2OK6A

Crystal structure of aromatic amine dehydrogenase ttq-formamide adduct oxidized with ferricyanide.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 96
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ok6A01
4CC9A 3PSLA 3SWSD 4FA4D 2H14A 5FKQA 3EI2A 2HKRA 4CI3A 3EI2B 3I89A 1TYQC 3UR4A 3ULEC 3MZLA 2J57G 4U7AA 3N0DA 3GREA 3RRMC 5EMMB 3EMHA 4KFMB 3V7DB 4PC0A 2H13A 2CN3A 5EARA 4AEZA 2AGWA 4R7AB 5H14A 5EAPA 3A0FA 3I2NA 4JSXC 5IGQA 5CXBA 3OL2A 3MMYA 4JT6C 4A2LA 3OL2B 2IWFA 4QQEA 4JD2C 1SQ9A 3NVNA 4MK0B 3E0CA 2BCJB 3JRPA 2I0SA 3AFCA 2OIZA 2QC5A 3UVNA 2CO0A 1B9XA 4ERYA 3DXMC 3I7HA 2P9IC 4J8GA 2PBIB 3CIKB 2IUVA 3JPXA 2PM6B 4O1QD 4LG8A 5FKTA 4J81A 3RN0D 4H5JA 4J8BA 1FWXA 2XYIA 2H68A 5B4WA 2B5MA 4K3JB 3IIYA 5HE3B 3PVWB 4CZXA 4GGAA 3SBQA 4A11A 2XL2A 3EI1A 4A11B 2HJBA 3EI1B 2IAAA 4IMMA 5EMJB 1GP2B 1R5MA 2PM7B 3EI4A 5FXYA 3JB9L 2UZXB 3EI4B 1U4CA 3RMZD 5CYKA 5EM2A 5CYKB 4CI1A 3I7PA 2O9KA 4ZN4A 2P9NC 3C75H 4BUJC 5EM2B 4U1EI 1RI6A 3DXKC 3PXTD 4CY5A 5TF2A 2CN2A 4CZVA 4YVDA 3UKUC 1NR0A 1QNIA 3NVQA 3J81g 4A09A 5FA5B 4A09B 1JJUB 4PNKB 2PM9A 2QXVA 3IIWA 2PM9B 3SMRA 2H6KA 3EU7A 2IUQA 2OVQB 2IURA 4FAVD 1B9YA 3VA6A 4FB1D 4JSVC 3EWEA 2H9MA 1XHMA 2HKMA 3CFVA 4CY2A 3IJ1A 4A0BA 3C9CA 4A0BB 2W18A 4GM8A 3I7LA 5I5IA 3V9FA 4GQ2P 1JOFA 4D6VA 1A0RB 1ERJA 4JXMA 2AGXA 3F3GA 3IKOA 4A2MA 2Q7QA 4Y7RA 4J86A 1JMZB 3ZWLB 2H9LA 3I7NA 3FGBA 4J79A 3K27A 4D0KA 3SVWD 4X61B 1NEXB 3IJ0A 5AFU3 1JMXB 4JSPC 1MG2A 1PEVA 3W15A 4GGCA 4J0WA 3OW8A 4LG9A 4BL0A 1N6FA 3RFGA 3OKYA 2HXCA 2IUPA 3OKYB 1MG3A 4FAND 5K1CC 2OVPB 4K3ID 4J87A 5HE2B 2YNNA 1OMWB 5A2Qg 2Z2OA 4PXWA 3MKSB 3I7KA 3P4FA 2I0RA 4GM9A 5IT9g 3I8EA 5EALA 3B7FA 4QT8A 2I3SA 3DSMA 3EG6A 3VGZA 4CI8A 2XU7A 5I5JA 3FRXA 3IJCA 2P9UC 5K19A 4A7JA 2AH1A 3KRWB 2B5NA 3EI3B 4JSNC 1S4UX 2Z2PA 5C9ZB 4L1QD 3SFZA 4CZYA 5TEEA 3UVLA 3C5MA 3I7OA 3JZHA 5THAA 4CY3A 3AL9A 5GXIA 3PE7A 3UVKA 5GXHA 4PSWB 3SLED 4XYHA 2H3XA 4TZ4A 3PXSD 3SN6B 3SJLD 2BBKH 2AGYA 4A0AA 2J56H 3KRXB 4IA9A 1GXRA 3HFQA 4A0AB 3V5WB 4J84A 4L3HD 5FLXg 4OWRA 2P9LC 3PXWD 4FHLA 4QRJA 2AH0A 4FA9D 2YMUA 2AGZA 2HJ4A 4A08A 3L4MD 4E5ZA 4A08B 4E5ZB 5GMKn 3UVMA 3BWSA 4J0XA 3J80g 1YFQA 3C99A 2G99A 3SCYA 3RLMD 4EWRA 3MXXA 4XEIC 4J77A 5KDOB 1K8KC 3SBPA 3MZKA 2P9PC 5IGOA 5IJ7E 3PVUB 5IC7A 2OK4A 3L4OD 1SHYB 5EAMA 2H9PA 1PI6A 5C2VB 3VH0A 4OZUA 1MDAH 3F3PA 4E54A 2H6QA 2HYEA 5AMSA 4CI2A 4E54B 2CO0C 2H9NA 1N6EA 4L3GD 4FWWA 4ERZA 3K26A 2H47A 3RSEC 2GC7A 4LGNA 5EMKB 2OK6A 2B5LA 3MKQA 4X63B 2MTAH 2OVRB 2XL3A 3SHFA 4FA5D 5C2WB 2EBSA 4O45A 4J78A 3I8CA 1Q47A 4J73A 3AL8A 4GMBA 3AL8B 5H1MA 4GGDA 5I5MA 4ZOZA 3SBRA 1XIPA 5TDHB 4Y5RD 1GOTB 2IWKA 5CXBB 1U2VC 3SXTD 2OJYA 4ESGA 5TEFA 2GC4A 3NVXA 4ES0A 4GQ1A 1L0QA 4BH6A 3DM0A 4ZOVA 1VYHC 4XYIA 3JAMg 4JT5C 1TBGA 3JZNA 4CY1A 1PBYB 2CE8A 4X60B 4H5IA 4PBZA 4FA1D 5HYNB 3CFSB 2YB8B 5GSAA 4GQBB 2TRCB 3EI3A 4ZOYA 5HE0B 2CE9A 5HQGA 2AQ5A 1N6DA 3ODTA 3U4YA 3JZGA 4UI9R 4J82A 4HDJA 4PSXB 1GG2B 5FKSA 2AGLA 4X3EA 3OKTA 2B4EA 4I79A 2G9AA 3OKWA 4O9DA 4PBYA 5FKRA 4O3TB 2J55H 5AJAA 5HE1B 5CXCA 5EMLB 3BG1A 3RFHA 3AH8B 4AOWA 4ERQA 2YNOA 5CXCB 1K32A 3PSCB 3UKRC 2P9KC 5IJ8E 2H6NA 4Z8LA 3F3FA 4NSXA 4L9OA 4QL1A 5FQDA 3BG0A 1OLZA 1SQJA 3OTTA 4G56B 5H17A 2YNPA 2CNXA 4ZOXA 3FM0A 2I0TA 2I3TA 1XKSA 3JROA 3ORVD 2GNQA 3GFCA 5SXMA 4N14A 3UVOA 2YBAA 2HESX 4GZ8A 3DWLC 2P9SC 3N0EA 5JWZA 3RN1D 2UZYB 1PGUA 4GM3A 1P22A 4O3UB 2Z2NA
chains in the Genus database with same CATH superfamily
1H2ZA 3PSLA 1E8MA 4CC9A 3SWSD 4FA4D 2H14A 1O6GA 5FKQA 3ZE0A 3EI2A 2HKRA 4CI3A 2VDOA 3EI2B 3VI3A 1H2YA 3I89A 1TYQC 4UM8A 3UR4A 3ULEC 3MZLA 2J57G 4U7AA 3N0DA 3GREA 3RRMC 5EMMB 3EMHA 4KFMB 3V7DB 4PC0A 2H13A 2CN3A 1C9IA 5EARA 4AEZA 1VZ3A 2AGWA 4R7AB 4WK0A 5H14A 1H2WA 5EAPA 1UOPA 3EQ9A 3A0FA 3T3PA 3I2NA 4JSXC 5IGQA 5CXBA 2VDQA 3MMYA 3OL2A 5C92A 4JT6C 4A2LA 3OL2B 2IWFA 4NBMA 4QQEA 4JD2C 3ZDXA 1SQ9A 3NVNA 4MK0B 1JTDB 5E6SA 3E0CA 2BCJB 3JRPA 2I0SA 3AFCA 2OIZA 2QC5A 3UVNA 4AN0A 1B9XA 2CO0A 3ZDZA 4ERYA 3NIDA 4JHNA 3DXMC 3I7HA 2P9IC 4IRZA 1UTCA 2PBIB 3IUQA 3CIKB 4J8GA 2IUVA 3JPXA 2PM6B 4O1QD 4LG8A 5FKTA 4J81A 3RN0D 4H5JA 2VDNA 4J8BA 2HU5A 4BCDA 1FWXA 2XYIA 2H68A 5B4WA 3IVMA 3NIFA 1M1XA 2B5MA 4Z7OA 4K3JB 3IIYA 5HE3B 3PVWB 4CZXA 4NC4A 4GGAA 3SBQA 4A11A 2XL2A 3EI1A 3GC3B 4A11B 2HJBA 3EI1B 5M61A 2IAAA 4IMMA 5EMJB 1GP2B 2XDWA 1R5MA 2PM7B 3EI4A 5FXYA 3JB9L 2EIBA 2UZXB 3EI4B 1U4CA 3RMZD 1C9LA 5CYKA 1L5GA 5EM2A 3V4VA 5CYKB 4CI1A 3I7PA 2O9KA 4ZN4A 2P9NC 3C75H 4BUJC 5EM2B 4U1EI 1QFSA 1RI6A 3DXKC 3PXTD 3MUNA 4CY5A 5TF2A 2CN2A 4CZVA 3FCUA 4YVDA 2HU8A 3UKUC 1NR0A 1QNIA 3NVQA 1UOQA 3J81g 4A09A 3K71A 3QHYB 5FA5B 2VDLA 1K3IA 3ZE1A 4A09B 1JJUB 4PNKB 2PM9A 2QXVA 3IIWA 2PM9B 3SMRA 2H6KA 3EU7A 2VZ1A 2IUQA 2OVQB 2IURA 3FCSA 4FAVD 3IULA 3K72A 1B9YA 3VA6A 4FB1D 4JSVC 3EWEA 2H9MA 1XHMA 2HKMA 3CFVA 4CY2A 3IJ1A 4A0BA 3C9CA 4A0BB 2W18A 4GM8A 3I7LA 5I5IA 2XZGA 3V9FA 4GQ2P 1JOFA 4D6VA 1A0RB 1ERJA 4G1MA 1H2XA 3GD1I 4JXMA 2AGXA 3F3GA 3IKOA 4A2MA 2Q7QA 4O02A 4Y7RA 4RE6A 4J86A 4BCCA 3NIGA 4D9SA 1JMZB 3ZWLB 2H9LA 3I7NA 3FGBA 5FFGA 4J79A 3K27A 4D0KA 3SVWD 1E5TA 4X61B 1NEXB 3IJ0A 5AFU3 5M5RA 1JMXB 4JSPC 5M5UA 1MG2A 1PEVA 3W15A 1JV2A 1O6FA 4GGCA 4J0WA 3IUNA 3OW8A 4LG9A 4BL0A 1N6FA 3RFGA 3OKYA 2HXCA 2IUPA 3OKYB 1MG3A 4FAND 5K1CC 2OVPB 4K3ID 4J87A 4DNWA 5HE2B 3MVDK 2YNNA 1OMWB 1I2MB 2VDPA 5A2Qg 2Z2OA 4PXWA 3MKSB 3I7KA 5M5VA 3P4FA 2I0RA 4JHPC 4GM9A 5IT9g 3I8EA 5EALA 3B7FA 2VC2A 4AMYA 4QT8A 3IURA 1VE7A 2I3SA 3DSMA 4WJKA 1UOOA 3EG6A 3VGZA 4CI8A 2XU7A 5I5JA 3FRXA 3IJCA 2P9UC 5K19A 4A7JA 2AH1A 3KCIA 3KRWB 2B5NA 3EI3B 4JSNC 1S4UX 2Z2PA 5C9ZB 4L1QD 3SFZA 4CZYA 1QFMA 5TEEA 3UVLA 3C5MA 4L1MA 3I7OA 3JZHA 5THAA 4QAMA 4BP9A 4CY3A 3AL9A 5GXIA 3PE7A 2VDMA 3UVKA 5GXHA 4PSWB 3SLED 3V4PA 2QR5A 4XYHA 2H3XA 4TZ4A 3PXSD 5M5SA 3SN6B 3SJLD 2BBKH 2AGYA 4A0AA 2J56H 3KRXB 4IA9A 1GXRA 3HFQA 4A0AB 5HDBA 3V5WB 4J84A 4L3HD 4BCBA 1A12A 5FLXg 4OWRA 5M5TA 2P9LC 3PXWD 4FHLA 1T2XA 4QRJA 2AH0A 4FA9D 2YMUA 2AGZA 2HJ4A 4A08A 3L4MD 4E5ZA 4A08B 4E5ZB 5GMKn 1BPOA 2EIEA 3UVMA 3BWSA 4J0XA 3J80g 1YFQA 3C99A 2G99A 1YR2A 3SCYA 3RLMD 4EWRA 3MXXA 4XEIC 4J77A 5KDOB 5FFOA 2VZ3A 1K8KC 3SBPA 3MZKA 2P9PC 5IGOA 5IJ7E 3PVUB 5IC7A 2VDRA 2OK4A 3L4OD 1SHYB 3O4HA 5EAMA 3K6SA 2H9PA 1PI6A 4O2WA 5C2VB 3VH0A 4OZUA 1MDAH 1GOHA 3F3PA 4E54A 2H6QA 2HYEA 5AMSA 4CI2A 4E54B 4AMZA 2CO0C 2H9NA 1N6EA 4G1EA 4L3GD 3IJEA 4DNUA 5C86A 4FWWA 4ERZA 1TYEA 3K26A 2H47A 4MMYA 2JKXA 3RSEC 2GC7A 4G55A 4LGNA 5EMKB 2OK6A 2B5LA 3MKQA 4X63B 2MTAH 2OVRB 2XL3A 3SHFA 4FA5D 5C2WB 2EBSA 4O45A 4J78A 3ZE2A 3I8CA 1Q47A 1VZ2A 4J73A 3AL8A 4GMBA 3AL8B 5H1MA 4GGDA 4Z7QA 5I5MA 4ZOZA 3SBRA 1XIPA 5TDHB 4Y5RD 1GOTB 2IWKA 5CXBB 3ZDYA 1VE6A 1U2VC 3SXTD 2OJYA 4ESGA 5TEFA 3O4GA 2GC4A 2EIDA 3NVXA 4RE5A 4ES0A 4GQ1A 1L0QA 4WK4A 3DM0A 4BH6A 4ZOVA 1VYHC 4XYIA 3JAMg 4JT5C 1TBGA 3JZNA 4CY1A 4AN1A 1E8NA 1PBYB 2CE8A 4X60B 3OF7A 4H5IA 4PBZA 4MMXA 2VDKA 4FA1D 5HYNB 3CFSB 2YB8B 4BP8A 5GSAA 4GQBB 2TRCB 3EQ7A 3O4IA 3EI3A 3DDUA 4ZOYA 5HE0B 2CE9A 5HQGA 2AQ5A 1N6DA 4DNVA 3ODTA 3U4YA 3JZGA 4UI9R 4UM9A 2BKLA 4J82A 4HDJA 4PSXB 1GG2B 5FKSA 1U8CA 4NENA 2AGLA 4WK2A 3EQ8A 4X3EA 3OKTA 2B4EA 4I79A 2G9AA 3OKWA 4O9DA 4PBYA 5FKRA 4O3TB 1GOGA 2J55H 5AJAA 5CXCA 5HE1B 5EMLB 3BG1A 3RFHA 3AH8B 4AOWA 4ERQA 2YNOA 5CXCB 1K32A 3PSCB 3UKRC 2P9KC 5IJ8E 2H6NA 1GOFA 4Z8LA 2EICA 3MUOA 3F3FA 4NSXA 4L9OA 4QL1A 5E6RA 5FQDA 3BG0A 1OLZA 3QI0A 4AX4A 1SQJA 2XE4A 3IUJA 3OTTA 4G56B 5H17A 2YNPA 2CNXA 4NAAA 4ZOXA 2HU7A 3FM0A 2I0TA 3T3MA 2I3TA 1XKSA 3JROA 3ORVD 2GNQA 2QZPA 4MMZA 3GFCA 5SXMA 4N14A 3VI4A 5E6UA 3UVOA 2YBAA 2HESX 4GZ8A 4Z7NA 3DWLC 2P9SC 3N0EA 3IUMA 5JWZA 3O4JA 2WQ8A 3RN1D 2UZYB 1PGUA 4GM3A 1P22A 4O3UB 2Z2NA
chains in the Genus database with same CATH topology
4CC9A 3PSLA 3SWSD 4FA4D 2H14A 5FKQA 3EI2A 2HKRA 4CI3A 3EI2B 3I89A 1TYQC 3UR4A 3ULEC 3MZLA 2J57G 4U7AA 3N0DA 3GREA 3RRMC 5EMMB 3EMHA 4KFMB 3V7DB 4PC0A 2H13A 2CN3A 5EARA 4AEZA 2AGWA 4R7AB 5H14A 5EAPA 3A0FA 3I2NA 4JSXC 5IGQA 5CXBA 3OL2A 3MMYA 4JT6C 4A2LA 3OL2B 2IWFA 4QQEA 4JD2C 1SQ9A 3NVNA 4MK0B 3E0CA 2BCJB 3JRPA 2I0SA 3AFCA 2OIZA 2QC5A 3UVNA 2CO0A 1B9XA 4ERYA 3DXMC 3I7HA 2P9IC 4J8GA 2PBIB 3CIKB 2IUVA 3JPXA 2PM6B 4O1QD 4LG8A 5FKTA 4J81A 3RN0D 4H5JA 4J8BA 1FWXA 2XYIA 2H68A 5B4WA 2B5MA 4K3JB 3IIYA 5HE3B 3PVWB 4CZXA 4GGAA 3SBQA 4A11A 2XL2A 3EI1A 4A11B 2HJBA 3EI1B 2IAAA 4IMMA 5EMJB 1GP2B 1R5MA 2PM7B 3EI4A 5FXYA 3JB9L 2UZXB 3EI4B 1U4CA 3RMZD 5CYKA 5EM2A 5CYKB 4CI1A 3I7PA 2O9KA 4ZN4A 2P9NC 3C75H 4BUJC 5EM2B 4U1EI 1RI6A 3DXKC 3PXTD 4CY5A 5TF2A 2CN2A 4CZVA 4YVDA 3UKUC 1NR0A 1QNIA 3NVQA 3J81g 4A09A 5FA5B 4A09B 1JJUB 4PNKB 2PM9A 2QXVA 3IIWA 2PM9B 3SMRA 2H6KA 3EU7A 2IUQA 2OVQB 2IURA 4FAVD 1B9YA 3VA6A 4FB1D 4JSVC 3EWEA 2H9MA 1XHMA 2HKMA 3CFVA 4CY2A 3IJ1A 4A0BA 3C9CA 4A0BB 2W18A 4GM8A 3I7LA 5I5IA 3V9FA 4GQ2P 1JOFA 4D6VA 1A0RB 1ERJA 4JXMA 2AGXA 3F3GA 3IKOA 4A2MA 2Q7QA 4Y7RA 4J86A 1JMZB 3ZWLB 2H9LA 3I7NA 3FGBA 4J79A 3K27A 4D0KA 3SVWD 4X61B 1NEXB 3IJ0A 5AFU3 1JMXB 4JSPC 1MG2A 1PEVA 3W15A 4GGCA 4J0WA 3OW8A 4LG9A 4BL0A 1N6FA 3RFGA 3OKYA 2HXCA 2IUPA 3OKYB 1MG3A 4FAND 5K1CC 2OVPB 4K3ID 4J87A 5HE2B 2YNNA 1OMWB 5A2Qg 2Z2OA 4PXWA 3MKSB 3I7KA 3P4FA 2I0RA 4GM9A 5IT9g 3I8EA 5EALA 3B7FA 4QT8A 2I3SA 3DSMA 3EG6A 3VGZA 4CI8A 2XU7A 5I5JA 3FRXA 3IJCA 2P9UC 5K19A 4A7JA 2AH1A 3KRWB 2B5NA 3EI3B 4JSNC 1S4UX 2Z2PA 5C9ZB 4L1QD 3SFZA 4CZYA 5TEEA 3UVLA 3C5MA 3I7OA 3JZHA 5THAA 4CY3A 3AL9A 5GXIA 3PE7A 3UVKA 5GXHA 4PSWB 3SLED 4XYHA 2H3XA 4TZ4A 3PXSD 3SN6B 3SJLD 2BBKH 2AGYA 4A0AA 2J56H 3KRXB 4IA9A 1GXRA 3HFQA 4A0AB 3V5WB 4J84A 4L3HD 5FLXg 4OWRA 2P9LC 3PXWD 4FHLA 4QRJA 2AH0A 4FA9D 2YMUA 2AGZA 2HJ4A 4A08A 3L4MD 4E5ZA 4A08B 4E5ZB 5GMKn 3UVMA 3BWSA 4J0XA 3J80g 1YFQA 3C99A 2G99A 3SCYA 3RLMD 4EWRA 3MXXA 4XEIC 4J77A 5KDOB 1K8KC 3SBPA 3MZKA 2P9PC 5IGOA 5IJ7E 3PVUB 5IC7A 2OK4A 3L4OD 1SHYB 5EAMA 2H9PA 1PI6A 5C2VB 3VH0A 4OZUA 1MDAH 3F3PA 4E54A 2H6QA 2HYEA 5AMSA 4CI2A 4E54B 2CO0C 2H9NA 1N6EA 4L3GD 4FWWA 4ERZA 3K26A 2H47A 3RSEC 2GC7A 4LGNA 5EMKB 2OK6A 2B5LA 3MKQA 4X63B 2MTAH 2OVRB 2XL3A 3SHFA 4FA5D 5C2WB 2EBSA 4O45A 4J78A 3I8CA 1Q47A 4J73A 3AL8A 4GMBA 3AL8B 5H1MA 4GGDA 5I5MA 4ZOZA 3SBRA 1XIPA 5TDHB 4Y5RD 1GOTB 2IWKA 5CXBB 1U2VC 3SXTD 2OJYA 4ESGA 5TEFA 2GC4A 3NVXA 4ES0A 4GQ1A 1L0QA 4BH6A 3DM0A 4ZOVA 1VYHC 4XYIA 3JAMg 4JT5C 1TBGA 3JZNA 4CY1A 1PBYB 2CE8A 4X60B 4H5IA 4PBZA 4FA1D 5HYNB 3CFSB 2YB8B 5GSAA 4GQBB 2TRCB 3EI3A 4ZOYA 5HE0B 2CE9A 5HQGA 2AQ5A 1N6DA 3ODTA 3U4YA 3JZGA 4UI9R 4J82A 4HDJA 4PSXB 1GG2B 5FKSA 2AGLA 4X3EA 3OKTA 2B4EA 4I79A 2G9AA 3OKWA 4O9DA 4PBYA 5FKRA 4O3TB 2J55H 5AJAA 5HE1B 5CXCA 5EMLB 3BG1A 3RFHA 3AH8B 4AOWA 4ERQA 2YNOA 5CXCB 1K32A 3PSCB 3UKRC 2P9KC 5IJ8E 2H6NA 4Z8LA 3F3FA 4NSXA 4L9OA 4QL1A 5FQDA 3BG0A 1OLZA 1SQJA 3OTTA 4G56B 5H17A 2YNPA 2CNXA 4ZOXA 3FM0A 2I0TA 2I3TA 1XKSA 3JROA 3ORVD 2GNQA 3GFCA 5SXMA 4N14A 3UVOA 2YBAA 2HESX 4GZ8A 3DWLC 2P9SC 3N0EA 5JWZA 3RN1D 2UZYB 1PGUA 4GM3A 1P22A 4O3UB 2Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC9 A;  3PSL A;  3SWS D;  4FA4 D;  2H14 A;  5FKQ A;  3EI2 A;  2HKR A;  4CI3 A;  3EI2 B;  3I89 A;  1TYQ C;  3UR4 A;  3ULE C;  3MZL A;  2J57 G;  4U7A A;  3N0D A;  3GRE A;  3RRM C;  5EMM B;  3EMH A;  4KFM B;  3V7D B;  4PC0 A;  2H13 A;  2CN3 A;  5EAR A;  4AEZ A;  2AGW A;  4R7A B;  5H14 A;  5EAP A;  3A0F A;  3I2N A;  4JSX C;  5IGQ A;  5CXB A;  3OL2 A;  3MMY A;  4JT6 C;  4A2L A;  3OL2 B;  2IWF A;  4QQE A;  4JD2 C;  1SQ9 A;  3NVN A;  4MK0 B;  3E0C A;  2BCJ B;  3JRP A;  2I0S A;  3AFC A;  2OIZ A;  2QC5 A;  3UVN A;  2CO0 A;  1B9X A;  4ERY A;  3DXM C;  3I7H A;  2P9I C;  4J8G A;  2PBI B;  3CIK B;  2IUV A;  3JPX A;  2PM6 B;  4O1Q D;  4LG8 A;  5FKT A;  4J81 A;  3RN0 D;  4H5J A;  4J8B A;  1FWX A;  2XYI A;  2H68 A;  5B4W A;  2B5M A;  4K3J B;  3IIY A;  5HE3 B;  3PVW B;  4CZX A;  4GGA A;  3SBQ A;  4A11 A;  2XL2 A;  3EI1 A;  4A11 B;  2HJB A;  3EI1 B;  2IAA A;  4IMM A;  5EMJ B;  1GP2 B;  1R5M A;  2PM7 B;  3EI4 A;  5FXY A;  3JB9 L;  2UZX B;  3EI4 B;  1U4C A;  3RMZ D;  5CYK A;  5EM2 A;  5CYK B;  4CI1 A;  3I7P A;  2O9K A;  4ZN4 A;  2P9N C;  3C75 H;  4BUJ C;  5EM2 B;  4U1E I;  1RI6 A;  3DXK C;  3PXT D;  4CY5 A;  5TF2 A;  2CN2 A;  4CZV A;  4YVD A;  3UKU C;  1NR0 A;  1QNI A;  3NVQ A;  3J81 g;  4A09 A;  5FA5 B;  4A09 B;  1JJU B;  4PNK B;  2PM9 A;  2QXV A;  3IIW A;  2PM9 B;  3SMR A;  2H6K A;  3EU7 A;  2IUQ A;  2OVQ B;  2IUR A;  4FAV D;  1B9Y A;  3VA6 A;  4FB1 D;  4JSV C;  3EWE A;  2H9M A;  1XHM A;  2HKM A;  3CFV A;  4CY2 A;  3IJ1 A;  4A0B A;  3C9C A;  4A0B B;  2W18 A;  4GM8 A;  3I7L A;  5I5I A;  3V9F A;  4GQ2 P;  1JOF A;  4D6V A;  1A0R B;  1ERJ A;  4JXM A;  2AGX A;  3F3G A;  3IKO A;  4A2M A;  2Q7Q A;  4Y7R A;  4J86 A;  1JMZ B;  3ZWL B;  2H9L A;  3I7N A;  3FGB A;  4J79 A;  3K27 A;  4D0K A;  3SVW D;  4X61 B;  1NEX B;  3IJ0 A;  5AFU 3;  1JMX B;  4JSP C;  1MG2 A;  1PEV A;  3W15 A;  4GGC A;  4J0W A;  3OW8 A;  4LG9 A;  4BL0 A;  1N6F A;  3RFG A;  3OKY A;  2HXC A;  2IUP A;  3OKY B;  1MG3 A;  4FAN D;  5K1C C;  2OVP B;  4K3I D;  4J87 A;  5HE2 B;  2YNN A;  1OMW B;  5A2Q g;  2Z2O A;  4PXW A;  3MKS B;  3I7K A;  3P4F A;  2I0R A;  4GM9 A;  5IT9 g;  3I8E A;  5EAL A;  3B7F A;  4QT8 A;  2I3S A;  3DSM A;  3EG6 A;  3VGZ A;  4CI8 A;  2XU7 A;  5I5J A;  3FRX A;  3IJC A;  2P9U C;  5K19 A;  4A7J A;  2AH1 A;  3KRW B;  2B5N A;  3EI3 B;  4JSN C;  1S4U X;  2Z2P A;  5C9Z B;  4L1Q D;  3SFZ A;  4CZY A;  5TEE A;  3UVL A;  3C5M A;  3I7O A;  3JZH A;  5THA A;  4CY3 A;  3AL9 A;  5GXI A;  3PE7 A;  3UVK A;  5GXH A;  4PSW B;  3SLE D;  4XYH A;  2H3X A;  4TZ4 A;  3PXS D;  3SN6 B;  3SJL D;  2BBK H;  2AGY A;  4A0A A;  2J56 H;  3KRX B;  4IA9 A;  1GXR A;  3HFQ A;  4A0A B;  3V5W B;  4J84 A;  4L3H D;  5FLX g;  4OWR A;  2P9L C;  3PXW D;  4FHL A;  4QRJ A;  2AH0 A;  4FA9 D;  2YMU A;  2AGZ A;  2HJ4 A;  4A08 A;  3L4M D;  4E5Z A;  4A08 B;  4E5Z B;  5GMK n;  3UVM A;  3BWS A;  4J0X A;  3J80 g;  1YFQ A;  3C99 A;  2G99 A;  3SCY A;  3RLM D;  4EWR A;  3MXX A;  4XEI C;  4J77 A;  5KDO B;  1K8K C;  3SBP A;  3MZK A;  2P9P C;  5IGO A;  5IJ7 E;  3PVU B;  5IC7 A;  2OK4 A;  3L4O D;  1SHY B;  5EAM A;  2H9P A;  1PI6 A;  5C2V B;  3VH0 A;  4OZU A;  1MDA H;  3F3P A;  4E54 A;  2H6Q A;  2HYE A;  5AMS A;  4CI2 A;  4E54 B;  2CO0 C;  2H9N A;  1N6E A;  4L3G D;  4FWW A;  4ERZ A;  3K26 A;  2H47 A;  3RSE C;  2GC7 A;  4LGN A;  5EMK B;  2OK6 A;  2B5L A;  3MKQ A;  4X63 B;  2MTA H;  2OVR B;  2XL3 A;  3SHF A;  4FA5 D;  5C2W B;  2EBS A;  4O45 A;  4J78 A;  3I8C A;  1Q47 A;  4J73 A;  3AL8 A;  4GMB A;  3AL8 B;  5H1M A;  4GGD A;  5I5M A;  4ZOZ A;  3SBR A;  1XIP A;  5TDH B;  4Y5R D;  1GOT B;  2IWK A;  5CXB B;  1U2V C;  3SXT D;  2OJY A;  4ESG A;  5TEF A;  2GC4 A;  3NVX A;  4ES0 A;  4GQ1 A;  1L0Q A;  4BH6 A;  3DM0 A;  4ZOV A;  1VYH C;  4XYI A;  3JAM g;  4JT5 C;  1TBG A;  3JZN A;  4CY1 A;  1PBY B;  2CE8 A;  4X60 B;  4H5I A;  4PBZ A;  4FA1 D;  5HYN B;  3CFS B;  2YB8 B;  5GSA A;  4GQB B;  2TRC B;  3EI3 A;  4ZOY A;  5HE0 B;  2CE9 A;  5HQG A;  2AQ5 A;  1N6D A;  3ODT A;  3U4Y A;  3JZG A;  4UI9 R;  4J82 A;  4HDJ A;  4PSX B;  1GG2 B;  5FKS A;  2AGL A;  4X3E A;  3OKT A;  2B4E A;  4I79 A;  2G9A A;  3OKW A;  4O9D A;  4PBY A;  5FKR A;  4O3T B;  2J55 H;  5AJA A;  5HE1 B;  5CXC A;  5EML B;  3BG1 A;  3RFH A;  3AH8 B;  4AOW A;  4ERQ A;  2YNO A;  5CXC B;  1K32 A;  3PSC B;  3UKR C;  2P9K C;  5IJ8 E;  2H6N A;  4Z8L A;  3F3F A;  4NSX A;  4L9O A;  4QL1 A;  5FQD A;  3BG0 A;  1OLZ A;  1SQJ A;  3OTT A;  4G56 B;  5H17 A;  2YNP A;  2CNX A;  4ZOX A;  3FM0 A;  2I0T A;  2I3T A;  1XKS A;  3JRO A;  3ORV D;  2GNQ A;  3GFC A;  5SXM A;  4N14 A;  3UVO A;  2YBA A;  2HES X;  4GZ8 A;  3DWL C;  2P9S C;  3N0E A;  5JWZ A;  3RN1 D;  2UZY B;  1PGU A;  4GM3 A;  1P22 A;  4O3U B;  2Z2N A; 
#chains in the Genus database with same CATH topology
 1H2Z A;  3PSL A;  1E8M A;  4CC9 A;  3SWS D;  4FA4 D;  2H14 A;  1O6G A;  5FKQ A;  3ZE0 A;  3EI2 A;  2HKR A;  4CI3 A;  2VDO A;  3EI2 B;  3VI3 A;  1H2Y A;  3I89 A;  1TYQ C;  4UM8 A;  3UR4 A;  3ULE C;  3MZL A;  2J57 G;  4U7A A;  3N0D A;  3GRE A;  3RRM C;  5EMM B;  3EMH A;  4KFM B;  3V7D B;  4PC0 A;  2H13 A;  2CN3 A;  1C9I A;  5EAR A;  4AEZ A;  1VZ3 A;  2AGW A;  4R7A B;  4WK0 A;  5H14 A;  1H2W A;  5EAP A;  1UOP A;  3EQ9 A;  3A0F A;  3T3P A;  3I2N A;  4JSX C;  5IGQ A;  5CXB A;  2VDQ A;  3MMY A;  3OL2 A;  5C92 A;  4JT6 C;  4A2L A;  3OL2 B;  2IWF A;  4NBM A;  4QQE A;  4JD2 C;  3ZDX A;  1SQ9 A;  3NVN A;  4MK0 B;  1JTD B;  5E6S A;  3E0C A;  2BCJ B;  3JRP A;  2I0S A;  3AFC A;  2OIZ A;  2QC5 A;  3UVN A;  4AN0 A;  1B9X A;  2CO0 A;  3ZDZ A;  4ERY A;  3NID A;  4JHN A;  3DXM C;  3I7H A;  2P9I C;  4IRZ A;  1UTC A;  2PBI B;  3IUQ A;  3CIK B;  4J8G A;  2IUV A;  3JPX A;  2PM6 B;  4O1Q D;  4LG8 A;  5FKT A;  4J81 A;  3RN0 D;  4H5J A;  2VDN A;  4J8B A;  2HU5 A;  4BCD A;  1FWX A;  2XYI A;  2H68 A;  5B4W A;  3IVM A;  3NIF A;  1M1X A;  2B5M A;  4Z7O A;  4K3J B;  3IIY A;  5HE3 B;  3PVW B;  4CZX A;  4NC4 A;  4GGA A;  3SBQ A;  4A11 A;  2XL2 A;  3EI1 A;  3GC3 B;  4A11 B;  2HJB A;  3EI1 B;  5M61 A;  2IAA A;  4IMM A;  5EMJ B;  1GP2 B;  2XDW A;  1R5M A;  2PM7 B;  3EI4 A;  5FXY A;  3JB9 L;  2EIB A;  2UZX B;  3EI4 B;  1U4C A;  3RMZ D;  1C9L A;  5CYK A;  1L5G A;  5EM2 A;  3V4V A;  5CYK B;  4CI1 A;  3I7P A;  2O9K A;  4ZN4 A;  2P9N C;  3C75 H;  4BUJ C;  5EM2 B;  4U1E I;  1QFS A;  1RI6 A;  3DXK C;  3PXT D;  3MUN A;  4CY5 A;  5TF2 A;  2CN2 A;  4CZV A;  3FCU A;  4YVD A;  2HU8 A;  3UKU C;  1NR0 A;  1QNI A;  3NVQ A;  1UOQ A;  3J81 g;  4A09 A;  3K71 A;  3QHY B;  5FA5 B;  2VDL A;  1K3I A;  3ZE1 A;  4A09 B;  1JJU B;  4PNK B;  2PM9 A;  2QXV A;  3IIW A;  2PM9 B;  3SMR A;  2H6K A;  3EU7 A;  2VZ1 A;  2IUQ A;  2OVQ B;  2IUR A;  3FCS A;  4FAV D;  3IUL A;  3K72 A;  1B9Y A;  3VA6 A;  4FB1 D;  4JSV C;  3EWE A;  2H9M A;  1XHM A;  2HKM A;  3CFV A;  4CY2 A;  3IJ1 A;  4A0B A;  3C9C A;  4A0B B;  2W18 A;  4GM8 A;  3I7L A;  5I5I A;  2XZG A;  3V9F A;  4GQ2 P;  1JOF A;  4D6V A;  1A0R B;  1ERJ A;  4G1M A;  1H2X A;  3GD1 I;  4JXM A;  2AGX A;  3F3G A;  3IKO A;  4A2M A;  2Q7Q A;  4O02 A;  4Y7R A;  4RE6 A;  4J86 A;  4BCC A;  3NIG A;  4D9S A;  1JMZ B;  3ZWL B;  2H9L A;  3I7N A;  3FGB A;  5FFG A;  4J79 A;  3K27 A;  4D0K A;  3SVW D;  1E5T A;  4X61 B;  1NEX B;  3IJ0 A;  5AFU 3;  5M5R A;  1JMX B;  4JSP C;  5M5U A;  1MG2 A;  1PEV A;  3W15 A;  1JV2 A;  1O6F A;  4GGC A;  4J0W A;  3IUN A;  3OW8 A;  4LG9 A;  4BL0 A;  1N6F A;  3RFG A;  3OKY A;  2HXC A;  2IUP A;  3OKY B;  1MG3 A;  4FAN D;  5K1C C;  2OVP B;  4K3I D;  4J87 A;  4DNW A;  5HE2 B;  3MVD K;  2YNN A;  1OMW B;  1I2M B;  2VDP A;  5A2Q g;  2Z2O A;  4PXW A;  3MKS B;  3I7K A;  5M5V A;  3P4F A;  2I0R A;  4JHP C;  4GM9 A;  5IT9 g;  3I8E A;  5EAL A;  3B7F A;  2VC2 A;  4AMY A;  4QT8 A;  3IUR A;  1VE7 A;  2I3S A;  3DSM A;  4WJK A;  1UOO A;  3EG6 A;  3VGZ A;  4CI8 A;  2XU7 A;  5I5J A;  3FRX A;  3IJC A;  2P9U C;  5K19 A;  4A7J A;  2AH1 A;  3KCI A;  3KRW B;  2B5N A;  3EI3 B;  4JSN C;  1S4U X;  2Z2P A;  5C9Z B;  4L1Q D;  3SFZ A;  4CZY A;  1QFM A;  5TEE A;  3UVL A;  3C5M A;  4L1M A;  3I7O A;  3JZH A;  5THA A;  4QAM A;  4BP9 A;  4CY3 A;  3AL9 A;  5GXI A;  3PE7 A;  2VDM A;  3UVK A;  5GXH A;  4PSW B;  3SLE D;  3V4P A;  2QR5 A;  4XYH A;  2H3X A;  4TZ4 A;  3PXS D;  5M5S A;  3SN6 B;  3SJL D;  2BBK H;  2AGY A;  4A0A A;  2J56 H;  3KRX B;  4IA9 A;  1GXR A;  3HFQ A;  4A0A B;  5HDB A;  3V5W B;  4J84 A;  4L3H D;  4BCB A;  1A12 A;  5FLX g;  4OWR A;  5M5T A;  2P9L C;  3PXW D;  4FHL A;  1T2X A;  4QRJ A;  2AH0 A;  4FA9 D;  2YMU A;  2AGZ A;  2HJ4 A;  4A08 A;  3L4M D;  4E5Z A;  4A08 B;  4E5Z B;  5GMK n;  1BPO A;  2EIE A;  3UVM A;  3BWS A;  4J0X A;  3J80 g;  1YFQ A;  3C99 A;  2G99 A;  1YR2 A;  3SCY A;  3RLM D;  4EWR A;  3MXX A;  4XEI C;  4J77 A;  5KDO B;  5FFO A;  2VZ3 A;  1K8K C;  3SBP A;  3MZK A;  2P9P C;  5IGO A;  5IJ7 E;  3PVU B;  5IC7 A;  2VDR A;  2OK4 A;  3L4O D;  1SHY B;  3O4H A;  5EAM A;  3K6S A;  2H9P A;  1PI6 A;  4O2W A;  5C2V B;  3VH0 A;  4OZU A;  1MDA H;  1GOH A;  3F3P A;  4E54 A;  2H6Q A;  2HYE A;  5AMS A;  4CI2 A;  4E54 B;  4AMZ A;  2CO0 C;  2H9N A;  1N6E A;  4G1E A;  4L3G D;  3IJE A;  4DNU A;  5C86 A;  4FWW A;  4ERZ A;  1TYE A;  3K26 A;  2H47 A;  4MMY A;  2JKX A;  3RSE C;  2GC7 A;  4G55 A;  4LGN A;  5EMK B;  2OK6 A;  2B5L A;  3MKQ A;  4X63 B;  2MTA H;  2OVR B;  2XL3 A;  3SHF A;  4FA5 D;  5C2W B;  2EBS A;  4O45 A;  4J78 A;  3ZE2 A;  3I8C A;  1Q47 A;  1VZ2 A;  4J73 A;  3AL8 A;  4GMB A;  3AL8 B;  5H1M A;  4GGD A;  4Z7Q A;  5I5M A;  4ZOZ A;  3SBR A;  1XIP A;  5TDH B;  4Y5R D;  1GOT B;  2IWK A;  5CXB B;  3ZDY A;  1VE6 A;  1U2V C;  3SXT D;  2OJY A;  4ESG A;  5TEF A;  3O4G A;  2GC4 A;  2EID A;  3NVX A;  4RE5 A;  4ES0 A;  4GQ1 A;  1L0Q A;  4WK4 A;  3DM0 A;  4BH6 A;  4ZOV A;  1VYH C;  4XYI A;  3JAM g;  4JT5 C;  1TBG A;  3JZN A;  4CY1 A;  4AN1 A;  1E8N A;  1PBY B;  2CE8 A;  4X60 B;  3OF7 A;  4H5I A;  4PBZ A;  4MMX A;  2VDK A;  4FA1 D;  5HYN B;  3CFS B;  2YB8 B;  4BP8 A;  5GSA A;  4GQB B;  2TRC B;  3EQ7 A;  3O4I A;  3EI3 A;  3DDU A;  4ZOY A;  5HE0 B;  2CE9 A;  5HQG A;  2AQ5 A;  1N6D A;  4DNV A;  3ODT A;  3U4Y A;  3JZG A;  4UI9 R;  4UM9 A;  2BKL A;  4J82 A;  4HDJ A;  4PSX B;  1GG2 B;  5FKS A;  1U8C A;  4NEN A;  2AGL A;  4WK2 A;  3EQ8 A;  4X3E A;  3OKT A;  2B4E A;  4I79 A;  2G9A A;  3OKW A;  4O9D A;  4PBY A;  5FKR A;  4O3T B;  1GOG A;  2J55 H;  5AJA A;  5CXC A;  5HE1 B;  5EML B;  3BG1 A;  3RFH A;  3AH8 B;  4AOW A;  4ERQ A;  2YNO A;  5CXC B;  1K32 A;  3PSC B;  3UKR C;  2P9K C;  5IJ8 E;  2H6N A;  1GOF A;  4Z8L A;  2EIC A;  3MUO A;  3F3F A;  4NSX A;  4L9O A;  4QL1 A;  5E6R A;  5FQD A;  3BG0 A;  1OLZ A;  3QI0 A;  4AX4 A;  1SQJ A;  2XE4 A;  3IUJ A;  3OTT A;  4G56 B;  5H17 A;  2YNP A;  2CNX A;  4NAA A;  4ZOX A;  2HU7 A;  3FM0 A;  2I0T A;  3T3M A;  2I3T A;  1XKS A;  3JRO A;  3ORV D;  2GNQ A;  2QZP A;  4MMZ A;  3GFC A;  5SXM A;  4N14 A;  3VI4 A;  5E6U A;  3UVO A;  2YBA A;  2HES X;  4GZ8 A;  4Z7N A;  3DWL C;  2P9S C;  3N0E A;  3IUM A;  5JWZ A;  3O4J A;  2WQ8 A;  3RN1 D;  2UZY B;  1PGU A;  4GM3 A;  1P22 A;  4O3U B;  2Z2N A; 
#chains in the Genus database with same CATH homology
 4CC9 A;  3PSL A;  3SWS D;  4FA4 D;  2H14 A;  5FKQ A;  3EI2 A;  2HKR A;  4CI3 A;  3EI2 B;  3I89 A;  1TYQ C;  3UR4 A;  3ULE C;  3MZL A;  2J57 G;  4U7A A;  3N0D A;  3GRE A;  3RRM C;  5EMM B;  3EMH A;  4KFM B;  3V7D B;  4PC0 A;  2H13 A;  2CN3 A;  5EAR A;  4AEZ A;  2AGW A;  4R7A B;  5H14 A;  5EAP A;  3A0F A;  3I2N A;  4JSX C;  5IGQ A;  5CXB A;  3OL2 A;  3MMY A;  4JT6 C;  4A2L A;  3OL2 B;  2IWF A;  4QQE A;  4JD2 C;  1SQ9 A;  3NVN A;  4MK0 B;  3E0C A;  2BCJ B;  3JRP A;  2I0S A;  3AFC A;  2OIZ A;  2QC5 A;  3UVN A;  2CO0 A;  1B9X A;  4ERY A;  3DXM C;  3I7H A;  2P9I C;  4J8G A;  2PBI B;  3CIK B;  2IUV A;  3JPX A;  2PM6 B;  4O1Q D;  4LG8 A;  5FKT A;  4J81 A;  3RN0 D;  4H5J A;  4J8B A;  1FWX A;  2XYI A;  2H68 A;  5B4W A;  2B5M A;  4K3J B;  3IIY A;  5HE3 B;  3PVW B;  4CZX A;  4GGA A;  3SBQ A;  4A11 A;  2XL2 A;  3EI1 A;  4A11 B;  2HJB A;  3EI1 B;  2IAA A;  4IMM A;  5EMJ B;  1GP2 B;  1R5M A;  2PM7 B;  3EI4 A;  5FXY A;  3JB9 L;  2UZX B;  3EI4 B;  1U4C A;  3RMZ D;  5CYK A;  5EM2 A;  5CYK B;  4CI1 A;  3I7P A;  2O9K A;  4ZN4 A;  2P9N C;  3C75 H;  4BUJ C;  5EM2 B;  4U1E I;  1RI6 A;  3DXK C;  3PXT D;  4CY5 A;  5TF2 A;  2CN2 A;  4CZV A;  4YVD A;  3UKU C;  1NR0 A;  1QNI A;  3NVQ A;  3J81 g;  4A09 A;  5FA5 B;  4A09 B;  1JJU B;  4PNK B;  2PM9 A;  2QXV A;  3IIW A;  2PM9 B;  3SMR A;  2H6K A;  3EU7 A;  2IUQ A;  2OVQ B;  2IUR A;  4FAV D;  1B9Y A;  3VA6 A;  4FB1 D;  4JSV C;  3EWE A;  2H9M A;  1XHM A;  2HKM A;  3CFV A;  4CY2 A;  3IJ1 A;  4A0B A;  3C9C A;  4A0B B;  2W18 A;  4GM8 A;  3I7L A;  5I5I A;  3V9F A;  4GQ2 P;  1JOF A;  4D6V A;  1A0R B;  1ERJ A;  4JXM A;  2AGX A;  3F3G A;  3IKO A;  4A2M A;  2Q7Q A;  4Y7R A;  4J86 A;  1JMZ B;  3ZWL B;  2H9L A;  3I7N A;  3FGB A;  4J79 A;  3K27 A;  4D0K A;  3SVW D;  4X61 B;  1NEX B;  3IJ0 A;  5AFU 3;  1JMX B;  4JSP C;  1MG2 A;  1PEV A;  3W15 A;  4GGC A;  4J0W A;  3OW8 A;  4LG9 A;  4BL0 A;  1N6F A;  3RFG A;  3OKY A;  2HXC A;  2IUP A;  3OKY B;  1MG3 A;  4FAN D;  5K1C C;  2OVP B;  4K3I D;  4J87 A;  5HE2 B;  2YNN A;  1OMW B;  5A2Q g;  2Z2O A;  4PXW A;  3MKS B;  3I7K A;  3P4F A;  2I0R A;  4GM9 A;  5IT9 g;  3I8E A;  5EAL A;  3B7F A;  4QT8 A;  2I3S A;  3DSM A;  3EG6 A;  3VGZ A;  4CI8 A;  2XU7 A;  5I5J A;  3FRX A;  3IJC A;  2P9U C;  5K19 A;  4A7J A;  2AH1 A;  3KRW B;  2B5N A;  3EI3 B;  4JSN C;  1S4U X;  2Z2P A;  5C9Z B;  4L1Q D;  3SFZ A;  4CZY A;  5TEE A;  3UVL A;  3C5M A;  3I7O A;  3JZH A;  5THA A;  4CY3 A;  3AL9 A;  5GXI A;  3PE7 A;  3UVK A;  5GXH A;  4PSW B;  3SLE D;  4XYH A;  2H3X A;  4TZ4 A;  3PXS D;  3SN6 B;  3SJL D;  2BBK H;  2AGY A;  4A0A A;  2J56 H;  3KRX B;  4IA9 A;  1GXR A;  3HFQ A;  4A0A B;  3V5W B;  4J84 A;  4L3H D;  5FLX g;  4OWR A;  2P9L C;  3PXW D;  4FHL A;  4QRJ A;  2AH0 A;  4FA9 D;  2YMU A;  2AGZ A;  2HJ4 A;  4A08 A;  3L4M D;  4E5Z A;  4A08 B;  4E5Z B;  5GMK n;  3UVM A;  3BWS A;  4J0X A;  3J80 g;  1YFQ A;  3C99 A;  2G99 A;  3SCY A;  3RLM D;  4EWR A;  3MXX A;  4XEI C;  4J77 A;  5KDO B;  1K8K C;  3SBP A;  3MZK A;  2P9P C;  5IGO A;  5IJ7 E;  3PVU B;  5IC7 A;  2OK4 A;  3L4O D;  1SHY B;  5EAM A;  2H9P A;  1PI6 A;  5C2V B;  3VH0 A;  4OZU A;  1MDA H;  3F3P A;  4E54 A;  2H6Q A;  2HYE A;  5AMS A;  4CI2 A;  4E54 B;  2CO0 C;  2H9N A;  1N6E A;  4L3G D;  4FWW A;  4ERZ A;  3K26 A;  2H47 A;  3RSE C;  2GC7 A;  4LGN A;  5EMK B;  2OK6 A;  2B5L A;  3MKQ A;  4X63 B;  2MTA H;  2OVR B;  2XL3 A;  3SHF A;  4FA5 D;  5C2W B;  2EBS A;  4O45 A;  4J78 A;  3I8C A;  1Q47 A;  4J73 A;  3AL8 A;  4GMB A;  3AL8 B;  5H1M A;  4GGD A;  5I5M A;  4ZOZ A;  3SBR A;  1XIP A;  5TDH B;  4Y5R D;  1GOT B;  2IWK A;  5CXB B;  1U2V C;  3SXT D;  2OJY A;  4ESG A;  5TEF A;  2GC4 A;  3NVX A;  4ES0 A;  4GQ1 A;  1L0Q A;  4BH6 A;  3DM0 A;  4ZOV A;  1VYH C;  4XYI A;  3JAM g;  4JT5 C;  1TBG A;  3JZN A;  4CY1 A;  1PBY B;  2CE8 A;  4X60 B;  4H5I A;  4PBZ A;  4FA1 D;  5HYN B;  3CFS B;  2YB8 B;  5GSA A;  4GQB B;  2TRC B;  3EI3 A;  4ZOY A;  5HE0 B;  2CE9 A;  5HQG A;  2AQ5 A;  1N6D A;  3ODT A;  3U4Y A;  3JZG A;  4UI9 R;  4J82 A;  4HDJ A;  4PSX B;  1GG2 B;  5FKS A;  2AGL A;  4X3E A;  3OKT A;  2B4E A;  4I79 A;  2G9A A;  3OKW A;  4O9D A;  4PBY A;  5FKR A;  4O3T B;  2J55 H;  5AJA A;  5HE1 B;  5CXC A;  5EML B;  3BG1 A;  3RFH A;  3AH8 B;  4AOW A;  4ERQ A;  2YNO A;  5CXC B;  1K32 A;  3PSC B;  3UKR C;  2P9K C;  5IJ8 E;  2H6N A;  4Z8L A;  3F3F A;  4NSX A;  4L9O A;  4QL1 A;  5FQD A;  3BG0 A;  1OLZ A;  1SQJ A;  3OTT A;  4G56 B;  5H17 A;  2YNP A;  2CNX A;  4ZOX A;  3FM0 A;  2I0T A;  2I3T A;  1XKS A;  3JRO A;  3ORV D;  2GNQ A;  3GFC A;  5SXM A;  4N14 A;  3UVO A;  2YBA A;  2HES X;  4GZ8 A;  3DWL C;  2P9S C;  3N0E A;  5JWZ A;  3RN1 D;  2UZY B;  1PGU A;  4GM3 A;  1P22 A;  4O3U B;  2Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...