MMZ A;  2AGW A;  3EI3 A;  2VZ3 A;  4WK4 A;  3IJE A;  3W15 A;  4YVD A;  3OTT A;  3T3P A;  4D0K A;  2BKL A;  5M5S A;  4E54 A;  3L4M D;  2HU8 A;  3K27 A;  5EAM A;  2HYE A;  3K26 A;  2YNP A;  1GOT B;  2QR5 A;  2Z2N A;  2VZ1 A;  3OF7 A; 
#chains in the Genus database with same CATH homology
 3JZG A;  3JZN A;  5CXC A;  4CY5 A;  4IMM A;  2H47 A;  4J8B A;  3UVN A;  1PGU A;  2B4E A;  3AL9 A;  3N0D A;  4XEI C;  4FWW A;  4J73 A;  1FWX A;  2AGL A;  2I3S A;  2PM9 B;  3I2N A;  4ERY A;  4ZN4 A;  3U4Y A;  4H5I A;  3MKS B;  2P9U C;  5KDO B;  4JD2 C;  4LG9 A;  4PC0 A;  1N6E A;  3RSE C;  1MG3 A;  3GFC A;  3VH0 A;  5TF2 A;  4J0W A;  4JT5 C;  3SMR A;  3ODT A;  2XU7 A;  1K32 A;  4L3H D;  2PM6 B;  4K3J B;  1A0R B;  4GM8 A;  5H1M A;  2I0S A;  3ZWL B;  2H6K A;  3SXT D;  4L3G D;  1L0Q A;  2P9S C;  3VGZ A;  2IUP A;  3I7O A;  4O3U B;  4A08 A;  1OMW B;  4LG8 A;  1QNI A;  3PXT D;  3IJ1 A;  2H9L A;  2H3X A;  2OVQ B;  5I5I A;  1JMX B;  5HE1 B;  4JSP C;  3UVL A;  4X3E A;  4OZU A;  3RFG A;  3F3F A;  4OWR A;  5HQG A;  2H6Q A;  3C5M A;  4O1Q D;  4HDJ A;  4ZOZ A;  3JRP A;  3J81 g;  4JSV C;  3FRX A;  4CY3 A;  3SBQ A;  4AOW A;  2OIZ A;  3OL2 B;  5EAP A;  3SVW D;  2CNX A;  2Z2O A;  3NVN A;  4CI2 A;  2H6N A;  3OKT A;  4LGN A;  2BBK H;  3GRE A;  5H14 A;  2J55 H;  3EMH A;  4QL1 A;  1SQ9 A;  2MTA H;  2OJY A;  2B5M A;  4L1Q D;  4D6V A;  2IUV A;  2P9P C;  4ERZ A;  4R7A B;  3I7H A;  5GMK n;  2CE9 A;  4E54 B;  3IJC A;  4J87 A;  3PSC B;  1GG2 B;  3HFQ A;  3C99 A;  4K3I D;  5GXI A;  4GM3 A;  5CXC B;  4FAN D;  3OL2 A;  1PI6 A;  2H9N A;  2HES X;  3IIW A;  4EWR A;  2IUQ A;  3I8E A;  3EI2 A;  5FKR A;  3UR4 A;  4ZOY A;  4KFM B;  4NSX A;  2CE8 A;  4FA5 D;  5EMJ B;  2YNN A;  4J81 A;  4FAV D;  2IUR A;  4CY1 A;  3RFH A;  5HE2 B;  3I7N A;  4ZOV A;  5H17 A;  2HKM A;  4UI9 R;  4CY2 A;  2J56 H;  4U7A A;  3ORV D;  5EML B;  2XL3 A;  1OLZ A;  1JMZ B;  3RRM C;  5GSA A;  4A2L A;  4GGA A;  2H68 A;  4Z8L A;  3RN1 D;  3E0C A;  2UZY B;  4I79 A;  4GM9 A;  2IWF A;  4O3T B;  5FXY A;  5FKS A;  2HJB A;  4A08 B;  4CI3 A;  3JPX A;  5IT9 g;  4MK0 B;  5B4W A;  1JOF A;  3KRX B;  4E5Z B;  4O9D A;  4GGD A;  4XYH A;  4A0A B;  2TRC B;  4BL0 A;  5GXH A;  1VYH C;  3BG1 A;  4JT6 C;  3OW8 A;  4J79 A;  2HXC A;  2AH0 A;  2G99 A;  2YMU A;  4J77 A;  3B7F A;  3MZL A;  2P9N C;  4ES0 A;  4QT8 A;  4QRJ A;  2I0T A;  2AQ5 A;  5TEF A;  2EBS A;  3AH8 B;  4CI1 A;  3PSL A;  3C75 H;  3RMZ D;  4E5Z A;  3EI4 B;  3AL8 A;  4AEZ A;  4A0A A;  3MZK A;  5IJ7 E;  4ESG A;  4A2M A;  2H14 A;  3MMY A;  5HYN B;  5I5J A;  4A7J A;  4PBY A;  3IKO A;  4J84 A;  3J80 g;  2CN3 A;  4O45 A;  3SBR A;  3SLE D;  3V9F A;  3UVO A;  3EI2 B;  5AMS A;  1PBY B;  3CFV A;  1SQJ A;  3DXK C;  1PEV A;  3N0E A;  2YNO A;  2O9K A;  5EMM B;  4X63 B;  4A0B B;  5TEE A;  3V7D B;  5CXB A;  3CFS B;  3EI4 A;  4Y7R A;  3I89 A;  4FA4 D;  4A11 B;  5EAR A;  1TYQ C;  2AH1 A;  2H9P A;  5IGQ A;  3EU7 A;  5CYK B;  3I7P A;  3V5W B;  1XKS A;  2OVR B;  2AGZ A;  2PBI B;  3SCY A;  3KRW B;  5K1C C;  2GNQ A;  2QC5 A;  3VA6 A;  3EG6 A;  2H9M A;  4PBZ A;  4A0B A;  2P9L C;  3DSM A;  3OKW A;  3SN6 B;  4CZY A;  3JB9 L;  2GC4 A;  1MG2 A;  2XL2 A;  3IIY A;  3BWS A;  1SHY B;  5THA A;  4GQ1 A;  5CYK A;  2Z2P A;  4J82 A;  5TDH B;  1GP2 B;  1P22 A;  3EWE A;  4X60 B;  2PM7 B;  4CZV A;  2HJ4 A;  1K8K C;  4CC9 A;  5FKQ A;  5A2Q g;  3SWS D;  4PSX B;  4PSW B;  1N6F A;  3I8C A;  4IA9 A;  2GC7 A;  3F3G A;  4PNK B;  3SJL D;  4JSN C;  4X61 B;  2CO0 C;  2OVP B;  5FQD A;  1RI6 A;  5EM2 B;  3EI1 B;  5FLX g;  4GQ2 P;  1Q47 A;  4ZOX A;  2B5L A;  2Q7Q A;  3PE7 A;  5AJA A;  2I3T A;  4PXW A;  3SFZ A;  4BH6 A;  2G9A A;  3F3P A;  4FHL A;  4CI8 A;  4GQB B;  4FA9 D;  3P4F A;  4TZ4 A;  3UKR C;  2CO0 A;  2XYI A;  3L4O D;  3JRO A;  5IC7 A;  1MDA H;  2I0R A;  5HE0 B;  3AL8 B;  3PXS D;  4U1E I;  5C2V B;  3IJ0 A;  4A09 B;  5EM2 A;  3EI1 A;  3I7K A;  2CN2 A;  5IJ8 E;  5JWZ A;  3OKY B;  4A11 A;  1XHM A;  4ERQ A;  5K19 A;  2AGX A;  1B9Y A;  3RN0 D;  4J8G A;  2IWK A;  1U2V C;  2J57 G;  4JSX C;  2P9K C;  4H5J A;  4N14 A;  4FB1 D;  5EAL A;  4GZ8 A;  2IAA A;  3RLM D;  4J78 A;  5CXB B;  5EMK B;  1NEX B;  1R5M A;  4GGC A;  3JZH A;  2PM9 A;  5IGO A;  1B9X A;  3C9C A;  3JAM g;  4A09 A;  4XYI A;  3A0F A;  3DXM C;  3PVU B;  3OKY A;  4Y5R D;  1U4C A;  5I5M A;  1JJU B;  5FA5 B;  3NVQ A;  2B5N A;  2OK4 A;  2UZX B;  4GMB A;  4J86 A;  2YB8 B;  3FM0 A;  3SHF A;  4CZX A;  3SBP A;  5HE3 B;  2HKR A;  1TBG A;  2AGY A;  3AFC A;  5SXM A;  4BUJ C;  3NVX A;  3BG0 A;  3MKQ A;  3CIK B;  2W18 A;  1YFQ A;  4FA1 D;  3EI3 B;  4J0X A;  3UVM A;  5FKT A;  1ERJ A;  2BCJ B;  1S4U X;  2OK6 A;  3DM0 A;  1NR0 A;  4L9O A;  3UVK A;  1GXR A;  5AFU 3;  2H13 A;  1XIP A;  3I7L A;  3PVW B;  3FGB A;  3PXW D;  3MXX A;  3DWL C;  1N6D A;  4G56 B;  3UKU C;  3ULE C;  4QQE A;  5C9Z B;  2P9I C;  2QXV A;  2YBA A;  4JXM A;  5C2W B;  2AGW A;  3EI3 A;  3W15 A;  4YVD A;  3OTT A;  4D0K A;  4E54 A;  3L4M D;  5EAM A;  3K27 A;  2HYE A;  3K26 A;  2YNP A;  1GOT B;  2Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...