2OK6A

Crystal structure of aromatic amine dehydrogenase ttq-formamide adduct oxidized with ferricyanide.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ok6A01
3OKWA 5CXBB 4X61B 5EAPA 4GQ2P 2AGZA 2I3TA 3ORVD 4N14A 4IA9A 2OK4A 3NVQA 2I3SA 2HJBA 3DSMA 2IUQA 1RI6A 3SN6B 1GP2B 2B5LA 2Z2NA 3PE7A 3I7PA 2GNQA 2CE9A 2CN2A 1JOFA 2CNXA 2XYIA 2OVPB 3SXTD 4A0AB 3I2NA 4D6VA 3J80g 2UZYB 3K27A 5I5MA 3EI2A 3V9FA 5GMKn 4JT5C 3VGZA 2GC7A 4J86A 5FXYA 5THAA 4ZOVA 3NVXA 4AEZA 2AH0A 5AJAA 4PSWB 1NEXB 4A11A 5FKRA 3SMRA 4E54B 5A2Qg 4PXWA 2I0TA 5HE3B 4L1QD 4NSXA 2OVQB 5IC7A 4FHLA 4HDJA 2Q7QA 4PSXB 2HESX 5HE2B 1ERJA 4PNKB 2AQ5A 4CY1A 1L0QA 3AH8B 3I89A 5FKQA 2OIZA 4XYIA 1PGUA 3MZLA 3VA6A 2YNOA 2PM9A 4ESGA 5HQGA 1XKSA 2P9PC 3FGBA 2XL3A 2Z2PA 5GSAA 5IT9g 5H14A 4GM3A 2P9NC 3AL8A 2OVRB 2YNPA 3SCYA 4K3JB 1JMZB 3AFCA 4UI9R 4A2MA 4QL1A 3FRXA 3EI1A 4JXMA 2BCJB 4A11B 4CY2A 4CI2A 3OKTA 4FAND 3V7DB 2YBAA 2EBSA 4X3EA 5HE0B 3RMZD 3MKSB 4CZYA 2I0SA 3N0DA 4A2LA 4J0WA 4O45A 5SXMA 2H9MA 3BG0A 3HFQA 4GM8A 1XIPA 3KRWB 4CI1A 3RFGA 3ULEC 1GOTB 4E5ZA 1TYQC 5C2WB 3N0EA 4J78A 1PEVA 5TDHB 2PM9B 4O9DA 3IKOA 2IWFA 2B5MA 5TEEA 2IWKA 5TF2A 4QQEA 5EALA 3IIYA 2P9IC 2PM7B 4A08A 1VYHC 5FKSA 3AL8B 3RLMD 2YNNA 4O1QD 3KRXB 4OZUA 5EARA 3SJLD 4JT6C 2IURA 4J84A 4LGNA 2G9AA 3AL9A 3GFCA 4FB1D 3DM0A 1XHMA 3DXMC 2O9KA 4H5IA 1A0RB 4IMMA 3J81g 1SQ9A 4QT8A 5IGOA 4FA5D 3EI4A 3FM0A 2J57G 4A09A 2CO0C 4YVDA 1N6FA 4FA4D 3UVNA 3SLED 2I0RA 4FWWA 4O3TB 3L4OD 4E5ZB 3MZKA 3I8CA 5EMKB 2Z2OA 4J82A 2AGWA 4XYHA 2H9PA 3OTTA 4ZOXA 4LG9A 5FLXg 2AH1A 4AOWA 4J79A 4CZVA 5AMSA 1PBYB 2P9KC 4GGDA 3ODTA 3I7LA 4TZ4A 1Q47A 3RN0D 3PXWD 3JZGA 3VH0A 3OL2A 3UVMA 3EG6A 4GQBB 1GG2B 2YMUA 3ZWLB 5HYNB 3RN1D 4A0BA 5EAMA 3L4MD 4GMBA 2G99A 1S4UX 4Y7RA 3W15A 2IAAA 2HJ4A 3IJ1A 4ERYA 2H6QA 3PXTD 4JSPC 3JZHA 3EI4B 2J56H 3NVNA 5FA5B 2QC5A 4A09B 3PVUB 3JZNA 1NR0A 4ERQA 3SHFA 3EI2B 5GXIA 3C99A 2GC4A 3OW8A 5CYKA 2H9NA 1FWXA 4H5JA 1U2VC 1PI6A 1K8KC 4EWRA 2UZXB 4GZ8A 2B4EA 3F3FA 4GGCA 5FKTA 4MK0B 2P9SC 4L3HD 4CY5A 3OL2B 4GGAA 4K3ID 5EMMB 2QXVA 5EMJB 2H14A 5C2VB 2PM6B 2PBIB 4JSNC 3JAMg 1MG2A 2AGXA 3IJ0A 3I7KA 4J0XA 4PBZA 4ES0A 5IJ8E 2AGYA 2H47A 3CIKB 3GREA 4PC0A 3C75H 2H9LA 5KDOB 4J81A 5CXCA 4GQ1A 4XEIC 3UVKA 3MKQA 1OLZA 5IGQA 5K19A 4CC9A 3OKYA 4BUJC 3I7HA 4I79A 3EMHA 4ZOYA 5I5JA 2XL2A 5IJ7E 3EI1B 2H13A 4ERZA 3CFVA 3MMYA 3MXXA 3K26A 4J8BA 2CN3A 3EI3A 3DXKC 4FA1D 3JROA 4JD2C 3IIWA 3SVWD 3P4FA 3C5MA 4CI8A 3PSCB 1K32A 4L3GD 5H17A 5H1MA 2XU7A 3JPXA 2H3XA 4PBYA 5FQDA 3SFZA 3A0FA 4A7JA 1MG3A 4Z8LA 4GM9A 4X63B 2HKMA 1SHYB 5CXCB 4KFMB 3F3PA 5HE1B 2H68A 4BH6A 3OKYB 3SBQA 2HXCA 3DWLC 4A08B 3EWEA 4CY3A 1R5MA 2AGLA 3JRPA 1B9XA 3PSLA 4FAVD 5GXHA 4O3UB 4CI3A 2CO0A 3EU7A 2B5NA 2CE8A 3CFSB 5JWZA 2YB8B 3JB9L 5EM2A 2TRCB 1JJUB 3BG1A 4Y5RD 3RSEC 4FA9D 4J73A 3SBRA 3EI3B 4BL0A 4J77A 1GXRA 1OMWB 4X60B 5B4WA 3IJCA 4J87A 2W18A 2BBKH 4ZOZA 3SBPA 3BWSA 2IUVA 3RFHA 2OJYA 5I5IA 3RRMC 3UR4A 3E0CA 3I7OA 4J8GA 1JMXB 4QRJA 4OWRA 1N6EA 1TBGA 5CXBA 3UVOA 3SWSD 3V5WB 2J55H 4A0BB 1B9YA 3PVWB 4U1EI 3B7FA 4D0KA 3U4YA 5AFU3 5EM2B 4ZN4A 4L9OA 5EMLB 3PXSD 4CZXA 4JSVC 1P22A 5TEFA 2P9UC 2HKRA 2P9LC 3F3GA 3UKUC 4A0AA 1U4CA 1QNIA 5CYKB 3I7NA 2H6KA 2OK6A 4U7AA 5K1CC 3UVLA 5C9ZB 1N6DA 4LG8A 3C9CA 1SQJA 2IUPA 2HYEA 4JSXC 1MDAH 2H6NA 3I8EA 4G56B 2MTAH 1YFQA 4E54A 4R7AB 3UKRC
chains in the Genus database with same CATH superfamily
3OKWA 5CXBB 4X61B 5EAPA 4GQ2P 2AGZA 1H2ZA 2I3TA 3GD1I 3ORVD 3ZDZA 4N14A 4IA9A 3NIDA 2OK4A 3NVQA 2I3SA 3T3MA 2VDKA 2HJBA 3DSMA 2IUQA 1RI6A 3SN6B 1GP2B 2B5LA 2Z2NA 3PE7A 3I7PA 2GNQA 2CE9A 2CN2A 1JOFA 2CNXA 2XYIA 2OVPB 4DNVA 3SXTD 4A0AB 3I2NA 4D6VA 3J80g 2UZYB 2XDWA 3K27A 5I5MA 3EI2A 3V9FA 2EICA 5HDBA 3O4IA 5GMKn 4IRZA 3QHYB 2QZPA 4JT5C 3VGZA 2GC7A 4J86A 5FXYA 5THAA 4ZOVA 3NVXA 2VDPA 4AEZA 3V4VA 2AH0A 5AJAA 4PSWB 1NEXB 4A11A 5FKRA 3SMRA 4E54B 5A2Qg 4PXWA 4BP9A 2I0TA 5HE3B 4L1QD 4NSXA 2OVQB 2EIDA 3IURA 5IC7A 4BCCA 4FHLA 4HDJA 2Q7QA 4PSXB 2HESX 5HE2B 1ERJA 2BKLA 4PNKB 2AQ5A 4CY1A 1L0QA 3AH8B 3I89A 3GC3B 5FKQA 2OIZA 4XYIA 1PGUA 3MZLA 3VA6A 2YNOA 2PM9A 4ESGA 3IUQA 5HQGA 1XKSA 2P9PC 1TYEA 3FGBA 3VI3A 2XL3A 3IULA 2Z2PA 5GSAA 5IT9g 5FFOA 5H14A 1VE7A 4GM3A 2P9NC 3AL8A 2OVRB 2YNPA 3SCYA 4K3JB 1JMZB 1UOOA 3AFCA 4UI9R 4A2MA 4QL1A 3FRXA 3EI1A 5M61A 4JXMA 2BCJB 4A11B 4CY2A 4CI2A 3OKTA 4FAND 3V7DB 2YBAA 2EBSA 4X3EA 5HE0B 3RMZD 3MKSB 4CZYA 2I0SA 3N0DA 4A2LA 4J0WA 1UOPA 4O45A 3QI0A 2H9MA 3BG0A 3HFQA 4GM8A 1XIPA 5SXMA 4NAAA 3O4JA 3KRWB 4CI1A 3MUNA 3NIGA 3RFGA 3ULEC 1GOTB 4E5ZA 1TYQC 5C2WB 3N0EA 3K6SA 4J78A 1PEVA 5TDHB 2PM9B 1QFMA 4O9DA 3IKOA 2IWFA 2B5MA 5TEEA 2IWKA 5TF2A 4QQEA 5EALA 3IIYA 2P9IC 2PM7B 4A08A 1VYHC 5FKSA 3AL8B 5C86A 3RLMD 2YNNA 4O1QD 3KRXB 4OZUA 4MMXA 3EQ9A 4D9SA 5EARA 3SJLD 4JT6C 2IURA 3IVMA 4J84A 4LGNA 2G9AA 3AL9A 3GFCA 5M5RA 2VDNA 4FB1D 3DM0A 3K72A 1XHMA 3DXMC 1M1XA 2O9KA 4H5IA 1A0RB 4IMMA 3J81g 3O4HA 1SQ9A 3MUOA 4QT8A 5IGOA 4FA5D 3EI4A 1U8CA 3FM0A 2J57G 2VC2A 4A09A 2CO0C 4MMYA 4YVDA 1N6FA 4JHPC 4FA4D 3UVNA 3SLED 1GOHA 2I0RA 4FWWA 4O3TB 3L4OD 4E5ZB 1H2YA 4G1MA 3MZKA 3I8CA 5EMKB 5M5SA 2EIBA 1GOGA 2Z2OA 4J82A 2AGWA 4XYHA 2H9PA 3OTTA 4ZOXA 4LG9A 1K3IA 5FLXg 2AH1A 4AOWA 4J79A 4CZVA 5AMSA 1PBYB 2P9KC 4GGDA 3ODTA 2XE4A 3I7LA 4TZ4A 1Q47A 3RN0D 3PXWD 3O4GA 3JZGA 1VZ3A 3VH0A 3OL2A 3UVMA 3FCUA 1GOFA 1E5TA 3EG6A 4GQBB 3ZE1A 1GG2B 2YMUA 3ZWLB 5HYNB 3RN1D 4A0BA 5EAMA 3L4MD 4GMBA 2G99A 4AMZA 1S4UX 4Y7RA 3W15A 3ZDXA 2IAAA 1UTCA 4RE6A 1T2XA 2HJ4A 3IJ1A 4ERYA 2H6QA 1UOQA 3PXTD 4JSPC 5M5UA 3JZHA 3EI4B 2J56H 3NVNA 5FA5B 4DNWA 3MVDK 2QC5A 4A09B 3PVUB 4AN1A 3JZNA 3IUNA 1NR0A 4ERQA 3SHFA 3EI2B 1QFSA 5GXIA 3C99A 4Z7QA 2GC4A 3OW8A 4WK0A 5CYKA 2H9NA 1FWXA 1C9LA 4H5JA 1U2VC 4NBMA 1PI6A 1K8KC 4EWRA 2UZXB 1JV2A 3EQ8A 4GZ8A 2B4EA 2VDOA 3F3FA 4GGCA 5FKTA 4MK0B 2VDRA 2P9SC 4L3HD 4CY5A 3OL2B 4GGAA 4K3ID 2VDQA 3IUJA 5EMMB 1C9IA 4RE5A 2QXVA 4WK2A 3IUMA 5EMJB 2H14A 5C2VB 2PM6B 2PBIB 4JSNC 3JAMg 4AX4A 1MG2A 2AGXA 3ZE2A 3IJ0A 3I7KA 4J0XA 4PBZA 4ES0A 5IJ8E 2AGYA 1L5GA 2JKXA 2H47A 3CIKB 3GREA 4PC0A 3C75H 2H9LA 3FCSA 5KDOB 4J81A 5CXCA 4Z7NA 4GQ1A 4XEIC 3UVKA 3MKQA 1OLZA 3IJEA 5IGQA 5K19A 4CC9A 3OKYA 4BUJC 3I7HA 4I79A 3EMHA 4ZOYA 5I5JA 3OF7A 3K71A 2XL2A 3T3PA 1A12A 5IJ7E 5E6UA 3EI1B 4BP8A 2VZ1A 2H13A 2QR5A 4ERZA 3CFVA 3MMYA 2HU5A 3MXXA 3K26A 1E8MA 4J8BA 2CN3A 4WJKA 3EI3A 3DXKC 4FA1D 3JROA 4JD2C 3IIWA 3SVWD 3P4FA 3C5MA 5E6RA 4CI8A 3PSCB 1K32A 4L3GD 5H17A 5H1MA 4L1MA 2XU7A 3JPXA 4UM9A 2H3XA 4PBYA 5FQDA 1YR2A 3SFZA 3A0FA 1H2WA 4A7JA 1MG3A 1VZ2A 4Z8LA 4GM9A 3ZDYA 4X63B 2HKMA 1BPOA 1SHYB 5CXCB 4KFMB 2EIEA 3F3PA 5HE1B 2H68A 4MMZA 4BH6A 3OKYB 3SBQA 3VI4A 2HXCA 3DWLC 4A08B 2VZ3A 4QAMA 3EWEA 4CY3A 1R5MA 2AGLA 3JRPA 3DDUA 1B9XA 3PSLA 4FAVD 5GXHA 4O3UB 4CI3A 2CO0A 3EU7A 2B5NA 2CE8A 3CFSB 5JWZA 2YB8B 4AN0A 3JB9L 4G55A 4NC4A 5EM2A 2TRCB 1JJUB 3BG1A 4Y5RD 3RSEC 4FA9D 4J73A 1O6FA 3SBRA 3EI3B 4BL0A 4J77A 1GXRA 1OMWB 4X60B 5B4WA 4Z7OA 1O6GA 5E6SA 3IJCA 4J87A 2HU7A 3EQ7A 2W18A 4NENA 2BBKH 4ZOZA 3SBPA 3BWSA 2IUVA 3RFHA 2OJYA 5I5IA 3RRMC 3UR4A 1JTDB 3E0CA 3I7OA 4J8GA 2HU8A 5C92A 5M5VA 1JMXB 4QRJA 4OWRA 5FFGA 1N6EA 1E8NA 1I2MB 4AMYA 1TBGA 1VE6A 5CXBA 3UVOA 3V4PA 4JHNA 3SWSD 3V5WB 2J55H 4A0BB 1B9YA 3PVWB 4U1EI 3B7FA 3ZE0A 4D0KA 3U4YA 5AFU3 5EM2B 4ZN4A 4L9OA 5EMLB 1H2XA 3PXSD 4CZXA 4JSVC 4UM8A 2VDMA 1P22A 5TEFA 4DNUA 2P9UC 5M5TA 2VDLA 2HKRA 2P9LC 3F3GA 3UKUC 4G1EA 4BCDA 1U4CA 4A0AA 1QNIA 3NIFA 4BCBA 5CYKB 4WK4A 2XZGA 3I7NA 2H6KA 2OK6A 4U7AA 4O02A 4O2WA 5K1CC 3UVLA 2WQ8A 5C9ZB 1N6DA 3KCIA 4LG8A 3C9CA 1SQJA 2IUPA 2HYEA 4JSXC 1MDAH 2H6NA 3I8EA 4G56B 2MTAH 1YFQA 4E54A 4R7AB 3UKRC
chains in the Genus database with same CATH topology
3OKWA 5CXBB 4X61B 5EAPA 4GQ2P 2AGZA 2I3TA 3ORVD 4N14A 4IA9A 2OK4A 3NVQA 2I3SA 2HJBA 3DSMA 2IUQA 1RI6A 3SN6B 1GP2B 2B5LA 2Z2NA 3PE7A 3I7PA 2GNQA 2CE9A 2CN2A 1JOFA 2CNXA 2XYIA 2OVPB 3SXTD 4A0AB 3I2NA 4D6VA 3J80g 2UZYB 3K27A 5I5MA 3EI2A 3V9FA 5GMKn 4JT5C 3VGZA 2GC7A 4J86A 5FXYA 5THAA 4ZOVA 3NVXA 4AEZA 2AH0A 5AJAA 4PSWB 1NEXB 4A11A 5FKRA 3SMRA 4E54B 5A2Qg 4PXWA 2I0TA 5HE3B 4L1QD 4NSXA 2OVQB 5IC7A 4FHLA 4HDJA 2Q7QA 4PSXB 2HESX 5HE2B 1ERJA 4PNKB 2AQ5A 4CY1A 1L0QA 3AH8B 3I89A 5FKQA 2OIZA 4XYIA 1PGUA 3MZLA 3VA6A 2YNOA 2PM9A 4ESGA 5HQGA 1XKSA 2P9PC 3FGBA 2XL3A 2Z2PA 5GSAA 5IT9g 5H14A 4GM3A 2P9NC 3AL8A 2OVRB 2YNPA 3SCYA 4K3JB 1JMZB 3AFCA 4UI9R 4A2MA 4QL1A 3FRXA 3EI1A 4JXMA 2BCJB 4A11B 4CY2A 4CI2A 3OKTA 4FAND 3V7DB 2YBAA 2EBSA 4X3EA 5HE0B 3RMZD 3MKSB 4CZYA 2I0SA 3N0DA 4A2LA 4J0WA 4O45A 5SXMA 2H9MA 3BG0A 3HFQA 4GM8A 1XIPA 3KRWB 4CI1A 3RFGA 3ULEC 1GOTB 4E5ZA 1TYQC 5C2WB 3N0EA 4J78A 1PEVA 5TDHB 2PM9B 4O9DA 3IKOA 2IWFA 2B5MA 5TEEA 2IWKA 5TF2A 4QQEA 5EALA 3IIYA 2P9IC 2PM7B 4A08A 1VYHC 5FKSA 3AL8B 3RLMD 2YNNA 4O1QD 3KRXB 4OZUA 5EARA 3SJLD 4JT6C 2IURA 4J84A 4LGNA 2G9AA 3AL9A 3GFCA 4FB1D 3DM0A 1XHMA 3DXMC 2O9KA 4H5IA 1A0RB 4IMMA 3J81g 1SQ9A 4QT8A 5IGOA 4FA5D 3EI4A 3FM0A 2J57G 4A09A 2CO0C 4YVDA 1N6FA 4FA4D 3UVNA 3SLED 2I0RA 4FWWA 4O3TB 3L4OD 4E5ZB 3MZKA 3I8CA 5EMKB 2Z2OA 4J82A 2AGWA 4XYHA 2H9PA 3OTTA 4ZOXA 4LG9A 5FLXg 2AH1A 4AOWA 4J79A 4CZVA 5AMSA 1PBYB 2P9KC 4GGDA 3ODTA 3I7LA 4TZ4A 1Q47A 3RN0D 3PXWD 3JZGA 3VH0A 3OL2A 3UVMA 3EG6A 4GQBB 1GG2B 2YMUA 3ZWLB 5HYNB 3RN1D 4A0BA 5EAMA 3L4MD 4GMBA 2G99A 1S4UX 4Y7RA 3W15A 2IAAA 2HJ4A 3IJ1A 4ERYA 2H6QA 3PXTD 4JSPC 3JZHA 3EI4B 2J56H 3NVNA 5FA5B 2QC5A 4A09B 3PVUB 3JZNA 1NR0A 4ERQA 3SHFA 3EI2B 5GXIA 3C99A 2GC4A 3OW8A 5CYKA 2H9NA 1FWXA 4H5JA 1U2VC 1PI6A 1K8KC 4EWRA 2UZXB 4GZ8A 2B4EA 3F3FA 4GGCA 5FKTA 4MK0B 2P9SC 4L3HD 4CY5A 3OL2B 4GGAA 4K3ID 5EMMB 2QXVA 5EMJB 2H14A 5C2VB 2PM6B 2PBIB 4JSNC 3JAMg 1MG2A 2AGXA 3IJ0A 3I7KA 4J0XA 4PBZA 4ES0A 5IJ8E 2AGYA 2H47A 3CIKB 3GREA 4PC0A 3C75H 2H9LA 5KDOB 4J81A 5CXCA 4GQ1A 4XEIC 3UVKA 3MKQA 1OLZA 5IGQA 5K19A 4CC9A 3OKYA 4BUJC 3I7HA 4I79A 3EMHA 4ZOYA 5I5JA 2XL2A 5IJ7E 3EI1B 2H13A 4ERZA 3CFVA 3MMYA 3MXXA 3K26A 4J8BA 2CN3A 3EI3A 3DXKC 4FA1D 3JROA 4JD2C 3IIWA 3SVWD 3P4FA 3C5MA 4CI8A 3PSCB 1K32A 4L3GD 5H17A 5H1MA 2XU7A 3JPXA 2H3XA 4PBYA 5FQDA 3SFZA 3A0FA 4A7JA 1MG3A 4Z8LA 4GM9A 4X63B 2HKMA 1SHYB 5CXCB 4KFMB 3F3PA 5HE1B 2H68A 4BH6A 3OKYB 3SBQA 2HXCA 3DWLC 4A08B 3EWEA 4CY3A 1R5MA 2AGLA 3JRPA 1B9XA 3PSLA 4FAVD 5GXHA 4O3UB 4CI3A 2CO0A 3EU7A 2B5NA 2CE8A 3CFSB 5JWZA 2YB8B 3JB9L 5EM2A 2TRCB 1JJUB 3BG1A 4Y5RD 3RSEC 4FA9D 4J73A 3SBRA 3EI3B 4BL0A 4J77A 1GXRA 1OMWB 4X60B 5B4WA 3IJCA 4J87A 2W18A 2BBKH 4ZOZA 3SBPA 3BWSA 2IUVA 3RFHA 2OJYA 5I5IA 3RRMC 3UR4A 3E0CA 3I7OA 4J8GA 1JMXB 4QRJA 4OWRA 1N6EA 1TBGA 5CXBA 3UVOA 3SWSD 3V5WB 2J55H 4A0BB 1B9YA 3PVWB 4U1EI 3B7FA 4D0KA 3U4YA 5AFU3 5EM2B 4ZN4A 4L9OA 5EMLB 3PXSD 4CZXA 4JSVC 1P22A 5TEFA 2P9UC 2HKRA 2P9LC 3F3GA 3UKUC 4A0AA 1U4CA 1QNIA 5CYKB 3I7NA 2H6KA 2OK6A 4U7AA 5K1CC 3UVLA 5C9ZB 1N6DA 4LG8A 3C9CA 1SQJA 2IUPA 2HYEA 4JSXC 1MDAH 2H6NA 3I8EA 4G56B 2MTAH 1YFQA 4E54A 4R7AB 3UKRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKW A;  5CXB B;  4X61 B;  5EAP A;  4GQ2 P;  2AGZ A;  2I3T A;  3ORV D;  4N14 A;  4IA9 A;  2OK4 A;  3NVQ A;  2I3S A;  2HJB A;  3DSM A;  2IUQ A;  1RI6 A;  3SN6 B;  1GP2 B;  2B5L A;  2Z2N A;  3PE7 A;  3I7P A;  2GNQ A;  2CE9 A;  2CN2 A;  1JOF A;  2CNX A;  2XYI A;  2OVP B;  3SXT D;  4A0A B;  3I2N A;  4D6V A;  3J80 g;  2UZY B;  3K27 A;  5I5M A;  3EI2 A;  3V9F A;  5GMK n;  4JT5 C;  3VGZ A;  2GC7 A;  4J86 A;  5FXY A;  5THA A;  4ZOV A;  3NVX A;  4AEZ A;  2AH0 A;  5AJA A;  4PSW B;  1NEX B;  4A11 A;  5FKR A;  3SMR A;  4E54 B;  5A2Q g;  4PXW A;  2I0T A;  5HE3 B;  4L1Q D;  4NSX A;  2OVQ B;  5IC7 A;  4FHL A;  4HDJ A;  2Q7Q A;  4PSX B;  2HES X;  5HE2 B;  1ERJ A;  4PNK B;  2AQ5 A;  4CY1 A;  1L0Q A;  3AH8 B;  3I89 A;  5FKQ A;  2OIZ A;  4XYI A;  1PGU A;  3MZL A;  3VA6 A;  2YNO A;  2PM9 A;  4ESG A;  5HQG A;  1XKS A;  2P9P C;  3FGB A;  2XL3 A;  2Z2P A;  5GSA A;  5IT9 g;  5H14 A;  4GM3 A;  2P9N C;  3AL8 A;  2OVR B;  2YNP A;  3SCY A;  4K3J B;  1JMZ B;  3AFC A;  4UI9 R;  4A2M A;  4QL1 A;  3FRX A;  3EI1 A;  4JXM A;  2BCJ B;  4A11 B;  4CY2 A;  4CI2 A;  3OKT A;  4FAN D;  3V7D B;  2YBA A;  2EBS A;  4X3E A;  5HE0 B;  3RMZ D;  3MKS B;  4CZY A;  2I0S A;  3N0D A;  4A2L A;  4J0W A;  4O45 A;  5SXM A;  2H9M A;  3BG0 A;  3HFQ A;  4GM8 A;  1XIP A;  3KRW B;  4CI1 A;  3RFG A;  3ULE C;  1GOT B;  4E5Z A;  1TYQ C;  5C2W B;  3N0E A;  4J78 A;  1PEV A;  5TDH B;  2PM9 B;  4O9D A;  3IKO A;  2IWF A;  2B5M A;  5TEE A;  2IWK A;  5TF2 A;  4QQE A;  5EAL A;  3IIY A;  2P9I C;  2PM7 B;  4A08 A;  1VYH C;  5FKS A;  3AL8 B;  3RLM D;  2YNN A;  4O1Q D;  3KRX B;  4OZU A;  5EAR A;  3SJL D;  4JT6 C;  2IUR A;  4J84 A;  4LGN A;  2G9A A;  3AL9 A;  3GFC A;  4FB1 D;  3DM0 A;  1XHM A;  3DXM C;  2O9K A;  4H5I A;  1A0R B;  4IMM A;  3J81 g;  1SQ9 A;  4QT8 A;  5IGO A;  4FA5 D;  3EI4 A;  3FM0 A;  2J57 G;  4A09 A;  2CO0 C;  4YVD A;  1N6F A;  4FA4 D;  3UVN A;  3SLE D;  2I0R A;  4FWW A;  4O3T B;  3L4O D;  4E5Z B;  3MZK A;  3I8C A;  5EMK B;  2Z2O A;  4J82 A;  2AGW A;  4XYH A;  2H9P A;  3OTT A;  4ZOX A;  4LG9 A;  5FLX g;  2AH1 A;  4AOW A;  4J79 A;  4CZV A;  5AMS A;  1PBY B;  2P9K C;  4GGD A;  3ODT A;  3I7L A;  4TZ4 A;  1Q47 A;  3RN0 D;  3PXW D;  3JZG A;  3VH0 A;  3OL2 A;  3UVM A;  3EG6 A;  4GQB B;  1GG2 B;  2YMU A;  3ZWL B;  5HYN B;  3RN1 D;  4A0B A;  5EAM A;  3L4M D;  4GMB A;  2G99 A;  1S4U X;  4Y7R A;  3W15 A;  2IAA A;  2HJ4 A;  3IJ1 A;  4ERY A;  2H6Q A;  3PXT D;  4JSP C;  3JZH A;  3EI4 B;  2J56 H;  3NVN A;  5FA5 B;  2QC5 A;  4A09 B;  3PVU B;  3JZN A;  1NR0 A;  4ERQ A;  3SHF A;  3EI2 B;  5GXI A;  3C99 A;  2GC4 A;  3OW8 A;  5CYK A;  2H9N A;  1FWX A;  4H5J A;  1U2V C;  1PI6 A;  1K8K C;  4EWR A;  2UZX B;  4GZ8 A;  2B4E A;  3F3F A;  4GGC A;  5FKT A;  4MK0 B;  2P9S C;  4L3H D;  4CY5 A;  3OL2 B;  4GGA A;  4K3I D;  5EMM B;  2QXV A;  5EMJ B;  2H14 A;  5C2V B;  2PM6 B;  2PBI B;  4JSN C;  3JAM g;  1MG2 A;  2AGX A;  3IJ0 A;  3I7K A;  4J0X A;  4PBZ A;  4ES0 A;  5IJ8 E;  2AGY A;  2H47 A;  3CIK B;  3GRE A;  4PC0 A;  3C75 H;  2H9L A;  5KDO B;  4J81 A;  5CXC A;  4GQ1 A;  4XEI C;  3UVK A;  3MKQ A;  1OLZ A;  5IGQ A;  5K19 A;  4CC9 A;  3OKY A;  4BUJ C;  3I7H A;  4I79 A;  3EMH A;  4ZOY A;  5I5J A;  2XL2 A;  5IJ7 E;  3EI1 B;  2H13 A;  4ERZ A;  3CFV A;  3MMY A;  3MXX A;  3K26 A;  4J8B A;  2CN3 A;  3EI3 A;  3DXK C;  4FA1 D;  3JRO A;  4JD2 C;  3IIW A;  3SVW D;  3P4F A;  3C5M A;  4CI8 A;  3PSC B;  1K32 A;  4L3G D;  5H17 A;  5H1M A;  2XU7 A;  3JPX A;  2H3X A;  4PBY A;  5FQD A;  3SFZ A;  3A0F A;  4A7J A;  1MG3 A;  4Z8L A;  4GM9 A;  4X63 B;  2HKM A;  1SHY B;  5CXC B;  4KFM B;  3F3P A;  5HE1 B;  2H68 A;  4BH6 A;  3OKY B;  3SBQ A;  2HXC A;  3DWL C;  4A08 B;  3EWE A;  4CY3 A;  1R5M A;  2AGL A;  3JRP A;  1B9X A;  3PSL A;  4FAV D;  5GXH A;  4O3U B;  4CI3 A;  2CO0 A;  3EU7 A;  2B5N A;  2CE8 A;  3CFS B;  5JWZ A;  2YB8 B;  3JB9 L;  5EM2 A;  2TRC B;  1JJU B;  3BG1 A;  4Y5R D;  3RSE C;  4FA9 D;  4J73 A;  3SBR A;  3EI3 B;  4BL0 A;  4J77 A;  1GXR A;  1OMW B;  4X60 B;  5B4W A;  3IJC A;  4J87 A;  2W18 A;  2BBK H;  4ZOZ A;  3SBP A;  3BWS A;  2IUV A;  3RFH A;  2OJY A;  5I5I A;  3RRM C;  3UR4 A;  3E0C A;  3I7O A;  4J8G A;  1JMX B;  4QRJ A;  4OWR A;  1N6E A;  1TBG A;  5CXB A;  3UVO A;  3SWS D;  3V5W B;  2J55 H;  4A0B B;  1B9Y A;  3PVW B;  4U1E I;  3B7F A;  4D0K A;  3U4Y A;  5AFU 3;  5EM2 B;  4ZN4 A;  4L9O A;  5EML B;  3PXS D;  4CZX A;  4JSV C;  1P22 A;  5TEF A;  2P9U C;  2HKR A;  2P9L C;  3F3G A;  3UKU C;  4A0A A;  1U4C A;  1QNI A;  5CYK B;  3I7N A;  2H6K A;  2OK6 A;  4U7A A;  5K1C C;  3UVL A;  5C9Z B;  1N6D A;  4LG8 A;  3C9C A;  1SQJ A;  2IUP A;  2HYE A;  4JSX C;  1MDA H;  2H6N A;  3I8E A;  4G56 B;  2MTA H;  1YFQ A;  4E54 A;  4R7A B;  3UKR C; 
#chains in the Genus database with same CATH topology
 3OKW A;  5CXB B;  4X61 B;  5EAP A;  4GQ2 P;  2AGZ A;  1H2Z A;  2I3T A;  3GD1 I;  3ORV D;  3ZDZ A;  4N14 A;  4IA9 A;  3NID A;  2OK4 A;  3NVQ A;  2I3S A;  3T3M A;  2VDK A;  2HJB A;  3DSM A;  2IUQ A;  1RI6 A;  3SN6 B;  1GP2 B;  2B5L A;  2Z2N A;  3PE7 A;  3I7P A;  2GNQ A;  2CE9 A;  2CN2 A;  1JOF A;  2CNX A;  2XYI A;  2OVP B;  4DNV A;  3SXT D;  4A0A B;  3I2N A;  4D6V A;  3J80 g;  2UZY B;  2XDW A;  3K27 A;  5I5M A;  3EI2 A;  3V9F A;  2EIC A;  5HDB A;  3O4I A;  5GMK n;  4IRZ A;  3QHY B;  2QZP A;  4JT5 C;  3VGZ A;  2GC7 A;  4J86 A;  5FXY A;  5THA A;  4ZOV A;  3NVX A;  2VDP A;  4AEZ A;  3V4V A;  2AH0 A;  5AJA A;  4PSW B;  1NEX B;  4A11 A;  5FKR A;  3SMR A;  4E54 B;  5A2Q g;  4PXW A;  4BP9 A;  2I0T A;  5HE3 B;  4L1Q D;  4NSX A;  2OVQ B;  2EID A;  3IUR A;  5IC7 A;  4BCC A;  4FHL A;  4HDJ A;  2Q7Q A;  4PSX B;  2HES X;  5HE2 B;  1ERJ A;  2BKL A;  4PNK B;  2AQ5 A;  4CY1 A;  1L0Q A;  3AH8 B;  3I89 A;  3GC3 B;  5FKQ A;  2OIZ A;  4XYI A;  1PGU A;  3MZL A;  3VA6 A;  2YNO A;  2PM9 A;  4ESG A;  3IUQ A;  5HQG A;  1XKS A;  2P9P C;  1TYE A;  3FGB A;  3VI3 A;  2XL3 A;  3IUL A;  2Z2P A;  5GSA A;  5IT9 g;  5FFO A;  5H14 A;  1VE7 A;  4GM3 A;  2P9N C;  3AL8 A;  2OVR B;  2YNP A;  3SCY A;  4K3J B;  1JMZ B;  1UOO A;  3AFC A;  4UI9 R;  4A2M A;  4QL1 A;  3FRX A;  3EI1 A;  5M61 A;  4JXM A;  2BCJ B;  4A11 B;  4CY2 A;  4CI2 A;  3OKT A;  4FAN D;  3V7D B;  2YBA A;  2EBS A;  4X3E A;  5HE0 B;  3RMZ D;  3MKS B;  4CZY A;  2I0S A;  3N0D A;  4A2L A;  4J0W A;  1UOP A;  4O45 A;  3QI0 A;  2H9M A;  3BG0 A;  3HFQ A;  4GM8 A;  1XIP A;  5SXM A;  4NAA A;  3O4J A;  3KRW B;  4CI1 A;  3MUN A;  3NIG A;  3RFG A;  3ULE C;  1GOT B;  4E5Z A;  1TYQ C;  5C2W B;  3N0E A;  3K6S A;  4J78 A;  1PEV A;  5TDH B;  2PM9 B;  1QFM A;  4O9D A;  3IKO A;  2IWF A;  2B5M A;  5TEE A;  2IWK A;  5TF2 A;  4QQE A;  5EAL A;  3IIY A;  2P9I C;  2PM7 B;  4A08 A;  1VYH C;  5FKS A;  3AL8 B;  5C86 A;  3RLM D;  2YNN A;  4O1Q D;  3KRX B;  4OZU A;  4MMX A;  3EQ9 A;  4D9S A;  5EAR A;  3SJL D;  4JT6 C;  2IUR A;  3IVM A;  4J84 A;  4LGN A;  2G9A A;  3AL9 A;  3GFC A;  5M5R A;  2VDN A;  4FB1 D;  3DM0 A;  3K72 A;  1XHM A;  3DXM C;  1M1X A;  2O9K A;  4H5I A;  1A0R B;  4IMM A;  3J81 g;  3O4H A;  1SQ9 A;  3MUO A;  4QT8 A;  5IGO A;  4FA5 D;  3EI4 A;  1U8C A;  3FM0 A;  2J57 G;  2VC2 A;  4A09 A;  2CO0 C;  4MMY A;  4YVD A;  1N6F A;  4JHP C;  4FA4 D;  3UVN A;  3SLE D;  1GOH A;  2I0R A;  4FWW A;  4O3T B;  3L4O D;  4E5Z B;  1H2Y A;  4G1M A;  3MZK A;  3I8C A;  5EMK B;  5M5S A;  2EIB A;  1GOG A;  2Z2O A;  4J82 A;  2AGW A;  4XYH A;  2H9P A;  3OTT A;  4ZOX A;  4LG9 A;  1K3I A;  5FLX g;  2AH1 A;  4AOW A;  4J79 A;  4CZV A;  5AMS A;  1PBY B;  2P9K C;  4GGD A;  3ODT A;  2XE4 A;  3I7L A;  4TZ4 A;  1Q47 A;  3RN0 D;  3PXW D;  3O4G A;  3JZG A;  1VZ3 A;  3VH0 A;  3OL2 A;  3UVM A;  3FCU A;  1GOF A;  1E5T A;  3EG6 A;  4GQB B;  3ZE1 A;  1GG2 B;  2YMU A;  3ZWL B;  5HYN B;  3RN1 D;  4A0B A;  5EAM A;  3L4M D;  4GMB A;  2G99 A;  4AMZ A;  1S4U X;  4Y7R A;  3W15 A;  3ZDX A;  2IAA A;  1UTC A;  4RE6 A;  1T2X A;  2HJ4 A;  3IJ1 A;  4ERY A;  2H6Q A;  1UOQ A;  3PXT D;  4JSP C;  5M5U A;  3JZH A;  3EI4 B;  2J56 H;  3NVN A;  5FA5 B;  4DNW A;  3MVD K;  2QC5 A;  4A09 B;  3PVU B;  4AN1 A;  3JZN A;  3IUN A;  1NR0 A;  4ERQ A;  3SHF A;  3EI2 B;  1QFS A;  5GXI A;  3C99 A;  4Z7Q A;  2GC4 A;  3OW8 A;  4WK0 A;  5CYK A;  2H9N A;  1FWX A;  1C9L A;  4H5J A;  1U2V C;  4NBM A;  1PI6 A;  1K8K C;  4EWR A;  2UZX B;  1JV2 A;  3EQ8 A;  4GZ8 A;  2B4E A;  2VDO A;  3F3F A;  4GGC A;  5FKT A;  4MK0 B;  2VDR A;  2P9S C;  4L3H D;  4CY5 A;  3OL2 B;  4GGA A;  4K3I D;  2VDQ A;  3IUJ A;  5EMM B;  1C9I A;  4RE5 A;  2QXV A;  4WK2 A;  3IUM A;  5EMJ B;  2H14 A;  5C2V B;  2PM6 B;  2PBI B;  4JSN C;  3JAM g;  4AX4 A;  1MG2 A;  2AGX A;  3ZE2 A;  3IJ0 A;  3I7K A;  4J0X A;  4PBZ A;  4ES0 A;  5IJ8 E;  2AGY A;  1L5G A;  2JKX A;  2H47 A;  3CIK B;  3GRE A;  4PC0 A;  3C75 H;  2H9L A;  3FCS A;  5KDO B;  4J81 A;  5CXC A;  4Z7N A;  4GQ1 A;  4XEI C;  3UVK A;  3MKQ A;  1OLZ A;  3IJE A;  5IGQ A;  5K19 A;  4CC9 A;  3OKY A;  4BUJ C;  3I7H A;  4I79 A;  3EMH A;  4ZOY A;  5I5J A;  3OF7 A;  3K71 A;  2XL2 A;  3T3P A;  1A12 A;  5IJ7 E;  5E6U A;  3EI1 B;  4BP8 A;  2VZ1 A;  2H13 A;  2QR5 A;  4ERZ A;  3CFV A;  3MMY A;  2HU5 A;  3MXX A;  3K26 A;  1E8M A;  4J8B A;  2CN3 A;  4WJK A;  3EI3 A;  3DXK C;  4FA1 D;  3JRO A;  4JD2 C;  3IIW A;  3SVW D;  3P4F A;  3C5M A;  5E6R A;  4CI8 A;  3PSC B;  1K32 A;  4L3G D;  5H17 A;  5H1M A;  4L1M A;  2XU7 A;  3JPX A;  4UM9 A;  2H3X A;  4PBY A;  5FQD A;  1YR2 A;  3SFZ A;  3A0F A;  1H2W A;  4A7J A;  1MG3 A;  1VZ2 A;  4Z8L A;  4GM9 A;  3ZDY A;  4X63 B;  2HKM A;  1BPO A;  1SHY B;  5CXC B;  4KFM B;  2EIE A;  3F3P A;  5HE1 B;  2H68 A;  4MMZ A;  4BH6 A;  3OKY B;  3SBQ A;  3VI4 A;  2HXC A;  3DWL C;  4A08 B;  2VZ3 A;  4QAM A;  3EWE A;  4CY3 A;  1R5M A;  2AGL A;  3JRP A;  3DDU A;  1B9X A;  3PSL A;  4FAV D;  5GXH A;  4O3U B;  4CI3 A;  2CO0 A;  3EU7 A;  2B5N A;  2CE8 A;  3CFS B;  5JWZ A;  2YB8 B;  4AN0 A;  3JB9 L;  4G55 A;  4NC4 A;  5EM2 A;  2TRC B;  1JJU B;  3BG1 A;  4Y5R D;  3RSE C;  4FA9 D;  4J73 A;  1O6F A;  3SBR A;  3EI3 B;  4BL0 A;  4J77 A;  1GXR A;  1OMW B;  4X60 B;  5B4W A;  4Z7O A;  1O6G A;  5E6S A;  3IJC A;  4J87 A;  2HU7 A;  3EQ7 A;  2W18 A;  4NEN A;  2BBK H;  4ZOZ A;  3SBP A;  3BWS A;  2IUV A;  3RFH A;  2OJY A;  5I5I A;  3RRM C;  3UR4 A;  1JTD B;  3E0C A;  3I7O A;  4J8G A;  2HU8 A;  5C92 A;  5M5V A;  1JMX B;  4QRJ A;  4OWR A;  5FFG A;  1N6E A;  1E8N A;  1I2M B;  4AMY A;  1TBG A;  1VE6 A;  5CXB A;  3UVO A;  3V4P A;  4JHN A;  3SWS D;  3V5W B;  2J55 H;  4A0B B;  1B9Y A;  3PVW B;  4U1E I;  3B7F A;  3ZE0 A;  4D0K A;  3U4Y A;  5AFU 3;  5EM2 B;  4ZN4 A;  4L9O A;  5EML B;  1H2X A;  3PXS D;  4CZX A;  4JSV C;  4UM8 A;  2VDM A;  1P22 A;  5TEF A;  4DNU A;  2P9U C;  5M5T A;  2VDL A;  2HKR A;  2P9L C;  3F3G A;  3UKU C;  4G1E A;  4BCD A;  1U4C A;  4A0A A;  1QNI A;  3NIF A;  4BCB A;  5CYK B;  4WK4 A;  2XZG A;  3I7N A;  2H6K A;  2OK6 A;  4U7A A;  4O02 A;  4O2W A;  5K1C C;  3UVL A;  2WQ8 A;  5C9Z B;  1N6D A;  3KCI A;  4LG8 A;  3C9C A;  1SQJ A;  2IUP A;  2HYE A;  4JSX C;  1MDA H;  2H6N A;  3I8E A;  4G56 B;  2MTA H;  1YFQ A;  4E54 A;  4R7A B;  3UKR C; 
#chains in the Genus database with same CATH homology
 3OKW A;  5CXB B;  4X61 B;  5EAP A;  4GQ2 P;  2AGZ A;  2I3T A;  3ORV D;  4N14 A;  4IA9 A;  2OK4 A;  3NVQ A;  2I3S A;  2HJB A;  3DSM A;  2IUQ A;  1RI6 A;  3SN6 B;  1GP2 B;  2B5L A;  2Z2N A;  3PE7 A;  3I7P A;  2GNQ A;  2CE9 A;  2CN2 A;  1JOF A;  2CNX A;  2XYI A;  2OVP B;  3SXT D;  4A0A B;  3I2N A;  4D6V A;  3J80 g;  2UZY B;  3K27 A;  5I5M A;  3EI2 A;  3V9F A;  5GMK n;  4JT5 C;  3VGZ A;  2GC7 A;  4J86 A;  5FXY A;  5THA A;  4ZOV A;  3NVX A;  4AEZ A;  2AH0 A;  5AJA A;  4PSW B;  1NEX B;  4A11 A;  5FKR A;  3SMR A;  4E54 B;  5A2Q g;  4PXW A;  2I0T A;  5HE3 B;  4L1Q D;  4NSX A;  2OVQ B;  5IC7 A;  4FHL A;  4HDJ A;  2Q7Q A;  4PSX B;  2HES X;  5HE2 B;  1ERJ A;  4PNK B;  2AQ5 A;  4CY1 A;  1L0Q A;  3AH8 B;  3I89 A;  5FKQ A;  2OIZ A;  4XYI A;  1PGU A;  3MZL A;  3VA6 A;  2YNO A;  2PM9 A;  4ESG A;  5HQG A;  1XKS A;  2P9P C;  3FGB A;  2XL3 A;  2Z2P A;  5GSA A;  5IT9 g;  5H14 A;  4GM3 A;  2P9N C;  3AL8 A;  2OVR B;  2YNP A;  3SCY A;  4K3J B;  1JMZ B;  3AFC A;  4UI9 R;  4A2M A;  4QL1 A;  3FRX A;  3EI1 A;  4JXM A;  2BCJ B;  4A11 B;  4CY2 A;  4CI2 A;  3OKT A;  4FAN D;  3V7D B;  2YBA A;  2EBS A;  4X3E A;  5HE0 B;  3RMZ D;  3MKS B;  4CZY A;  2I0S A;  3N0D A;  4A2L A;  4J0W A;  4O45 A;  5SXM A;  2H9M A;  3BG0 A;  3HFQ A;  4GM8 A;  1XIP A;  3KRW B;  4CI1 A;  3RFG A;  3ULE C;  1GOT B;  4E5Z A;  1TYQ C;  5C2W B;  3N0E A;  4J78 A;  1PEV A;  5TDH B;  2PM9 B;  4O9D A;  3IKO A;  2IWF A;  2B5M A;  5TEE A;  2IWK A;  5TF2 A;  4QQE A;  5EAL A;  3IIY A;  2P9I C;  2PM7 B;  4A08 A;  1VYH C;  5FKS A;  3AL8 B;  3RLM D;  2YNN A;  4O1Q D;  3KRX B;  4OZU A;  5EAR A;  3SJL D;  4JT6 C;  2IUR A;  4J84 A;  4LGN A;  2G9A A;  3AL9 A;  3GFC A;  4FB1 D;  3DM0 A;  1XHM A;  3DXM C;  2O9K A;  4H5I A;  1A0R B;  4IMM A;  3J81 g;  1SQ9 A;  4QT8 A;  5IGO A;  4FA5 D;  3EI4 A;  3FM0 A;  2J57 G;  4A09 A;  2CO0 C;  4YVD A;  1N6F A;  4FA4 D;  3UVN A;  3SLE D;  2I0R A;  4FWW A;  4O3T B;  3L4O D;  4E5Z B;  3MZK A;  3I8C A;  5EMK B;  2Z2O A;  4J82 A;  2AGW A;  4XYH A;  2H9P A;  3OTT A;  4ZOX A;  4LG9 A;  5FLX g;  2AH1 A;  4AOW A;  4J79 A;  4CZV A;  5AMS A;  1PBY B;  2P9K C;  4GGD A;  3ODT A;  3I7L A;  4TZ4 A;  1Q47 A;  3RN0 D;  3PXW D;  3JZG A;  3VH0 A;  3OL2 A;  3UVM A;  3EG6 A;  4GQB B;  1GG2 B;  2YMU A;  3ZWL B;  5HYN B;  3RN1 D;  4A0B A;  5EAM A;  3L4M D;  4GMB A;  2G99 A;  1S4U X;  4Y7R A;  3W15 A;  2IAA A;  2HJ4 A;  3IJ1 A;  4ERY A;  2H6Q A;  3PXT D;  4JSP C;  3JZH A;  3EI4 B;  2J56 H;  3NVN A;  5FA5 B;  2QC5 A;  4A09 B;  3PVU B;  3JZN A;  1NR0 A;  4ERQ A;  3SHF A;  3EI2 B;  5GXI A;  3C99 A;  2GC4 A;  3OW8 A;  5CYK A;  2H9N A;  1FWX A;  4H5J A;  1U2V C;  1PI6 A;  1K8K C;  4EWR A;  2UZX B;  4GZ8 A;  2B4E A;  3F3F A;  4GGC A;  5FKT A;  4MK0 B;  2P9S C;  4L3H D;  4CY5 A;  3OL2 B;  4GGA A;  4K3I D;  5EMM B;  2QXV A;  5EMJ B;  2H14 A;  5C2V B;  2PM6 B;  2PBI B;  4JSN C;  3JAM g;  1MG2 A;  2AGX A;  3IJ0 A;  3I7K A;  4J0X A;  4PBZ A;  4ES0 A;  5IJ8 E;  2AGY A;  2H47 A;  3CIK B;  3GRE A;  4PC0 A;  3C75 H;  2H9L A;  5KDO B;  4J81 A;  5CXC A;  4GQ1 A;  4XEI C;  3UVK A;  3MKQ A;  1OLZ A;  5IGQ A;  5K19 A;  4CC9 A;  3OKY A;  4BUJ C;  3I7H A;  4I79 A;  3EMH A;  4ZOY A;  5I5J A;  2XL2 A;  5IJ7 E;  3EI1 B;  2H13 A;  4ERZ A;  3CFV A;  3MMY A;  3MXX A;  3K26 A;  4J8B A;  2CN3 A;  3EI3 A;  3DXK C;  4FA1 D;  3JRO A;  4JD2 C;  3IIW A;  3SVW D;  3P4F A;  3C5M A;  4CI8 A;  3PSC B;  1K32 A;  4L3G D;  5H17 A;  5H1M A;  2XU7 A;  3JPX A;  2H3X A;  4PBY A;  5FQD A;  3SFZ A;  3A0F A;  4A7J A;  1MG3 A;  4Z8L A;  4GM9 A;  4X63 B;  2HKM A;  1SHY B;  5CXC B;  4KFM B;  3F3P A;  5HE1 B;  2H68 A;  4BH6 A;  3OKY B;  3SBQ A;  2HXC A;  3DWL C;  4A08 B;  3EWE A;  4CY3 A;  1R5M A;  2AGL A;  3JRP A;  1B9X A;  3PSL A;  4FAV D;  5GXH A;  4O3U B;  4CI3 A;  2CO0 A;  3EU7 A;  2B5N A;  2CE8 A;  3CFS B;  5JWZ A;  2YB8 B;  3JB9 L;  5EM2 A;  2TRC B;  1JJU B;  3BG1 A;  4Y5R D;  3RSE C;  4FA9 D;  4J73 A;  3SBR A;  3EI3 B;  4BL0 A;  4J77 A;  1GXR A;  1OMW B;  4X60 B;  5B4W A;  3IJC A;  4J87 A;  2W18 A;  2BBK H;  4ZOZ A;  3SBP A;  3BWS A;  2IUV A;  3RFH A;  2OJY A;  5I5I A;  3RRM C;  3UR4 A;  3E0C A;  3I7O A;  4J8G A;  1JMX B;  4QRJ A;  4OWR A;  1N6E A;  1TBG A;  5CXB A;  3UVO A;  3SWS D;  3V5W B;  2J55 H;  4A0B B;  1B9Y A;  3PVW B;  4U1E I;  3B7F A;  4D0K A;  3U4Y A;  5AFU 3;  5EM2 B;  4ZN4 A;  4L9O A;  5EML B;  3PXS D;  4CZX A;  4JSV C;  1P22 A;  5TEF A;  2P9U C;  2HKR A;  2P9L C;  3F3G A;  3UKU C;  4A0A A;  1U4C A;  1QNI A;  5CYK B;  3I7N A;  2H6K A;  2OK6 A;  4U7A A;  5K1C C;  3UVL A;  5C9Z B;  1N6D A;  4LG8 A;  3C9C A;  1SQJ A;  2IUP A;  2HYE A;  4JSX C;  1MDA H;  2H6N A;  3I8E A;  4G56 B;  2MTA H;  1YFQ A;  4E54 A;  4R7A B;  3UKR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...