2OK6A

Crystal structure of aromatic amine dehydrogenase ttq-formamide adduct oxidized with ferricyanide.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ok6A01
3I7OA 3HFQA 3MMYA 2GNQA 4H5JA 2AH0A 2IAAA 1OLZA 4CY5A 4D6VA 4CY1A 4FA1D 3JZNA 5HE3B 1XHMA 3SBPA 3K27A 3SMRA 3SN6B 2AH1A 4GGDA 4A08A 4FA5D 3EI1B 4YVDA 2UZYB 5C9ZB 3AL9A 3OKTA 4D0KA 4JT5C 4AEZA 4CY3A 1MDAH 3NVQA 5B4WA 4L1QD 4NSXA 3JAMg 3IIYA 4LG9A 3I7KA 2G99A 2CN2A 2GC7A 2I3TA 1A0RB 3FGBA 4O3UB 3PE7A 4R7AB 3P4FA 4UI9R 2I0TA 4A0AA 2I3SA 3C9CA 2H9PA 5IGQA 5CXCB 5H1MA 2TRCB 4CZXA 5FLXg 5TF2A 4FB1D 4J87A 3MZLA 4A2LA 3U4YA 3RMZD 3CIKB 1GG2B 2H6NA 3SBQA 4JSPC 3UR4A 3SFZA 3RN1D 4PBZA 3RSEC 1JMZB 2OVRB 3IKOA 1P22A 5THAA 5K19A 5GSAA 3I2NA 4FA9D 5IT9g 4A0AB 3FRXA 4L3HD 2CE8A 5FKQA 3BWSA 4CY2A 3K26A 2YB8B 4J86A 5AFU3 2J55H 2B4EA 3I7HA 4JT6C 4QL1A 4ES0A 2Z2PA 5H14A 5IC7A 3EI2B 3ZWLB 4FAND 4ERYA 1OMWB 3C5MA 3V7DB 3MKQA 4QRJA 4FWWA 5AJAA 2PM7B 2XL3A 2AGXA 4MK0B 3I89A 1U2VC 4K3JB 3F3GA 3L4OD 3V5WB 3DXMC 3I8EA 4KFMB 2GC4A 3AL8A 3NVNA 1N6DA 2O9KA 5HYNB 3PSLA 2AQ5A 3RRMC 3ORVD 1ERJA 3EI1A 2YBAA 2CNXA 3PXSD 5FXYA 2EBSA 2Z2OA 5EALA 5SXMA 4ZOYA 2HJBA 2CE9A 3J80g 3SBRA 1TBGA 2P9PC 3OW8A 4LG8A 2BBKH 4GQ2P 3PXTD 3N0EA 4H5IA 2H47A 3AL8B 4J0XA 2QXVA 5EMLB 2AGZA 3I7NA 2AGWA 3PVWB 2J57G 2CO0C 1FWXA 1K8KC 2PBIB 5CXCA 2I0RA 5EM2A 4GQ1A 5EAPA 5TEEA 3OL2B 1QNIA 3C99A 5K1CC 5FKRA 3MKSB 3DWLC 2B5MA 1VYHC 2B5LA 1JMXB 1MG3A 2H68A 2IURA 3PXWD 2Z2NA 2OK6A 4AOWA 4OZUA 3FM0A 5FKSA 1RI6A 4O3TB 2XL2A 2OVQB 5EM2B 3OKWA 4J81A 4JD2C 1PGUA 4EWRA 3KRXB 3BG1A 3PVUB 3SXTD 3EWEA 2CN3A 1R5MA 4A2MA 1SQ9A 3AFCA 2P9KC 3JB9L 2OJYA 3F3FA 4TZ4A 3AH8B 3EI2A 3JROA 3CFVA 4GGAA 4U1EI 3ODTA 2P9SC 4J73A 5C2VB 4OWRA 5EMJB 4E54B 4XYHA 3EG6A 3RLMD 2YNNA 2YNOA 4CI8A 2YNPA 3JRPA 3OKYB 4PC0A 1N6FA 1U4CA 4X61B 5GMKn 3V9FA 2PM9B 4IA9A 4ZOXA 4XEIC 2HYEA 3SJLD 1JJUB 2AGLA 1JOFA 2G9AA 1GXRA 3KRWB 4LGNA 4E5ZB 3EI4B 2OVPB 3ULEC 3RFGA 4A0BB 2P9NC 4CI2A 2HXCA 3DXKC 5HQGA 4BUJC 5KDOB 4A11B 2XYIA 4GMBA 4CI3A 3BG0A 4ERQA 2H6QA 4J78A 5TDHB 4GM9A 5JWZA 3IIWA 3OL2A 4GQBB 2HJ4A 1XIPA 1SQJA 3L4MD 4QT8A 4GM3A 3OTTA 3IJ0A 4J8GA 3A0FA 5CXBB 5FA5B 4GZ8A 4FA4D 2B5NA 3J81g 1PI6A 3N0DA 3B7FA 4FAVD 5I5IA 1GOTB 1MG2A 4GM8A 3I8CA 1S4UX 5C2WB 4ESGA 3RN0D 4PNKB 5GXHA 4ERZA 2IWFA 4J84A 3EI3A 2J56H 3SWSD 1B9YA 2IUVA 3UKUC 3PSCB 3RFHA 2H6KA 3W15A 4J0WA 4CI1A 5FQDA 5HE0B 1PEVA 3GREA 4J79A 4XYIA 2HKMA 3E0CA 1B9XA 3IJ1A 3UKRC 3EU7A 4BL0A 5IJ8E 4E54A 4Y5RD 3MXXA 5A2Qg 2W18A 3NVXA 1N6EA 4Z8LA 1YFQA 3SVWD 3JZGA 3VH0A 2H9LA 4CZVA 2H13A 3EI3B 4PSXB 2IUQA 4O45A 3OKYA 4X60B 4A08B 2H9MA 2XU7A 2YMUA 2HESX 4ZOVA 3SLED 5FKTA 2IUPA 2PM9A 4O1QD 3JPXA 3UVKA 5HE1B 4QQEA 4E5ZA 2AGYA 3F3PA 3EI4A 3DSMA 2P9LC 2Q7QA 3CFSB 3GFCA 4L3GD 4A0BA 4X63B 3C75H 4A7JA 2IWKA 3UVLA 4ZN4A 2I0SA 4IMMA 5EARA 5CYKA 4A11A 5H17A 3UVMA 2UZXB 1Q47A 1SHYB 5TEFA 2QC5A 5HE2B 4JSXC 4GGCA 4FHLA 4J8BA 2MTAH 3SHFA 2CO0A 5I5MA 1NEXB 4O9DA 4X3EA 4JSNC 3I7PA 4L9OA 1L0QA 5CYKB 4HDJA 5EMMB 2HKRA 4U7AA 5CXBA 4PBYA 2BCJB 2OIZA 4ZOZA 4PSWB 1XKSA 1K32A 2PM6B 4JXMA 4CZYA 5IGOA 1GP2B 3VGZA 3I7LA 2OK4A 4A09A 4K3ID 2H9NA 5IJ7E 1NR0A 3VA6A 3SCYA 3JZHA 1TYQC 5EAMA 4I79A 2H14A 4J77A 5I5JA 2H3XA 3UVOA 3UVNA 2P9UC 3IJCA 3DM0A 4CC9A 4PXWA 5GXIA 4Y7RA 1PBYB 4JSVC 5EMKB 5AMSA 3MZKA 4J82A 4BH6A 2P9IC 4G56B 3EMHA 4N14A 4A09B
chains in the Genus database with same CATH superfamily
3I7OA 3HFQA 3MMYA 2GNQA 4H5JA 2AH0A 2IAAA 1OLZA 4CY5A 3DDUA 4D6VA 4CY1A 4FA1D 3JZNA 5HE3B 1XHMA 3SBPA 3K27A 3SMRA 3SN6B 2AH1A 4GGDA 4A08A 2VC2A 4FA5D 3ZDZA 3EI1B 4YVDA 2UZYB 5C9ZB 3AL9A 3OKTA 4D0KA 4JT5C 4AEZA 4CY3A 4DNWA 1MDAH 3NVQA 5B4WA 4L1QD 4NSXA 4DNVA 3IIYA 3JAMg 4LG9A 3I7KA 2G99A 2CN2A 5M5UA 2GC7A 1C9LA 2I3TA 3FCUA 3MUOA 5M5SA 1A0RB 3FGBA 4O3UB 3PE7A 4R7AB 3P4FA 4UI9R 4N14A 1H2WA 2I0TA 4JHNA 4A0AA 2I3SA 3C9CA 2H9PA 1E5TA 5IGQA 5CXCB 1UOPA 5H1MA 2VDOA 2TRCB 4CZXA 5FLXg 4IRZA 3IUQA 5TF2A 2VDMA 3IULA 3MZLA 4J87A 4A2LA 4FB1D 3RMZD 3U4YA 3CIKB 1GG2B 2H6NA 3SBQA 4JSPC 2EIDA 3SFZA 3UR4A 3RN1D 4PBZA 3RSEC 1JMZB 3IJEA 2OVRB 3IKOA 1P22A 5THAA 5K19A 5GSAA 4RE6A 3I2NA 1GOHA 3O4IA 2HU8A 4FA9D 5IT9g 4A0AB 3FRXA 4L3HD 3MVDK 2CE8A 1UOOA 5FKQA 3FCSA 3BWSA 4CY2A 3K26A 5M5TA 2XE4A 3O4JA 2YB8B 4J86A 4G1EA 5AFU3 2J55H 3QI0A 2B4EA 3I7HA 5E6SA 4JT6C 4QL1A 4ES0A 2Z2PA 1H2ZA 5H14A 5IC7A 3EI2B 3ZWLB 4FAND 4G55A 4AX4A 4WK4A 4ERYA 1H2XA 1OMWB 3C5MA 3V7DB 5M5VA 3MUNA 3MKQA 4QRJA 4FWWA 5AJAA 2PM7B 3EQ9A 2XL3A 3I89A 2AGXA 1U2VC 4MK0B 3F3GA 4K3JB 5FFOA 3L4OD 2HU7A 1GOGA 4UM9A 3IUNA 3V5WB 3DXMC 3ZDYA 3I8EA 4KFMB 2GC4A 2VDLA 3AL8A 3NVNA 1N6DA 4MMZA 2O9KA 5HYNB 3PSLA 3V4VA 2AQ5A 4JHPC 3ORVD 3RRMC 1ERJA 1L5GA 4NBMA 3EI1A 2YBAA 2CNXA 3PXSD 5FXYA 2EBSA 2Z2OA 5EALA 5SXMA 4ZOYA 2QZPA 2HJBA 2CE9A 3J80g 3SBRA 1TBGA 2P9PC 3OW8A 4LG8A 2BBKH 4DNUA 1UTCA 4GQ2P 3PXTD 3KCIA 3N0EA 4H5IA 3EQ7A 4O2WA 3GD1I 2H47A 3AL8B 4J0XA 2QXVA 5EMLB 1A12A 2AGZA 3I7NA 2AGWA 3PVWB 2J57G 2CO0C 1FWXA 4BCDA 1K8KC 2PBIB 4G1MA 2I0RA 5CXCA 5EM2A 3NIDA 4GQ1A 5EAPA 5E6RA 5TEEA 3OL2B 3V4PA 1QNIA 3C99A 3O4GA 5FKRA 5K1CC 3MKSB 3IUJA 3DWLC 1JTDB 4AMYA 3QHYB 2B5MA 4WJKA 1VYHC 2B5LA 3OF7A 1JMXB 1MG3A 2H68A 4L1MA 3VI4A 2IURA 3PXWD 2Z2NA 2OK6A 4AOWA 1VZ3A 4OZUA 3FM0A 3ZE1A 3NIFA 4WK2A 3IUMA 3GC3B 5FKSA 1RI6A 4O3TB 2XL2A 1TYEA 2OVQB 5EM2B 3OKWA 4J81A 4JD2C 1PGUA 4EWRA 5M5RA 3KRXB 3BG1A 3PVUB 3SXTD 1VE6A 3EWEA 1VZ2A 2CN3A 1R5MA 4A2MA 1SQ9A 3AFCA 2P9KC 3JB9L 2OJYA 3F3FA 4TZ4A 3AH8B 4AN1A 3NIGA 3EI2A 3JROA 3CFVA 1BPOA 4GGAA 2HU5A 4U1EI 3ODTA 2P9SC 4J73A 4NENA 5C2VB 4OWRA 5EMJB 4E54B 4XYHA 3EG6A 3RLMD 2YNNA 2YNOA 1QFMA 4Z7OA 1U8CA 4CI8A 2VDRA 2YNPA 4Z7QA 3JRPA 2EICA 3OKYB 4PC0A 2QR5A 1N6FA 1U4CA 4X61B 5GMKn 2XZGA 3V9FA 2PM9B 4BCBA 4IA9A 4ZOXA 4XEIC 2HYEA 3SJLD 1O6FA 3T3PA 1JJUB 2AGLA 1JOFA 2G9AA 1GXRA 3KRWB 4AN0A 4LGNA 4E5ZB 3EI4B 2OVPB 3ULEC 3O4HA 2VDKA 3RFGA 4A0BB 2P9NC 4CI2A 2HXCA 3DXKC 3K71A 5HQGA 4BUJC 3ZE0A 5KDOB 4A11B 4AMZA 2VZ3A 4RE5A 2XYIA 4GMBA 4CI3A 3BG0A 4ERQA 3K6SA 4Z7NA 2H6QA 4J78A 5TDHB 4GM9A 5JWZA 3IIWA 3OL2A 4GQBB 2HJ4A 1XIPA 1SQJA 2EIEA 3L4MD 3ZDXA 4QT8A 4GM3A 3OTTA 3IJ0A 4J8GA 3A0FA 5CXBB 5FA5B 4GZ8A 4FA4D 3IVMA 2B5NA 3J81g 1PI6A 3N0DA 3B7FA 4FAVD 5I5IA 4BP9A 1GOTB 5C86A 1MG2A 4GM8A 3I8CA 1S4UX 5C2WB 4ESGA 3RN0D 4PNKB 5GXHA 4ERZA 2IWFA 4J84A 2XDWA 3EI3A 2J56H 3SWSD 1B9YA 1E8NA 2EIBA 2IUVA 3UKUC 3PSCB 3RFHA 2H6KA 3W15A 4J0WA 4CI1A 5FQDA 5HE0B 5HDBA 1PEVA 3GREA 4J79A 4XYIA 2HKMA 3E0CA 1B9XA 3IJ1A 3UKRC 3EU7A 4BL0A 1E8MA 5IJ8E 4E54A 4Y5RD 3MXXA 1T2XA 2W18A 3NVXA 1N6EA 4Z8LA 1YFQA 5A2Qg 3SVWD 3JZGA 3VH0A 2H9LA 4CZVA 4NC4A 2H13A 3EI3B 1C9IA 2JKXA 2IUQA 4PSXB 4O45A 3OKYA 1M1XA 4X60B 4A08B 1YR2A 2H9MA 2XU7A 2YMUA 2HESX 4ZOVA 3SLED 5FKTA 2IUPA 2PM9A 4O1QD 2VDQA 3JPXA 3K72A 3UVKA 3VI3A 5HE1B 3T3MA 4QQEA 4E5ZA 2AGYA 3F3PA 4UM8A 3EI4A 1O6GA 3DSMA 2WQ8A 2P9LC 2Q7QA 3CFSB 3GFCA 4L3GD 4A0BA 4X63B 3C75H 4A7JA 2IWKA 3UVLA 4ZN4A 2VDPA 2I0SA 4IMMA 5EARA 5CYKA 4A11A 5H17A 3UVMA 4WK0A 1UOQA 2UZXB 5E6UA 1Q47A 1SHYB 5TEFA 2QC5A 5HE2B 1K3IA 4JSXC 4GGCA 4FHLA 4J8BA 2MTAH 3SHFA 2CO0A 4D9SA 5I5MA 1NEXB 4O9DA 4X3EA 4JSNC 5FFGA 3I7PA 4L9OA 1L0QA 3EQ8A 5CYKB 1GOFA 4HDJA 3IURA 5EMMB 2HKRA 4U7AA 5CXBA 5M61A 4PBYA 1JV2A 3ZE2A 2BCJB 2OIZA 5C92A 4ZOZA 4MMXA 4PSWB 1XKSA 1K32A 2PM6B 4JXMA 4CZYA 5IGOA 1GP2B 4NAAA 3VGZA 3I7LA 1VE7A 2OK4A 1QFSA 4A09A 4K3ID 2H9NA 5IJ7E 1NR0A 3VA6A 3SCYA 4BP8A 3JZHA 1TYQC 5EAMA 4I79A 1H2YA 2H14A 4J77A 5I5JA 3UVOA 2VZ1A 3UVNA 2P9UC 2VDNA 4MMYA 3IJCA 3DM0A 4QAMA 4CC9A 4PXWA 5GXIA 4Y7RA 1PBYB 2BKLA 4BCCA 4JSVC 5EMKB 5AMSA 3MZKA 4J82A 4BH6A 2P9IC 4G56B 4O02A 1I2MB 3EMHA 2H3XA 4A09B
chains in the Genus database with same CATH topology
3I7OA 3HFQA 3MMYA 2GNQA 4H5JA 2AH0A 2IAAA 1OLZA 4CY5A 4D6VA 4CY1A 4FA1D 3JZNA 5HE3B 1XHMA 3SBPA 3K27A 3SMRA 3SN6B 2AH1A 4GGDA 4A08A 4FA5D 3EI1B 4YVDA 2UZYB 5C9ZB 3AL9A 3OKTA 4D0KA 4JT5C 4AEZA 4CY3A 1MDAH 3NVQA 5B4WA 4L1QD 4NSXA 3JAMg 3IIYA 4LG9A 3I7KA 2G99A 2CN2A 2GC7A 2I3TA 1A0RB 3FGBA 4O3UB 3PE7A 4R7AB 3P4FA 4UI9R 2I0TA 4A0AA 2I3SA 3C9CA 2H9PA 5IGQA 5CXCB 5H1MA 2TRCB 4CZXA 5FLXg 5TF2A 4FB1D 4J87A 3MZLA 4A2LA 3U4YA 3RMZD 3CIKB 1GG2B 2H6NA 3SBQA 4JSPC 3UR4A 3SFZA 3RN1D 4PBZA 3RSEC 1JMZB 2OVRB 3IKOA 1P22A 5THAA 5K19A 5GSAA 3I2NA 4FA9D 5IT9g 4A0AB 3FRXA 4L3HD 2CE8A 5FKQA 3BWSA 4CY2A 3K26A 2YB8B 4J86A 5AFU3 2J55H 2B4EA 3I7HA 4JT6C 4QL1A 4ES0A 2Z2PA 5H14A 5IC7A 3EI2B 3ZWLB 4FAND 4ERYA 1OMWB 3C5MA 3V7DB 3MKQA 4QRJA 4FWWA 5AJAA 2PM7B 2XL3A 2AGXA 4MK0B 3I89A 1U2VC 4K3JB 3F3GA 3L4OD 3V5WB 3DXMC 3I8EA 4KFMB 2GC4A 3AL8A 3NVNA 1N6DA 2O9KA 5HYNB 3PSLA 2AQ5A 3RRMC 3ORVD 1ERJA 3EI1A 2YBAA 2CNXA 3PXSD 5FXYA 2EBSA 2Z2OA 5EALA 5SXMA 4ZOYA 2HJBA 2CE9A 3J80g 3SBRA 1TBGA 2P9PC 3OW8A 4LG8A 2BBKH 4GQ2P 3PXTD 3N0EA 4H5IA 2H47A 3AL8B 4J0XA 2QXVA 5EMLB 2AGZA 3I7NA 2AGWA 3PVWB 2J57G 2CO0C 1FWXA 1K8KC 2PBIB 5CXCA 2I0RA 5EM2A 4GQ1A 5EAPA 5TEEA 3OL2B 1QNIA 3C99A 5K1CC 5FKRA 3MKSB 3DWLC 2B5MA 1VYHC 2B5LA 1JMXB 1MG3A 2H68A 2IURA 3PXWD 2Z2NA 2OK6A 4AOWA 4OZUA 3FM0A 5FKSA 1RI6A 4O3TB 2XL2A 2OVQB 5EM2B 3OKWA 4J81A 4JD2C 1PGUA 4EWRA 3KRXB 3BG1A 3PVUB 3SXTD 3EWEA 2CN3A 1R5MA 4A2MA 1SQ9A 3AFCA 2P9KC 3JB9L 2OJYA 3F3FA 4TZ4A 3AH8B 3EI2A 3JROA 3CFVA 4GGAA 4U1EI 3ODTA 2P9SC 4J73A 5C2VB 4OWRA 5EMJB 4E54B 4XYHA 3EG6A 3RLMD 2YNNA 2YNOA 4CI8A 2YNPA 3JRPA 3OKYB 4PC0A 1N6FA 1U4CA 4X61B 5GMKn 3V9FA 2PM9B 4IA9A 4ZOXA 4XEIC 2HYEA 3SJLD 1JJUB 2AGLA 1JOFA 2G9AA 1GXRA 3KRWB 4LGNA 4E5ZB 3EI4B 2OVPB 3ULEC 3RFGA 4A0BB 2P9NC 4CI2A 2HXCA 3DXKC 5HQGA 4BUJC 5KDOB 4A11B 2XYIA 4GMBA 4CI3A 3BG0A 4ERQA 2H6QA 4J78A 5TDHB 4GM9A 5JWZA 3IIWA 3OL2A 4GQBB 2HJ4A 1XIPA 1SQJA 3L4MD 4QT8A 4GM3A 3OTTA 3IJ0A 4J8GA 3A0FA 5CXBB 5FA5B 4GZ8A 4FA4D 2B5NA 3J81g 1PI6A 3N0DA 3B7FA 4FAVD 5I5IA 1GOTB 1MG2A 4GM8A 3I8CA 1S4UX 5C2WB 4ESGA 3RN0D 4PNKB 5GXHA 4ERZA 2IWFA 4J84A 3EI3A 2J56H 3SWSD 1B9YA 2IUVA 3UKUC 3PSCB 3RFHA 2H6KA 3W15A 4J0WA 4CI1A 5FQDA 5HE0B 1PEVA 3GREA 4J79A 4XYIA 2HKMA 3E0CA 1B9XA 3IJ1A 3UKRC 3EU7A 4BL0A 5IJ8E 4E54A 4Y5RD 3MXXA 5A2Qg 2W18A 3NVXA 1N6EA 4Z8LA 1YFQA 3SVWD 3JZGA 3VH0A 2H9LA 4CZVA 2H13A 3EI3B 4PSXB 2IUQA 4O45A 3OKYA 4X60B 4A08B 2H9MA 2XU7A 2YMUA 2HESX 4ZOVA 3SLED 5FKTA 2IUPA 2PM9A 4O1QD 3JPXA 3UVKA 5HE1B 4QQEA 4E5ZA 2AGYA 3F3PA 3EI4A 3DSMA 2P9LC 2Q7QA 3CFSB 3GFCA 4L3GD 4A0BA 4X63B 3C75H 4A7JA 2IWKA 3UVLA 4ZN4A 2I0SA 4IMMA 5EARA 5CYKA 4A11A 5H17A 3UVMA 2UZXB 1Q47A 1SHYB 5TEFA 2QC5A 5HE2B 4JSXC 4GGCA 4FHLA 4J8BA 2MTAH 3SHFA 2CO0A 5I5MA 1NEXB 4O9DA 4X3EA 4JSNC 3I7PA 4L9OA 1L0QA 5CYKB 4HDJA 5EMMB 2HKRA 4U7AA 5CXBA 4PBYA 2BCJB 2OIZA 4ZOZA 4PSWB 1XKSA 1K32A 2PM6B 4JXMA 4CZYA 5IGOA 1GP2B 3VGZA 3I7LA 2OK4A 4A09A 4K3ID 2H9NA 5IJ7E 1NR0A 3VA6A 3SCYA 3JZHA 1TYQC 5EAMA 4I79A 2H14A 4J77A 5I5JA 2H3XA 3UVOA 3UVNA 2P9UC 3IJCA 3DM0A 4CC9A 4PXWA 5GXIA 4Y7RA 1PBYB 4JSVC 5EMKB 5AMSA 3MZKA 4J82A 4BH6A 2P9IC 4G56B 3EMHA 4N14A 4A09B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7O A;  3HFQ A;  3MMY A;  2GNQ A;  4H5J A;  2AH0 A;  2IAA A;  1OLZ A;  4CY5 A;  4D6V A;  4CY1 A;  4FA1 D;  3JZN A;  5HE3 B;  1XHM A;  3SBP A;  3K27 A;  3SMR A;  3SN6 B;  2AH1 A;  4GGD A;  4A08 A;  4FA5 D;  3EI1 B;  4YVD A;  2UZY B;  5C9Z B;  3AL9 A;  3OKT A;  4D0K A;  4JT5 C;  4AEZ A;  4CY3 A;  1MDA H;  3NVQ A;  5B4W A;  4L1Q D;  4NSX A;  3JAM g;  3IIY A;  4LG9 A;  3I7K A;  2G99 A;  2CN2 A;  2GC7 A;  2I3T A;  1A0R B;  3FGB A;  4O3U B;  3PE7 A;  4R7A B;  3P4F A;  4UI9 R;  2I0T A;  4A0A A;  2I3S A;  3C9C A;  2H9P A;  5IGQ A;  5CXC B;  5H1M A;  2TRC B;  4CZX A;  5FLX g;  5TF2 A;  4FB1 D;  4J87 A;  3MZL A;  4A2L A;  3U4Y A;  3RMZ D;  3CIK B;  1GG2 B;  2H6N A;  3SBQ A;  4JSP C;  3UR4 A;  3SFZ A;  3RN1 D;  4PBZ A;  3RSE C;  1JMZ B;  2OVR B;  3IKO A;  1P22 A;  5THA A;  5K19 A;  5GSA A;  3I2N A;  4FA9 D;  5IT9 g;  4A0A B;  3FRX A;  4L3H D;  2CE8 A;  5FKQ A;  3BWS A;  4CY2 A;  3K26 A;  2YB8 B;  4J86 A;  5AFU 3;  2J55 H;  2B4E A;  3I7H A;  4JT6 C;  4QL1 A;  4ES0 A;  2Z2P A;  5H14 A;  5IC7 A;  3EI2 B;  3ZWL B;  4FAN D;  4ERY A;  1OMW B;  3C5M A;  3V7D B;  3MKQ A;  4QRJ A;  4FWW A;  5AJA A;  2PM7 B;  2XL3 A;  2AGX A;  4MK0 B;  3I89 A;  1U2V C;  4K3J B;  3F3G A;  3L4O D;  3V5W B;  3DXM C;  3I8E A;  4KFM B;  2GC4 A;  3AL8 A;  3NVN A;  1N6D A;  2O9K A;  5HYN B;  3PSL A;  2AQ5 A;  3RRM C;  3ORV D;  1ERJ A;  3EI1 A;  2YBA A;  2CNX A;  3PXS D;  5FXY A;  2EBS A;  2Z2O A;  5EAL A;  5SXM A;  4ZOY A;  2HJB A;  2CE9 A;  3J80 g;  3SBR A;  1TBG A;  2P9P C;  3OW8 A;  4LG8 A;  2BBK H;  4GQ2 P;  3PXT D;  3N0E A;  4H5I A;  2H47 A;  3AL8 B;  4J0X A;  2QXV A;  5EML B;  2AGZ A;  3I7N A;  2AGW A;  3PVW B;  2J57 G;  2CO0 C;  1FWX A;  1K8K C;  2PBI B;  5CXC A;  2I0R A;  5EM2 A;  4GQ1 A;  5EAP A;  5TEE A;  3OL2 B;  1QNI A;  3C99 A;  5K1C C;  5FKR A;  3MKS B;  3DWL C;  2B5M A;  1VYH C;  2B5L A;  1JMX B;  1MG3 A;  2H68 A;  2IUR A;  3PXW D;  2Z2N A;  2OK6 A;  4AOW A;  4OZU A;  3FM0 A;  5FKS A;  1RI6 A;  4O3T B;  2XL2 A;  2OVQ B;  5EM2 B;  3OKW A;  4J81 A;  4JD2 C;  1PGU A;  4EWR A;  3KRX B;  3BG1 A;  3PVU B;  3SXT D;  3EWE A;  2CN3 A;  1R5M A;  4A2M A;  1SQ9 A;  3AFC A;  2P9K C;  3JB9 L;  2OJY A;  3F3F A;  4TZ4 A;  3AH8 B;  3EI2 A;  3JRO A;  3CFV A;  4GGA A;  4U1E I;  3ODT A;  2P9S C;  4J73 A;  5C2V B;  4OWR A;  5EMJ B;  4E54 B;  4XYH A;  3EG6 A;  3RLM D;  2YNN A;  2YNO A;  4CI8 A;  2YNP A;  3JRP A;  3OKY B;  4PC0 A;  1N6F A;  1U4C A;  4X61 B;  5GMK n;  3V9F A;  2PM9 B;  4IA9 A;  4ZOX A;  4XEI C;  2HYE A;  3SJL D;  1JJU B;  2AGL A;  1JOF A;  2G9A A;  1GXR A;  3KRW B;  4LGN A;  4E5Z B;  3EI4 B;  2OVP B;  3ULE C;  3RFG A;  4A0B B;  2P9N C;  4CI2 A;  2HXC A;  3DXK C;  5HQG A;  4BUJ C;  5KDO B;  4A11 B;  2XYI A;  4GMB A;  4CI3 A;  3BG0 A;  4ERQ A;  2H6Q A;  4J78 A;  5TDH B;  4GM9 A;  5JWZ A;  3IIW A;  3OL2 A;  4GQB B;  2HJ4 A;  1XIP A;  1SQJ A;  3L4M D;  4QT8 A;  4GM3 A;  3OTT A;  3IJ0 A;  4J8G A;  3A0F A;  5CXB B;  5FA5 B;  4GZ8 A;  4FA4 D;  2B5N A;  3J81 g;  1PI6 A;  3N0D A;  3B7F A;  4FAV D;  5I5I A;  1GOT B;  1MG2 A;  4GM8 A;  3I8C A;  1S4U X;  5C2W B;  4ESG A;  3RN0 D;  4PNK B;  5GXH A;  4ERZ A;  2IWF A;  4J84 A;  3EI3 A;  2J56 H;  3SWS D;  1B9Y A;  2IUV A;  3UKU C;  3PSC B;  3RFH A;  2H6K A;  3W15 A;  4J0W A;  4CI1 A;  5FQD A;  5HE0 B;  1PEV A;  3GRE A;  4J79 A;  4XYI A;  2HKM A;  3E0C A;  1B9X A;  3IJ1 A;  3UKR C;  3EU7 A;  4BL0 A;  5IJ8 E;  4E54 A;  4Y5R D;  3MXX A;  5A2Q g;  2W18 A;  3NVX A;  1N6E A;  4Z8L A;  1YFQ A;  3SVW D;  3JZG A;  3VH0 A;  2H9L A;  4CZV A;  2H13 A;  3EI3 B;  4PSX B;  2IUQ A;  4O45 A;  3OKY A;  4X60 B;  4A08 B;  2H9M A;  2XU7 A;  2YMU A;  2HES X;  4ZOV A;  3SLE D;  5FKT A;  2IUP A;  2PM9 A;  4O1Q D;  3JPX A;  3UVK A;  5HE1 B;  4QQE A;  4E5Z A;  2AGY A;  3F3P A;  3EI4 A;  3DSM A;  2P9L C;  2Q7Q A;  3CFS B;  3GFC A;  4L3G D;  4A0B A;  4X63 B;  3C75 H;  4A7J A;  2IWK A;  3UVL A;  4ZN4 A;  2I0S A;  4IMM A;  5EAR A;  5CYK A;  4A11 A;  5H17 A;  3UVM A;  2UZX B;  1Q47 A;  1SHY B;  5TEF A;  2QC5 A;  5HE2 B;  4JSX C;  4GGC A;  4FHL A;  4J8B A;  2MTA H;  3SHF A;  2CO0 A;  5I5M A;  1NEX B;  4O9D A;  4X3E A;  4JSN C;  3I7P A;  4L9O A;  1L0Q A;  5CYK B;  4HDJ A;  5EMM B;  2HKR A;  4U7A A;  5CXB A;  4PBY A;  2BCJ B;  2OIZ A;  4ZOZ A;  4PSW B;  1XKS A;  1K32 A;  2PM6 B;  4JXM A;  4CZY A;  5IGO A;  1GP2 B;  3VGZ A;  3I7L A;  2OK4 A;  4A09 A;  4K3I D;  2H9N A;  5IJ7 E;  1NR0 A;  3VA6 A;  3SCY A;  3JZH A;  1TYQ C;  5EAM A;  4I79 A;  2H14 A;  4J77 A;  5I5J A;  2H3X A;  3UVO A;  3UVN A;  2P9U C;  3IJC A;  3DM0 A;  4CC9 A;  4PXW A;  5GXI A;  4Y7R A;  1PBY B;  4JSV C;  5EMK B;  5AMS A;  3MZK A;  4J82 A;  4BH6 A;  2P9I C;  4G56 B;  3EMH A;  4N14 A;  4A09 B; 
#chains in the Genus database with same CATH topology
 3I7O A;  3HFQ A;  3MMY A;  2GNQ A;  4H5J A;  2AH0 A;  2IAA A;  1OLZ A;  4CY5 A;  3DDU A;  4D6V A;  4CY1 A;  4FA1 D;  3JZN A;  5HE3 B;  1XHM A;  3SBP A;  3K27 A;  3SMR A;  3SN6 B;  2AH1 A;  4GGD A;  4A08 A;  2VC2 A;  4FA5 D;  3ZDZ A;  3EI1 B;  4YVD A;  2UZY B;  5C9Z B;  3AL9 A;  3OKT A;  4D0K A;  4JT5 C;  4AEZ A;  4CY3 A;  4DNW A;  1MDA H;  3NVQ A;  5B4W A;  4L1Q D;  4NSX A;  4DNV A;  3IIY A;  3JAM g;  4LG9 A;  3I7K A;  2G99 A;  2CN2 A;  5M5U A;  2GC7 A;  1C9L A;  2I3T A;  3FCU A;  3MUO A;  5M5S A;  1A0R B;  3FGB A;  4O3U B;  3PE7 A;  4R7A B;  3P4F A;  4UI9 R;  4N14 A;  1H2W A;  2I0T A;  4JHN A;  4A0A A;  2I3S A;  3C9C A;  2H9P A;  1E5T A;  5IGQ A;  5CXC B;  1UOP A;  5H1M A;  2VDO A;  2TRC B;  4CZX A;  5FLX g;  4IRZ A;  3IUQ A;  5TF2 A;  2VDM A;  3IUL A;  3MZL A;  4J87 A;  4A2L A;  4FB1 D;  3RMZ D;  3U4Y A;  3CIK B;  1GG2 B;  2H6N A;  3SBQ A;  4JSP C;  2EID A;  3SFZ A;  3UR4 A;  3RN1 D;  4PBZ A;  3RSE C;  1JMZ B;  3IJE A;  2OVR B;  3IKO A;  1P22 A;  5THA A;  5K19 A;  5GSA A;  4RE6 A;  3I2N A;  1GOH A;  3O4I A;  2HU8 A;  4FA9 D;  5IT9 g;  4A0A B;  3FRX A;  4L3H D;  3MVD K;  2CE8 A;  1UOO A;  5FKQ A;  3FCS A;  3BWS A;  4CY2 A;  3K26 A;  5M5T A;  2XE4 A;  3O4J A;  2YB8 B;  4J86 A;  4G1E A;  5AFU 3;  2J55 H;  3QI0 A;  2B4E A;  3I7H A;  5E6S A;  4JT6 C;  4QL1 A;  4ES0 A;  2Z2P A;  1H2Z A;  5H14 A;  5IC7 A;  3EI2 B;  3ZWL B;  4FAN D;  4G55 A;  4AX4 A;  4WK4 A;  4ERY A;  1H2X A;  1OMW B;  3C5M A;  3V7D B;  5M5V A;  3MUN A;  3MKQ A;  4QRJ A;  4FWW A;  5AJA A;  2PM7 B;  3EQ9 A;  2XL3 A;  3I89 A;  2AGX A;  1U2V C;  4MK0 B;  3F3G A;  4K3J B;  5FFO A;  3L4O D;  2HU7 A;  1GOG A;  4UM9 A;  3IUN A;  3V5W B;  3DXM C;  3ZDY A;  3I8E A;  4KFM B;  2GC4 A;  2VDL A;  3AL8 A;  3NVN A;  1N6D A;  4MMZ A;  2O9K A;  5HYN B;  3PSL A;  3V4V A;  2AQ5 A;  4JHP C;  3ORV D;  3RRM C;  1ERJ A;  1L5G A;  4NBM A;  3EI1 A;  2YBA A;  2CNX A;  3PXS D;  5FXY A;  2EBS A;  2Z2O A;  5EAL A;  5SXM A;  4ZOY A;  2QZP A;  2HJB A;  2CE9 A;  3J80 g;  3SBR A;  1TBG A;  2P9P C;  3OW8 A;  4LG8 A;  2BBK H;  4DNU A;  1UTC A;  4GQ2 P;  3PXT D;  3KCI A;  3N0E A;  4H5I A;  3EQ7 A;  4O2W A;  3GD1 I;  2H47 A;  3AL8 B;  4J0X A;  2QXV A;  5EML B;  1A12 A;  2AGZ A;  3I7N A;  2AGW A;  3PVW B;  2J57 G;  2CO0 C;  1FWX A;  4BCD A;  1K8K C;  2PBI B;  4G1M A;  2I0R A;  5CXC A;  5EM2 A;  3NID A;  4GQ1 A;  5EAP A;  5E6R A;  5TEE A;  3OL2 B;  3V4P A;  1QNI A;  3C99 A;  3O4G A;  5FKR A;  5K1C C;  3MKS B;  3IUJ A;  3DWL C;  1JTD B;  4AMY A;  3QHY B;  2B5M A;  4WJK A;  1VYH C;  2B5L A;  3OF7 A;  1JMX B;  1MG3 A;  2H68 A;  4L1M A;  3VI4 A;  2IUR A;  3PXW D;  2Z2N A;  2OK6 A;  4AOW A;  1VZ3 A;  4OZU A;  3FM0 A;  3ZE1 A;  3NIF A;  4WK2 A;  3IUM A;  3GC3 B;  5FKS A;  1RI6 A;  4O3T B;  2XL2 A;  1TYE A;  2OVQ B;  5EM2 B;  3OKW A;  4J81 A;  4JD2 C;  1PGU A;  4EWR A;  5M5R A;  3KRX B;  3BG1 A;  3PVU B;  3SXT D;  1VE6 A;  3EWE A;  1VZ2 A;  2CN3 A;  1R5M A;  4A2M A;  1SQ9 A;  3AFC A;  2P9K C;  3JB9 L;  2OJY A;  3F3F A;  4TZ4 A;  3AH8 B;  4AN1 A;  3NIG A;  3EI2 A;  3JRO A;  3CFV A;  1BPO A;  4GGA A;  2HU5 A;  4U1E I;  3ODT A;  2P9S C;  4J73 A;  4NEN A;  5C2V B;  4OWR A;  5EMJ B;  4E54 B;  4XYH A;  3EG6 A;  3RLM D;  2YNN A;  2YNO A;  1QFM A;  4Z7O A;  1U8C A;  4CI8 A;  2VDR A;  2YNP A;  4Z7Q A;  3JRP A;  2EIC A;  3OKY B;  4PC0 A;  2QR5 A;  1N6F A;  1U4C A;  4X61 B;  5GMK n;  2XZG A;  3V9F A;  2PM9 B;  4BCB A;  4IA9 A;  4ZOX A;  4XEI C;  2HYE A;  3SJL D;  1O6F A;  3T3P A;  1JJU B;  2AGL A;  1JOF A;  2G9A A;  1GXR A;  3KRW B;  4AN0 A;  4LGN A;  4E5Z B;  3EI4 B;  2OVP B;  3ULE C;  3O4H A;  2VDK A;  3RFG A;  4A0B B;  2P9N C;  4CI2 A;  2HXC A;  3DXK C;  3K71 A;  5HQG A;  4BUJ C;  3ZE0 A;  5KDO B;  4A11 B;  4AMZ A;  2VZ3 A;  4RE5 A;  2XYI A;  4GMB A;  4CI3 A;  3BG0 A;  4ERQ A;  3K6S A;  4Z7N A;  2H6Q A;  4J78 A;  5TDH B;  4GM9 A;  5JWZ A;  3IIW A;  3OL2 A;  4GQB B;  2HJ4 A;  1XIP A;  1SQJ A;  2EIE A;  3L4M D;  3ZDX A;  4QT8 A;  4GM3 A;  3OTT A;  3IJ0 A;  4J8G A;  3A0F A;  5CXB B;  5FA5 B;  4GZ8 A;  4FA4 D;  3IVM A;  2B5N A;  3J81 g;  1PI6 A;  3N0D A;  3B7F A;  4FAV D;  5I5I A;  4BP9 A;  1GOT B;  5C86 A;  1MG2 A;  4GM8 A;  3I8C A;  1S4U X;  5C2W B;  4ESG A;  3RN0 D;  4PNK B;  5GXH A;  4ERZ A;  2IWF A;  4J84 A;  2XDW A;  3EI3 A;  2J56 H;  3SWS D;  1B9Y A;  1E8N A;  2EIB A;  2IUV A;  3UKU C;  3PSC B;  3RFH A;  2H6K A;  3W15 A;  4J0W A;  4CI1 A;  5FQD A;  5HE0 B;  5HDB A;  1PEV A;  3GRE A;  4J79 A;  4XYI A;  2HKM A;  3E0C A;  1B9X A;  3IJ1 A;  3UKR C;  3EU7 A;  4BL0 A;  1E8M A;  5IJ8 E;  4E54 A;  4Y5R D;  3MXX A;  1T2X A;  2W18 A;  3NVX A;  1N6E A;  4Z8L A;  1YFQ A;  5A2Q g;  3SVW D;  3JZG A;  3VH0 A;  2H9L A;  4CZV A;  4NC4 A;  2H13 A;  3EI3 B;  1C9I A;  2JKX A;  2IUQ A;  4PSX B;  4O45 A;  3OKY A;  1M1X A;  4X60 B;  4A08 B;  1YR2 A;  2H9M A;  2XU7 A;  2YMU A;  2HES X;  4ZOV A;  3SLE D;  5FKT A;  2IUP A;  2PM9 A;  4O1Q D;  2VDQ A;  3JPX A;  3K72 A;  3UVK A;  3VI3 A;  5HE1 B;  3T3M A;  4QQE A;  4E5Z A;  2AGY A;  3F3P A;  4UM8 A;  3EI4 A;  1O6G A;  3DSM A;  2WQ8 A;  2P9L C;  2Q7Q A;  3CFS B;  3GFC A;  4L3G D;  4A0B A;  4X63 B;  3C75 H;  4A7J A;  2IWK A;  3UVL A;  4ZN4 A;  2VDP A;  2I0S A;  4IMM A;  5EAR A;  5CYK A;  4A11 A;  5H17 A;  3UVM A;  4WK0 A;  1UOQ A;  2UZX B;  5E6U A;  1Q47 A;  1SHY B;  5TEF A;  2QC5 A;  5HE2 B;  1K3I A;  4JSX C;  4GGC A;  4FHL A;  4J8B A;  2MTA H;  3SHF A;  2CO0 A;  4D9S A;  5I5M A;  1NEX B;  4O9D A;  4X3E A;  4JSN C;  5FFG A;  3I7P A;  4L9O A;  1L0Q A;  3EQ8 A;  5CYK B;  1GOF A;  4HDJ A;  3IUR A;  5EMM B;  2HKR A;  4U7A A;  5CXB A;  5M61 A;  4PBY A;  1JV2 A;  3ZE2 A;  2BCJ B;  2OIZ A;  5C92 A;  4ZOZ A;  4MMX A;  4PSW B;  1XKS A;  1K32 A;  2PM6 B;  4JXM A;  4CZY A;  5IGO A;  1GP2 B;  4NAA A;  3VGZ A;  3I7L A;  1VE7 A;  2OK4 A;  1QFS A;  4A09 A;  4K3I D;  2H9N A;  5IJ7 E;  1NR0 A;  3VA6 A;  3SCY A;  4BP8 A;  3JZH A;  1TYQ C;  5EAM A;  4I79 A;  1H2Y A;  2H14 A;  4J77 A;  5I5J A;  3UVO A;  2VZ1 A;  3UVN A;  2P9U C;  2VDN A;  4MMY A;  3IJC A;  3DM0 A;  4QAM A;  4CC9 A;  4PXW A;  5GXI A;  4Y7R A;  1PBY B;  2BKL A;  4BCC A;  4JSV C;  5EMK B;  5AMS A;  3MZK A;  4J82 A;  4BH6 A;  2P9I C;  4G56 B;  4O02 A;  1I2M B;  3EMH A;  2H3X A;  4A09 B; 
#chains in the Genus database with same CATH homology
 3I7O A;  3HFQ A;  3MMY A;  2GNQ A;  4H5J A;  2AH0 A;  2IAA A;  1OLZ A;  4CY5 A;  4D6V A;  4CY1 A;  4FA1 D;  3JZN A;  5HE3 B;  1XHM A;  3SBP A;  3K27 A;  3SMR A;  3SN6 B;  2AH1 A;  4GGD A;  4A08 A;  4FA5 D;  3EI1 B;  4YVD A;  2UZY B;  5C9Z B;  3AL9 A;  3OKT A;  4D0K A;  4JT5 C;  4AEZ A;  4CY3 A;  1MDA H;  3NVQ A;  5B4W A;  4L1Q D;  4NSX A;  3JAM g;  3IIY A;  4LG9 A;  3I7K A;  2G99 A;  2CN2 A;  2GC7 A;  2I3T A;  1A0R B;  3FGB A;  4O3U B;  3PE7 A;  4R7A B;  3P4F A;  4UI9 R;  2I0T A;  4A0A A;  2I3S A;  3C9C A;  2H9P A;  5IGQ A;  5CXC B;  5H1M A;  2TRC B;  4CZX A;  5FLX g;  5TF2 A;  4FB1 D;  4J87 A;  3MZL A;  4A2L A;  3U4Y A;  3RMZ D;  3CIK B;  1GG2 B;  2H6N A;  3SBQ A;  4JSP C;  3UR4 A;  3SFZ A;  3RN1 D;  4PBZ A;  3RSE C;  1JMZ B;  2OVR B;  3IKO A;  1P22 A;  5THA A;  5K19 A;  5GSA A;  3I2N A;  4FA9 D;  5IT9 g;  4A0A B;  3FRX A;  4L3H D;  2CE8 A;  5FKQ A;  3BWS A;  4CY2 A;  3K26 A;  2YB8 B;  4J86 A;  5AFU 3;  2J55 H;  2B4E A;  3I7H A;  4JT6 C;  4QL1 A;  4ES0 A;  2Z2P A;  5H14 A;  5IC7 A;  3EI2 B;  3ZWL B;  4FAN D;  4ERY A;  1OMW B;  3C5M A;  3V7D B;  3MKQ A;  4QRJ A;  4FWW A;  5AJA A;  2PM7 B;  2XL3 A;  2AGX A;  4MK0 B;  3I89 A;  1U2V C;  4K3J B;  3F3G A;  3L4O D;  3V5W B;  3DXM C;  3I8E A;  4KFM B;  2GC4 A;  3AL8 A;  3NVN A;  1N6D A;  2O9K A;  5HYN B;  3PSL A;  2AQ5 A;  3RRM C;  3ORV D;  1ERJ A;  3EI1 A;  2YBA A;  2CNX A;  3PXS D;  5FXY A;  2EBS A;  2Z2O A;  5EAL A;  5SXM A;  4ZOY A;  2HJB A;  2CE9 A;  3J80 g;  3SBR A;  1TBG A;  2P9P C;  3OW8 A;  4LG8 A;  2BBK H;  4GQ2 P;  3PXT D;  3N0E A;  4H5I A;  2H47 A;  3AL8 B;  4J0X A;  2QXV A;  5EML B;  2AGZ A;  3I7N A;  2AGW A;  3PVW B;  2J57 G;  2CO0 C;  1FWX A;  1K8K C;  2PBI B;  5CXC A;  2I0R A;  5EM2 A;  4GQ1 A;  5EAP A;  5TEE A;  3OL2 B;  1QNI A;  3C99 A;  5K1C C;  5FKR A;  3MKS B;  3DWL C;  2B5M A;  1VYH C;  2B5L A;  1JMX B;  1MG3 A;  2H68 A;  2IUR A;  3PXW D;  2Z2N A;  2OK6 A;  4AOW A;  4OZU A;  3FM0 A;  5FKS A;  1RI6 A;  4O3T B;  2XL2 A;  2OVQ B;  5EM2 B;  3OKW A;  4J81 A;  4JD2 C;  1PGU A;  4EWR A;  3KRX B;  3BG1 A;  3PVU B;  3SXT D;  3EWE A;  2CN3 A;  1R5M A;  4A2M A;  1SQ9 A;  3AFC A;  2P9K C;  3JB9 L;  2OJY A;  3F3F A;  4TZ4 A;  3AH8 B;  3EI2 A;  3JRO A;  3CFV A;  4GGA A;  4U1E I;  3ODT A;  2P9S C;  4J73 A;  5C2V B;  4OWR A;  5EMJ B;  4E54 B;  4XYH A;  3EG6 A;  3RLM D;  2YNN A;  2YNO A;  4CI8 A;  2YNP A;  3JRP A;  3OKY B;  4PC0 A;  1N6F A;  1U4C A;  4X61 B;  5GMK n;  3V9F A;  2PM9 B;  4IA9 A;  4ZOX A;  4XEI C;  2HYE A;  3SJL D;  1JJU B;  2AGL A;  1JOF A;  2G9A A;  1GXR A;  3KRW B;  4LGN A;  4E5Z B;  3EI4 B;  2OVP B;  3ULE C;  3RFG A;  4A0B B;  2P9N C;  4CI2 A;  2HXC A;  3DXK C;  5HQG A;  4BUJ C;  5KDO B;  4A11 B;  2XYI A;  4GMB A;  4CI3 A;  3BG0 A;  4ERQ A;  2H6Q A;  4J78 A;  5TDH B;  4GM9 A;  5JWZ A;  3IIW A;  3OL2 A;  4GQB B;  2HJ4 A;  1XIP A;  1SQJ A;  3L4M D;  4QT8 A;  4GM3 A;  3OTT A;  3IJ0 A;  4J8G A;  3A0F A;  5CXB B;  5FA5 B;  4GZ8 A;  4FA4 D;  2B5N A;  3J81 g;  1PI6 A;  3N0D A;  3B7F A;  4FAV D;  5I5I A;  1GOT B;  1MG2 A;  4GM8 A;  3I8C A;  1S4U X;  5C2W B;  4ESG A;  3RN0 D;  4PNK B;  5GXH A;  4ERZ A;  2IWF A;  4J84 A;  3EI3 A;  2J56 H;  3SWS D;  1B9Y A;  2IUV A;  3UKU C;  3PSC B;  3RFH A;  2H6K A;  3W15 A;  4J0W A;  4CI1 A;  5FQD A;  5HE0 B;  1PEV A;  3GRE A;  4J79 A;  4XYI A;  2HKM A;  3E0C A;  1B9X A;  3IJ1 A;  3UKR C;  3EU7 A;  4BL0 A;  5IJ8 E;  4E54 A;  4Y5R D;  3MXX A;  5A2Q g;  2W18 A;  3NVX A;  1N6E A;  4Z8L A;  1YFQ A;  3SVW D;  3JZG A;  3VH0 A;  2H9L A;  4CZV A;  2H13 A;  3EI3 B;  4PSX B;  2IUQ A;  4O45 A;  3OKY A;  4X60 B;  4A08 B;  2H9M A;  2XU7 A;  2YMU A;  2HES X;  4ZOV A;  3SLE D;  5FKT A;  2IUP A;  2PM9 A;  4O1Q D;  3JPX A;  3UVK A;  5HE1 B;  4QQE A;  4E5Z A;  2AGY A;  3F3P A;  3EI4 A;  3DSM A;  2P9L C;  2Q7Q A;  3CFS B;  3GFC A;  4L3G D;  4A0B A;  4X63 B;  3C75 H;  4A7J A;  2IWK A;  3UVL A;  4ZN4 A;  2I0S A;  4IMM A;  5EAR A;  5CYK A;  4A11 A;  5H17 A;  3UVM A;  2UZX B;  1Q47 A;  1SHY B;  5TEF A;  2QC5 A;  5HE2 B;  4JSX C;  4GGC A;  4FHL A;  4J8B A;  2MTA H;  3SHF A;  2CO0 A;  5I5M A;  1NEX B;  4O9D A;  4X3E A;  4JSN C;  3I7P A;  4L9O A;  1L0Q A;  5CYK B;  4HDJ A;  5EMM B;  2HKR A;  4U7A A;  5CXB A;  4PBY A;  2BCJ B;  2OIZ A;  4ZOZ A;  4PSW B;  1XKS A;  1K32 A;  2PM6 B;  4JXM A;  4CZY A;  5IGO A;  1GP2 B;  3VGZ A;  3I7L A;  2OK4 A;  4A09 A;  4K3I D;  2H9N A;  5IJ7 E;  1NR0 A;  3VA6 A;  3SCY A;  3JZH A;  1TYQ C;  5EAM A;  4I79 A;  2H14 A;  4J77 A;  5I5J A;  2H3X A;  3UVO A;  3UVN A;  2P9U C;  3IJC A;  3DM0 A;  4CC9 A;  4PXW A;  5GXI A;  4Y7R A;  1PBY B;  4JSV C;  5EMK B;  5AMS A;  3MZK A;  4J82 A;  4BH6 A;  2P9I C;  4G56 B;  3EMH A;  4N14 A;  4A09 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...