2OK6A

Crystal structure of aromatic amine dehydrogenase ttq-formamide adduct oxidized with ferricyanide.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
total genus 96
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ok6A01
3DXMC 5HE1B 5FKQA 2PM6B 5IT9g 4Y5RD 4IA9A 3HFQA 4J84A 5EM2A 5IGOA 3PVUB 1JMXB 1RI6A 4JT5C 4XEIC 5FKSA 5IGQA 4QT8A 3SBPA 3IJ1A 4BL0A 2YNNA 1N6EA 3PSCB 3EI1B 3OKYB 3UR4A 3SLED 2P9UC 2H9NA 1MG3A 5C2WB 5A2Qg 5H17A 2BCJB 3I7NA 3FM0A 4D6VA 3PXTD 2IWKA 3UKRC 4JSPC 2P9SC 4HDJA 4H5IA 3SVWD 2UZYB 1OLZA 3ZWLB 4ZOXA 4FHLA 5CXBB 4FAND 2Z2OA 4PBYA 2PM9A 4Z8LA 5K1CC 5GSAA 2IAAA 2H68A 2O9KA 3RSEC 3EI2A 2OK4A 1OMWB 3MZKA 3F3FA 3MKSB 4H5JA 4JXMA 5GMKn 1GOTB 2CE9A 4J82A 5AJAA 2AH1A 2PM7B 1XIPA 4J79A 4CZXA 2AGLA 2OVQB 3NVQA 2PBIB 1MG2A 3FRXA 4Y7RA 4JD2C 1FWXA 4IMMA 4TZ4A 4J8BA 3F3GA 2CN3A 2P9NC 2Z2NA 2HKRA 3L4MD 1L0QA 2G99A 5IJ7E 2XL2A 5I5JA 4LGNA 2J56H 1PBYB 3EI2B 4ZOYA 2I0TA 4A09B 2HKMA 1JOFA 2H6QA 4ESGA 2B4EA 4KFMB 3UVLA 2YB8B 4A0AA 4FA5D 3RRMC 3MXXA 4X60B 3EI4B 1SQ9A 4GQ2P 3JB9L 5TF2A 2CO0A 4E5ZA 4A0BB 1SHYB 2I3TA 2IUQA 5IC7A 3IJCA 2B5LA 3ULEC 3PSLA 3EWEA 4GGCA 5IJ8E 4K3JB 4FAVD 4FWWA 2H9PA 4FA4D 3RN1D 2HESX 3EU7A 2OVPB 5TEFA 4A2MA 4ERQA 3OKYA 3UVNA 3I7HA 5AFU3 2CNXA 4GQBB 4O3TB 3RFHA 3EG6A 3MKQA 2H6NA 2IUPA 3IKOA 2YNOA 4O1QD 3CFSB 2I3SA 4J87A 3JPXA 2XL3A 4XYHA 3EI4A 3N0DA 1B9YA 4CZYA 2HJBA 4CC9A 1P22A 1U4CA 4X63B 3EI1A 3DWLC 5FA5B 4LG9A 3J81g 1GG2B 4CY2A 3F3PA 3DSMA 2J55H 3W15A 3I7KA 1U2VC 1R5MA 4CI3A 2H3XA 3CIKB 4U7AA 2J57G 3OL2B 4D0KA 2Z2PA 2I0RA 1GP2B 4MK0B 1TYQC 3GFCA 3V7DB 3DXKC 2TRCB 4L3HD 5K19A 4E54B 4A11A 4GGAA 4ZN4A 4J8GA 1YFQA 1B9XA 4YVDA 3SCYA 1XHMA 3JZGA 2AGYA 3SWSD 1SQJA 5I5MA 3OTTA 4ERYA 2Q7QA 5C2VB 2OVRB 4QL1A 3C99A 5EMJB 4PSWB 4JSNC 3AH8B 3ODTA 3E0CA 4JSVC 3RLMD 4OZUA 4A08B 2OJYA 3ORVD 4J0WA 2P9IC 3CFVA 4AEZA 4A09A 4GM9A 2H6KA 3C5MA 5EAPA 5FLXg 3V5WB 1PGUA 4A0AB 3UVOA 5EMMB 3GREA 4A7JA 4N14A 3JZNA 3MMYA 4LG8A 3KRXB 3UVKA 3SBRA 1NR0A 4J0XA 3IIYA 4I79A 3BG0A 4G56B 5GXIA 4FA9D 2YBAA 4ERZA 5EMKB 4A11B 3AL9A 3EI3B 5SXMA 2G9AA 3IIWA 5AMSA 2GC4A 2GNQA 2HXCA 2EBSA 5H1MA 4NSXA 3SJLD 3NVXA 3AL8A 4PSXB 2MTAH 3C75H 4PXWA 4J73A 4PBZA 4O9DA 3RN0D 2H14A 1NEXB 4E5ZB 2GC7A 3KRWB 2W18A 3I8EA 2P9KC 4O3UB 1N6FA 5FXYA 3SBQA 4GZ8A 3VH0A 2AGXA 5CYKB 3UVMA 5HE0B 3I2NA 5EAMA 4FA1D 5EM2B 3BG1A 2OIZA 3SN6B 2YNPA 1PEVA 2HYEA 4X3EA 3BWSA 3SXTD 2B5NA 2BBKH 1JJUB 3VA6A 2IWFA 3JROA 4CY5A 3PE7A 3AL8B 3AFCA 5EARA 5HE3B 2CN2A 3K26A 2AH0A 1TBGA 3I7OA 1JMZB 3U4YA 3B7FA 4A2LA 4CY1A 4E54A 4CZVA 3K27A 4BH6A 5B4WA 3VGZA 5THAA 2H13A 4X61B 5FQDA 1PI6A 5C9ZB 3I7PA 1A0RB 4BUJC 4PC0A 4QQEA 4ZOZA 2OK6A 2CO0C 1ERJA 3SHFA 3OL2A 1N6DA 3I89A 4CI1A 4J81A 3J80g 2CE8A 4OWRA 2QXVA 2P9PC 2H47A 3FGBA 3C9CA 3L4OD 2I0SA 4ES0A 2XU7A 4J78A 2AGZA 3RMZD 4EWRA 1GXRA 4JSXC 4UI9R 1K8KC 1VYHC 5TDHB 5KDOB 5CXBA 4JT6C 3SFZA 4O45A 2XYIA 4R7AB 2PM9B 4L9OA 4GGDA 5I5IA 5EMLB 4CI8A 1Q47A 3EI3A 4QRJA 2IURA 3PXWD 4J86A 5HYNB 2YMUA 4A08A 5FKRA 4GM8A 5HE2B 5H14A 3JZHA 3N0EA 3OKWA 5CXCB 2HJ4A 3JRPA 3RFGA 2AQ5A 2QC5A 3OKTA 1S4UX 3I8CA 3P4FA 4PNKB 3JAMg 3EMHA 5GXHA 2P9LC 3I7LA 4AOWA 4FB1D 3IJ0A 3OW8A 3NVNA 4J77A 3UKUC 2H9MA 4U1EI 1K32A 4L1QD 2B5MA 2AGWA 4A0BA 1MDAH 5EALA 1XKSA 4K3ID 4CY3A 4GQ1A 5CYKA 4GM3A 3SMRA 4GMBA 5FKTA 3V9FA 3DM0A 2H9LA 5TEEA 4CI2A 4ZOVA 2UZXB 3MZLA 3A0FA 3PVWB 4XYIA 5CXCA 2IUVA 1QNIA 4L3GD 5HQGA 5JWZA 3PXSD
chains in the Genus database with same CATH superfamily
3DXMC 5HE1B 5FKQA 2PM6B 5IT9g 3ZE0A 4Y5RD 4IA9A 3HFQA 4J84A 5EM2A 5IGOA 3PVUB 4UM8A 3IVMA 3OF7A 1JMXB 1RI6A 4JT5C 4XEIC 5FKSA 5IGQA 4G1EA 4QT8A 3SBPA 3IJ1A 3EQ8A 2YNNA 1N6EA 2EIEA 3PSCB 4BL0A 3EI1B 3OKYB 1O6FA 3UR4A 3SLED 3IJEA 2P9UC 3ZDYA 2H9NA 1MG3A 5C2WB 5A2Qg 1GOFA 5H17A 2BCJB 3I7NA 3FM0A 4D6VA 2HU7A 3PXTD 2IWKA 3UKRC 4JSPC 2P9SC 4HDJA 4H5IA 4AMYA 4DNUA 3SVWD 3IUMA 1E8MA 2UZYB 1OLZA 1TYEA 3ZWLB 4ZOXA 4AN0A 4JHPC 4FHLA 5CXBB 4FAND 2Z2OA 4PBYA 2PM9A 5C86A 4Z8LA 4QAMA 3O4IA 1H2YA 5K1CC 5GSAA 2IAAA 2H68A 2O9KA 3RSEC 3EI2A 3IURA 1C9IA 2OK4A 1OMWB 3MZKA 3F3FA 1QFMA 3MKSB 4H5JA 2EIDA 4JXMA 5GMKn 1GOTB 2CE9A 4J82A 5AJAA 2AH1A 2PM7B 1XIPA 4J79A 2QZPA 3EQ7A 4CZXA 2AGLA 2OVQB 4WK0A 3ZE1A 3NVQA 2PBIB 1MG2A 3FRXA 4Y7RA 4BCCA 4JD2C 1FWXA 4IMMA 2WQ8A 1T2XA 4TZ4A 4J8BA 1QFSA 3F3GA 2CN3A 3EQ9A 2P9NC 2Z2NA 1U8CA 2HKRA 3L4MD 3IUJA 5M61A 1L0QA 2G99A 5IJ7E 2XL2A 5I5JA 5E6SA 4LGNA 2VDOA 2J56H 1PBYB 3ZE2A 3EI2B 4ZOYA 2I0TA 4A09B 2HKMA 1JOFA 2H6QA 4DNWA 4ESGA 2B4EA 4KFMB 3UVLA 2YB8B 5FFGA 4A0AA 4FA5D 3RRMC 3MXXA 4X60B 3EI4B 1SQ9A 4GQ2P 3JB9L 5TF2A 2CO0A 4E5ZA 4A0BB 1SHYB 2I3TA 2IUQA 5IC7A 3IJCA 2B5LA 3ULEC 3PSLA 1I2MB 3EWEA 4GGCA 5IJ8E 4K3JB 4FAVD 4FWWA 1C9LA 2H9PA 4G1MA 4FA4D 3RN1D 2HESX 3EU7A 2OVPB 5TEFA 4AN1A 4A2MA 1M1XA 4ERQA 4BCBA 3OKYA 3UVNA 3I7HA 4Z7QA 2CNXA 4GQBB 4O3TB 3RFHA 5AFU3 1UOOA 2HU8A 3EG6A 3MKQA 2VC2A 2H6NA 4WK4A 2IUPA 3IKOA 2YNOA 4O1QD 3CFSB 2I3SA 4J87A 3JPXA 2XL3A 4XYHA 5FFOA 3EI4A 3N0DA 1B9YA 4CZYA 2HJBA 4CC9A 1P22A 1U4CA 4X63B 3KCIA 3EI1A 4DNVA 4RE5A 3DWLC 3O4HA 5FA5B 4LG9A 3J81g 1GG2B 4CY2A 3F3PA 5E6UA 3DSMA 3ZDZA 2J55H 5C92A 3W15A 3I7KA 1U2VC 1R5MA 4CI3A 5M5SA 2H3XA 3CIKB 3MUOA 4U7AA 2J57G 3OL2B 4NAAA 4D0KA 2Z2PA 1VE6A 4L1MA 4RE6A 2I0RA 3O4GA 1GP2B 1TYQC 4MK0B 3GFCA 3V7DB 3DXKC 4NENA 4BCDA 2TRCB 4L3HD 5K19A 4E54B 4A11A 4GGAA 2VDQA 4ZN4A 4J8GA 3V4PA 1YFQA 1B9XA 4YVDA 3SCYA 3MUNA 1XHMA 2HU5A 3JZGA 2AGYA 3SWSD 1SQJA 3K6SA 5I5MA 2VDRA 3OTTA 2Q7QA 4O2WA 4ERYA 5C2VB 2OVRB 3C99A 4QL1A 5EMJB 2VDMA 4PSWB 4JSNC 3AH8B 3ODTA 3E0CA 4JSVC 3RLMD 4OZUA 4A08B 2OJYA 3ORVD 4J0WA 1YR2A 2P9IC 4UM9A 3CFVA 4AEZA 4A09A 2VZ1A 1GOGA 4GM9A 2H6KA 3C5MA 5EAPA 5FLXg 3V5WB 1PGUA 4A0AB 3UVOA 5EMMB 3GREA 4A7JA 4N14A 3JZNA 3MMYA 4LG8A 3KRXB 3UVKA 3SBRA 1NR0A 3IULA 4AMZA 4J0XA 3IIYA 5M5UA 4I79A 3BG0A 4G56B 5GXIA 4FA9D 2YBAA 4ERZA 5EMKB 4A11B 1H2ZA 3AL9A 3EI3B 5SXMA 2G9AA 3IIWA 5AMSA 2GC4A 2GNQA 5M5VA 4MMZA 2HXCA 3MVDK 2EBSA 5H1MA 4NSXA 3SJLD 3NVXA 3AL8A 4PSXB 2MTAH 3C75H 4PXWA 4J73A 5M5TA 4PBZA 4MMXA 4O9DA 3RN0D 2H14A 1NEXB 1JV2A 4E5ZB 2GC7A 5HDBA 3KRWB 2W18A 2XDWA 4NBMA 1UTCA 3I8EA 2P9KC 4O3UB 1N6FA 2VDKA 1K3IA 3GD1I 1UOQA 5FXYA 3FCUA 3SBQA 4GZ8A 3VH0A 3K71A 2AGXA 5CYKB 4BP9A 3UVMA 5HE0B 3I2NA 5EAMA 3QHYB 4FA1D 5EM2B 2XZGA 3BG1A 2OIZA 3SN6B 1L5GA 2YNPA 1VZ2A 1PEVA 2HYEA 1VZ3A 4JHNA 4NC4A 3BWSA 4X3EA 3SXTD 2B5NA 2BBKH 1JJUB 1O6GA 3VA6A 2IWFA 3JROA 4CY5A 3GC3B 3PE7A 3AL8B 3AFCA 5EARA 5HE3B 1E8NA 2CN2A 2AH0A 3K26A 3K72A 1TBGA 4BP8A 3I7OA 1JMZB 2EICA 3U4YA 3B7FA 4A2LA 4CY1A 4E54A 2BKLA 1UOPA 4G55A 4CZVA 3K27A 4BH6A 2XE4A 4WK2A 5B4WA 3VGZA 2QR5A 5THAA 2H13A 4X61B 5FQDA 1PI6A 5C9ZB 3I7PA 4AX4A 1A0RB 4BUJC 4PC0A 4QQEA 4ZOZA 2OK6A 2CO0C 4IRZA 1ERJA 3SHFA 3DDUA 3OL2A 3T3PA 4Z7OA 1N6DA 4Z7NA 3I89A 4CI1A 4J81A 3J80g 2CE8A 4OWRA 2QXVA 2P9PC 2H47A 3FGBA 3C9CA 3L4OD 2I0SA 2VDNA 2XU7A 4D9SA 4ES0A 1E5TA 1BPOA 3VI3A 4J78A 2AGZA 3RMZD 4EWRA 1GXRA 4JSXC 3IUQA 1K8KC 1VYHC 4MMYA 4UI9R 5CXBA 4JT6C 5TDHB 5KDOB 3SFZA 5M5RA 3IUNA 1VE7A 2EIBA 4O45A 2XYIA 4R7AB 3ZDXA 1A12A 2PM9B 4L9OA 4GGDA 5I5IA 5EMLB 4CI8A 1Q47A 3EI3A 2JKXA 4QRJA 2IURA 3PXWD 4J86A 5HYNB 2YMUA 4A08A 5E6RA 5FKRA 4GM8A 4O02A 3NIFA 5HE2B 3T3MA 5H14A 3JZHA 3N0EA 3OKWA 5CXCB 2HJ4A 3QI0A 3JRPA 3RFGA 2AQ5A 2QC5A 2VZ3A 3OKTA 1S4UX 3I8CA 3P4FA 3NIGA 4PNKB 3JAMg 1GOHA 3EMHA 3FCSA 2VDLA 2P9LC 3I7LA 4AOWA 4FB1D 5GXHA 3IJ0A 4WJKA 3OW8A 3NVNA 4J77A 3UKUC 1H2XA 2H9MA 4U1EI 1K32A 4L1QD 3V4VA 1H2WA 2AGWA 2B5MA 4A0BA 2VDPA 1MDAH 5EALA 1XKSA 4K3ID 4CY3A 4GQ1A 5CYKA 4GM3A 3SMRA 4GMBA 3VI4A 5FKTA 3V9FA 3DM0A 2H9LA 3O4JA 5TEEA 4CI2A 4ZOVA 2UZXB 3MZLA 1JTDB 3A0FA 3NIDA 3PVWB 4XYIA 5CXCA 2IUVA 1QNIA 4L3GD 5HQGA 5JWZA 3PXSD
chains in the Genus database with same CATH topology
3DXMC 5HE1B 5FKQA 2PM6B 5IT9g 4Y5RD 4IA9A 3HFQA 4J84A 5EM2A 5IGOA 3PVUB 1JMXB 1RI6A 4JT5C 4XEIC 5FKSA 5IGQA 4QT8A 3SBPA 3IJ1A 4BL0A 2YNNA 1N6EA 3PSCB 3EI1B 3OKYB 3UR4A 3SLED 2P9UC 2H9NA 1MG3A 5C2WB 5A2Qg 5H17A 2BCJB 3I7NA 3FM0A 4D6VA 3PXTD 2IWKA 3UKRC 4JSPC 2P9SC 4HDJA 4H5IA 3SVWD 2UZYB 1OLZA 3ZWLB 4ZOXA 4FHLA 5CXBB 4FAND 2Z2OA 4PBYA 2PM9A 4Z8LA 5K1CC 5GSAA 2IAAA 2H68A 2O9KA 3RSEC 3EI2A 2OK4A 1OMWB 3MZKA 3F3FA 3MKSB 4H5JA 4JXMA 5GMKn 1GOTB 2CE9A 4J82A 5AJAA 2AH1A 2PM7B 1XIPA 4J79A 4CZXA 2AGLA 2OVQB 3NVQA 2PBIB 1MG2A 3FRXA 4Y7RA 4JD2C 1FWXA 4IMMA 4TZ4A 4J8BA 3F3GA 2CN3A 2P9NC 2Z2NA 2HKRA 3L4MD 1L0QA 2G99A 5IJ7E 2XL2A 5I5JA 4LGNA 2J56H 1PBYB 3EI2B 4ZOYA 2I0TA 4A09B 2HKMA 1JOFA 2H6QA 4ESGA 2B4EA 4KFMB 3UVLA 2YB8B 4A0AA 4FA5D 3RRMC 3MXXA 4X60B 3EI4B 1SQ9A 4GQ2P 3JB9L 5TF2A 2CO0A 4E5ZA 4A0BB 1SHYB 2I3TA 2IUQA 5IC7A 3IJCA 2B5LA 3ULEC 3PSLA 3EWEA 4GGCA 5IJ8E 4K3JB 4FAVD 4FWWA 2H9PA 4FA4D 3RN1D 2HESX 3EU7A 2OVPB 5TEFA 4A2MA 4ERQA 3OKYA 3UVNA 3I7HA 5AFU3 2CNXA 4GQBB 4O3TB 3RFHA 3EG6A 3MKQA 2H6NA 2IUPA 3IKOA 2YNOA 4O1QD 3CFSB 2I3SA 4J87A 3JPXA 2XL3A 4XYHA 3EI4A 3N0DA 1B9YA 4CZYA 2HJBA 4CC9A 1P22A 1U4CA 4X63B 3EI1A 3DWLC 5FA5B 4LG9A 3J81g 1GG2B 4CY2A 3F3PA 3DSMA 2J55H 3W15A 3I7KA 1U2VC 1R5MA 4CI3A 2H3XA 3CIKB 4U7AA 2J57G 3OL2B 4D0KA 2Z2PA 2I0RA 1GP2B 4MK0B 1TYQC 3GFCA 3V7DB 3DXKC 2TRCB 4L3HD 5K19A 4E54B 4A11A 4GGAA 4ZN4A 4J8GA 1YFQA 1B9XA 4YVDA 3SCYA 1XHMA 3JZGA 2AGYA 3SWSD 1SQJA 5I5MA 3OTTA 4ERYA 2Q7QA 5C2VB 2OVRB 4QL1A 3C99A 5EMJB 4PSWB 4JSNC 3AH8B 3ODTA 3E0CA 4JSVC 3RLMD 4OZUA 4A08B 2OJYA 3ORVD 4J0WA 2P9IC 3CFVA 4AEZA 4A09A 4GM9A 2H6KA 3C5MA 5EAPA 5FLXg 3V5WB 1PGUA 4A0AB 3UVOA 5EMMB 3GREA 4A7JA 4N14A 3JZNA 3MMYA 4LG8A 3KRXB 3UVKA 3SBRA 1NR0A 4J0XA 3IIYA 4I79A 3BG0A 4G56B 5GXIA 4FA9D 2YBAA 4ERZA 5EMKB 4A11B 3AL9A 3EI3B 5SXMA 2G9AA 3IIWA 5AMSA 2GC4A 2GNQA 2HXCA 2EBSA 5H1MA 4NSXA 3SJLD 3NVXA 3AL8A 4PSXB 2MTAH 3C75H 4PXWA 4J73A 4PBZA 4O9DA 3RN0D 2H14A 1NEXB 4E5ZB 2GC7A 3KRWB 2W18A 3I8EA 2P9KC 4O3UB 1N6FA 5FXYA 3SBQA 4GZ8A 3VH0A 2AGXA 5CYKB 3UVMA 5HE0B 3I2NA 5EAMA 4FA1D 5EM2B 3BG1A 2OIZA 3SN6B 2YNPA 1PEVA 2HYEA 4X3EA 3BWSA 3SXTD 2B5NA 2BBKH 1JJUB 3VA6A 2IWFA 3JROA 4CY5A 3PE7A 3AL8B 3AFCA 5EARA 5HE3B 2CN2A 3K26A 2AH0A 1TBGA 3I7OA 1JMZB 3U4YA 3B7FA 4A2LA 4CY1A 4E54A 4CZVA 3K27A 4BH6A 5B4WA 3VGZA 5THAA 2H13A 4X61B 5FQDA 1PI6A 5C9ZB 3I7PA 1A0RB 4BUJC 4PC0A 4QQEA 4ZOZA 2OK6A 2CO0C 1ERJA 3SHFA 3OL2A 1N6DA 3I89A 4CI1A 4J81A 3J80g 2CE8A 4OWRA 2QXVA 2P9PC 2H47A 3FGBA 3C9CA 3L4OD 2I0SA 4ES0A 2XU7A 4J78A 2AGZA 3RMZD 4EWRA 1GXRA 4JSXC 4UI9R 1K8KC 1VYHC 5TDHB 5KDOB 5CXBA 4JT6C 3SFZA 4O45A 2XYIA 4R7AB 2PM9B 4L9OA 4GGDA 5I5IA 5EMLB 4CI8A 1Q47A 3EI3A 4QRJA 2IURA 3PXWD 4J86A 5HYNB 2YMUA 4A08A 5FKRA 4GM8A 5HE2B 5H14A 3JZHA 3N0EA 3OKWA 5CXCB 2HJ4A 3JRPA 3RFGA 2AQ5A 2QC5A 3OKTA 1S4UX 3I8CA 3P4FA 4PNKB 3JAMg 3EMHA 5GXHA 2P9LC 3I7LA 4AOWA 4FB1D 3IJ0A 3OW8A 3NVNA 4J77A 3UKUC 2H9MA 4U1EI 1K32A 4L1QD 2B5MA 2AGWA 4A0BA 1MDAH 5EALA 1XKSA 4K3ID 4CY3A 4GQ1A 5CYKA 4GM3A 3SMRA 4GMBA 5FKTA 3V9FA 3DM0A 2H9LA 5TEEA 4CI2A 4ZOVA 2UZXB 3MZLA 3A0FA 3PVWB 4XYIA 5CXCA 2IUVA 1QNIA 4L3GD 5HQGA 5JWZA 3PXSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM C;  5HE1 B;  5FKQ A;  2PM6 B;  5IT9 g;  4Y5R D;  4IA9 A;  3HFQ A;  4J84 A;  5EM2 A;  5IGO A;  3PVU B;  1JMX B;  1RI6 A;  4JT5 C;  4XEI C;  5FKS A;  5IGQ A;  4QT8 A;  3SBP A;  3IJ1 A;  4BL0 A;  2YNN A;  1N6E A;  3PSC B;  3EI1 B;  3OKY B;  3UR4 A;  3SLE D;  2P9U C;  2H9N A;  1MG3 A;  5C2W B;  5A2Q g;  5H17 A;  2BCJ B;  3I7N A;  3FM0 A;  4D6V A;  3PXT D;  2IWK A;  3UKR C;  4JSP C;  2P9S C;  4HDJ A;  4H5I A;  3SVW D;  2UZY B;  1OLZ A;  3ZWL B;  4ZOX A;  4FHL A;  5CXB B;  4FAN D;  2Z2O A;  4PBY A;  2PM9 A;  4Z8L A;  5K1C C;  5GSA A;  2IAA A;  2H68 A;  2O9K A;  3RSE C;  3EI2 A;  2OK4 A;  1OMW B;  3MZK A;  3F3F A;  3MKS B;  4H5J A;  4JXM A;  5GMK n;  1GOT B;  2CE9 A;  4J82 A;  5AJA A;  2AH1 A;  2PM7 B;  1XIP A;  4J79 A;  4CZX A;  2AGL A;  2OVQ B;  3NVQ A;  2PBI B;  1MG2 A;  3FRX A;  4Y7R A;  4JD2 C;  1FWX A;  4IMM A;  4TZ4 A;  4J8B A;  3F3G A;  2CN3 A;  2P9N C;  2Z2N A;  2HKR A;  3L4M D;  1L0Q A;  2G99 A;  5IJ7 E;  2XL2 A;  5I5J A;  4LGN A;  2J56 H;  1PBY B;  3EI2 B;  4ZOY A;  2I0T A;  4A09 B;  2HKM A;  1JOF A;  2H6Q A;  4ESG A;  2B4E A;  4KFM B;  3UVL A;  2YB8 B;  4A0A A;  4FA5 D;  3RRM C;  3MXX A;  4X60 B;  3EI4 B;  1SQ9 A;  4GQ2 P;  3JB9 L;  5TF2 A;  2CO0 A;  4E5Z A;  4A0B B;  1SHY B;  2I3T A;  2IUQ A;  5IC7 A;  3IJC A;  2B5L A;  3ULE C;  3PSL A;  3EWE A;  4GGC A;  5IJ8 E;  4K3J B;  4FAV D;  4FWW A;  2H9P A;  4FA4 D;  3RN1 D;  2HES X;  3EU7 A;  2OVP B;  5TEF A;  4A2M A;  4ERQ A;  3OKY A;  3UVN A;  3I7H A;  5AFU 3;  2CNX A;  4GQB B;  4O3T B;  3RFH A;  3EG6 A;  3MKQ A;  2H6N A;  2IUP A;  3IKO A;  2YNO A;  4O1Q D;  3CFS B;  2I3S A;  4J87 A;  3JPX A;  2XL3 A;  4XYH A;  3EI4 A;  3N0D A;  1B9Y A;  4CZY A;  2HJB A;  4CC9 A;  1P22 A;  1U4C A;  4X63 B;  3EI1 A;  3DWL C;  5FA5 B;  4LG9 A;  3J81 g;  1GG2 B;  4CY2 A;  3F3P A;  3DSM A;  2J55 H;  3W15 A;  3I7K A;  1U2V C;  1R5M A;  4CI3 A;  2H3X A;  3CIK B;  4U7A A;  2J57 G;  3OL2 B;  4D0K A;  2Z2P A;  2I0R A;  1GP2 B;  4MK0 B;  1TYQ C;  3GFC A;  3V7D B;  3DXK C;  2TRC B;  4L3H D;  5K19 A;  4E54 B;  4A11 A;  4GGA A;  4ZN4 A;  4J8G A;  1YFQ A;  1B9X A;  4YVD A;  3SCY A;  1XHM A;  3JZG A;  2AGY A;  3SWS D;  1SQJ A;  5I5M A;  3OTT A;  4ERY A;  2Q7Q A;  5C2V B;  2OVR B;  4QL1 A;  3C99 A;  5EMJ B;  4PSW B;  4JSN C;  3AH8 B;  3ODT A;  3E0C A;  4JSV C;  3RLM D;  4OZU A;  4A08 B;  2OJY A;  3ORV D;  4J0W A;  2P9I C;  3CFV A;  4AEZ A;  4A09 A;  4GM9 A;  2H6K A;  3C5M A;  5EAP A;  5FLX g;  3V5W B;  1PGU A;  4A0A B;  3UVO A;  5EMM B;  3GRE A;  4A7J A;  4N14 A;  3JZN A;  3MMY A;  4LG8 A;  3KRX B;  3UVK A;  3SBR A;  1NR0 A;  4J0X A;  3IIY A;  4I79 A;  3BG0 A;  4G56 B;  5GXI A;  4FA9 D;  2YBA A;  4ERZ A;  5EMK B;  4A11 B;  3AL9 A;  3EI3 B;  5SXM A;  2G9A A;  3IIW A;  5AMS A;  2GC4 A;  2GNQ A;  2HXC A;  2EBS A;  5H1M A;  4NSX A;  3SJL D;  3NVX A;  3AL8 A;  4PSX B;  2MTA H;  3C75 H;  4PXW A;  4J73 A;  4PBZ A;  4O9D A;  3RN0 D;  2H14 A;  1NEX B;  4E5Z B;  2GC7 A;  3KRW B;  2W18 A;  3I8E A;  2P9K C;  4O3U B;  1N6F A;  5FXY A;  3SBQ A;  4GZ8 A;  3VH0 A;  2AGX A;  5CYK B;  3UVM A;  5HE0 B;  3I2N A;  5EAM A;  4FA1 D;  5EM2 B;  3BG1 A;  2OIZ A;  3SN6 B;  2YNP A;  1PEV A;  2HYE A;  4X3E A;  3BWS A;  3SXT D;  2B5N A;  2BBK H;  1JJU B;  3VA6 A;  2IWF A;  3JRO A;  4CY5 A;  3PE7 A;  3AL8 B;  3AFC A;  5EAR A;  5HE3 B;  2CN2 A;  3K26 A;  2AH0 A;  1TBG A;  3I7O A;  1JMZ B;  3U4Y A;  3B7F A;  4A2L A;  4CY1 A;  4E54 A;  4CZV A;  3K27 A;  4BH6 A;  5B4W A;  3VGZ A;  5THA A;  2H13 A;  4X61 B;  5FQD A;  1PI6 A;  5C9Z B;  3I7P A;  1A0R B;  4BUJ C;  4PC0 A;  4QQE A;  4ZOZ A;  2OK6 A;  2CO0 C;  1ERJ A;  3SHF A;  3OL2 A;  1N6D A;  3I89 A;  4CI1 A;  4J81 A;  3J80 g;  2CE8 A;  4OWR A;  2QXV A;  2P9P C;  2H47 A;  3FGB A;  3C9C A;  3L4O D;  2I0S A;  4ES0 A;  2XU7 A;  4J78 A;  2AGZ A;  3RMZ D;  4EWR A;  1GXR A;  4JSX C;  4UI9 R;  1K8K C;  1VYH C;  5TDH B;  5KDO B;  5CXB A;  4JT6 C;  3SFZ A;  4O45 A;  2XYI A;  4R7A B;  2PM9 B;  4L9O A;  4GGD A;  5I5I A;  5EML B;  4CI8 A;  1Q47 A;  3EI3 A;  4QRJ A;  2IUR A;  3PXW D;  4J86 A;  5HYN B;  2YMU A;  4A08 A;  5FKR A;  4GM8 A;  5HE2 B;  5H14 A;  3JZH A;  3N0E A;  3OKW A;  5CXC B;  2HJ4 A;  3JRP A;  3RFG A;  2AQ5 A;  2QC5 A;  3OKT A;  1S4U X;  3I8C A;  3P4F A;  4PNK B;  3JAM g;  3EMH A;  5GXH A;  2P9L C;  3I7L A;  4AOW A;  4FB1 D;  3IJ0 A;  3OW8 A;  3NVN A;  4J77 A;  3UKU C;  2H9M A;  4U1E I;  1K32 A;  4L1Q D;  2B5M A;  2AGW A;  4A0B A;  1MDA H;  5EAL A;  1XKS A;  4K3I D;  4CY3 A;  4GQ1 A;  5CYK A;  4GM3 A;  3SMR A;  4GMB A;  5FKT A;  3V9F A;  3DM0 A;  2H9L A;  5TEE A;  4CI2 A;  4ZOV A;  2UZX B;  3MZL A;  3A0F A;  3PVW B;  4XYI A;  5CXC A;  2IUV A;  1QNI A;  4L3G D;  5HQG A;  5JWZ A;  3PXS D; 
#chains in the Genus database with same CATH topology
 3DXM C;  5HE1 B;  5FKQ A;  2PM6 B;  5IT9 g;  3ZE0 A;  4Y5R D;  4IA9 A;  3HFQ A;  4J84 A;  5EM2 A;  5IGO A;  3PVU B;  4UM8 A;  3IVM A;  3OF7 A;  1JMX B;  1RI6 A;  4JT5 C;  4XEI C;  5FKS A;  5IGQ A;  4G1E A;  4QT8 A;  3SBP A;  3IJ1 A;  3EQ8 A;  2YNN A;  1N6E A;  2EIE A;  3PSC B;  4BL0 A;  3EI1 B;  3OKY B;  1O6F A;  3UR4 A;  3SLE D;  3IJE A;  2P9U C;  3ZDY A;  2H9N A;  1MG3 A;  5C2W B;  5A2Q g;  1GOF A;  5H17 A;  2BCJ B;  3I7N A;  3FM0 A;  4D6V A;  2HU7 A;  3PXT D;  2IWK A;  3UKR C;  4JSP C;  2P9S C;  4HDJ A;  4H5I A;  4AMY A;  4DNU A;  3SVW D;  3IUM A;  1E8M A;  2UZY B;  1OLZ A;  1TYE A;  3ZWL B;  4ZOX A;  4AN0 A;  4JHP C;  4FHL A;  5CXB B;  4FAN D;  2Z2O A;  4PBY A;  2PM9 A;  5C86 A;  4Z8L A;  4QAM A;  3O4I A;  1H2Y A;  5K1C C;  5GSA A;  2IAA A;  2H68 A;  2O9K A;  3RSE C;  3EI2 A;  3IUR A;  1C9I A;  2OK4 A;  1OMW B;  3MZK A;  3F3F A;  1QFM A;  3MKS B;  4H5J A;  2EID A;  4JXM A;  5GMK n;  1GOT B;  2CE9 A;  4J82 A;  5AJA A;  2AH1 A;  2PM7 B;  1XIP A;  4J79 A;  2QZP A;  3EQ7 A;  4CZX A;  2AGL A;  2OVQ B;  4WK0 A;  3ZE1 A;  3NVQ A;  2PBI B;  1MG2 A;  3FRX A;  4Y7R A;  4BCC A;  4JD2 C;  1FWX A;  4IMM A;  2WQ8 A;  1T2X A;  4TZ4 A;  4J8B A;  1QFS A;  3F3G A;  2CN3 A;  3EQ9 A;  2P9N C;  2Z2N A;  1U8C A;  2HKR A;  3L4M D;  3IUJ A;  5M61 A;  1L0Q A;  2G99 A;  5IJ7 E;  2XL2 A;  5I5J A;  5E6S A;  4LGN A;  2VDO A;  2J56 H;  1PBY B;  3ZE2 A;  3EI2 B;  4ZOY A;  2I0T A;  4A09 B;  2HKM A;  1JOF A;  2H6Q A;  4DNW A;  4ESG A;  2B4E A;  4KFM B;  3UVL A;  2YB8 B;  5FFG A;  4A0A A;  4FA5 D;  3RRM C;  3MXX A;  4X60 B;  3EI4 B;  1SQ9 A;  4GQ2 P;  3JB9 L;  5TF2 A;  2CO0 A;  4E5Z A;  4A0B B;  1SHY B;  2I3T A;  2IUQ A;  5IC7 A;  3IJC A;  2B5L A;  3ULE C;  3PSL A;  1I2M B;  3EWE A;  4GGC A;  5IJ8 E;  4K3J B;  4FAV D;  4FWW A;  1C9L A;  2H9P A;  4G1M A;  4FA4 D;  3RN1 D;  2HES X;  3EU7 A;  2OVP B;  5TEF A;  4AN1 A;  4A2M A;  1M1X A;  4ERQ A;  4BCB A;  3OKY A;  3UVN A;  3I7H A;  4Z7Q A;  2CNX A;  4GQB B;  4O3T B;  3RFH A;  5AFU 3;  1UOO A;  2HU8 A;  3EG6 A;  3MKQ A;  2VC2 A;  2H6N A;  4WK4 A;  2IUP A;  3IKO A;  2YNO A;  4O1Q D;  3CFS B;  2I3S A;  4J87 A;  3JPX A;  2XL3 A;  4XYH A;  5FFO A;  3EI4 A;  3N0D A;  1B9Y A;  4CZY A;  2HJB A;  4CC9 A;  1P22 A;  1U4C A;  4X63 B;  3KCI A;  3EI1 A;  4DNV A;  4RE5 A;  3DWL C;  3O4H A;  5FA5 B;  4LG9 A;  3J81 g;  1GG2 B;  4CY2 A;  3F3P A;  5E6U A;  3DSM A;  3ZDZ A;  2J55 H;  5C92 A;  3W15 A;  3I7K A;  1U2V C;  1R5M A;  4CI3 A;  5M5S A;  2H3X A;  3CIK B;  3MUO A;  4U7A A;  2J57 G;  3OL2 B;  4NAA A;  4D0K A;  2Z2P A;  1VE6 A;  4L1M A;  4RE6 A;  2I0R A;  3O4G A;  1GP2 B;  1TYQ C;  4MK0 B;  3GFC A;  3V7D B;  3DXK C;  4NEN A;  4BCD A;  2TRC B;  4L3H D;  5K19 A;  4E54 B;  4A11 A;  4GGA A;  2VDQ A;  4ZN4 A;  4J8G A;  3V4P A;  1YFQ A;  1B9X A;  4YVD A;  3SCY A;  3MUN A;  1XHM A;  2HU5 A;  3JZG A;  2AGY A;  3SWS D;  1SQJ A;  3K6S A;  5I5M A;  2VDR A;  3OTT A;  2Q7Q A;  4O2W A;  4ERY A;  5C2V B;  2OVR B;  3C99 A;  4QL1 A;  5EMJ B;  2VDM A;  4PSW B;  4JSN C;  3AH8 B;  3ODT A;  3E0C A;  4JSV C;  3RLM D;  4OZU A;  4A08 B;  2OJY A;  3ORV D;  4J0W A;  1YR2 A;  2P9I C;  4UM9 A;  3CFV A;  4AEZ A;  4A09 A;  2VZ1 A;  1GOG A;  4GM9 A;  2H6K A;  3C5M A;  5EAP A;  5FLX g;  3V5W B;  1PGU A;  4A0A B;  3UVO A;  5EMM B;  3GRE A;  4A7J A;  4N14 A;  3JZN A;  3MMY A;  4LG8 A;  3KRX B;  3UVK A;  3SBR A;  1NR0 A;  3IUL A;  4AMZ A;  4J0X A;  3IIY A;  5M5U A;  4I79 A;  3BG0 A;  4G56 B;  5GXI A;  4FA9 D;  2YBA A;  4ERZ A;  5EMK B;  4A11 B;  1H2Z A;  3AL9 A;  3EI3 B;  5SXM A;  2G9A A;  3IIW A;  5AMS A;  2GC4 A;  2GNQ A;  5M5V A;  4MMZ A;  2HXC A;  3MVD K;  2EBS A;  5H1M A;  4NSX A;  3SJL D;  3NVX A;  3AL8 A;  4PSX B;  2MTA H;  3C75 H;  4PXW A;  4J73 A;  5M5T A;  4PBZ A;  4MMX A;  4O9D A;  3RN0 D;  2H14 A;  1NEX B;  1JV2 A;  4E5Z B;  2GC7 A;  5HDB A;  3KRW B;  2W18 A;  2XDW A;  4NBM A;  1UTC A;  3I8E A;  2P9K C;  4O3U B;  1N6F A;  2VDK A;  1K3I A;  3GD1 I;  1UOQ A;  5FXY A;  3FCU A;  3SBQ A;  4GZ8 A;  3VH0 A;  3K71 A;  2AGX A;  5CYK B;  4BP9 A;  3UVM A;  5HE0 B;  3I2N A;  5EAM A;  3QHY B;  4FA1 D;  5EM2 B;  2XZG A;  3BG1 A;  2OIZ A;  3SN6 B;  1L5G A;  2YNP A;  1VZ2 A;  1PEV A;  2HYE A;  1VZ3 A;  4JHN A;  4NC4 A;  3BWS A;  4X3E A;  3SXT D;  2B5N A;  2BBK H;  1JJU B;  1O6G A;  3VA6 A;  2IWF A;  3JRO A;  4CY5 A;  3GC3 B;  3PE7 A;  3AL8 B;  3AFC A;  5EAR A;  5HE3 B;  1E8N A;  2CN2 A;  2AH0 A;  3K26 A;  3K72 A;  1TBG A;  4BP8 A;  3I7O A;  1JMZ B;  2EIC A;  3U4Y A;  3B7F A;  4A2L A;  4CY1 A;  4E54 A;  2BKL A;  1UOP A;  4G55 A;  4CZV A;  3K27 A;  4BH6 A;  2XE4 A;  4WK2 A;  5B4W A;  3VGZ A;  2QR5 A;  5THA A;  2H13 A;  4X61 B;  5FQD A;  1PI6 A;  5C9Z B;  3I7P A;  4AX4 A;  1A0R B;  4BUJ C;  4PC0 A;  4QQE A;  4ZOZ A;  2OK6 A;  2CO0 C;  4IRZ A;  1ERJ A;  3SHF A;  3DDU A;  3OL2 A;  3T3P A;  4Z7O A;  1N6D A;  4Z7N A;  3I89 A;  4CI1 A;  4J81 A;  3J80 g;  2CE8 A;  4OWR A;  2QXV A;  2P9P C;  2H47 A;  3FGB A;  3C9C A;  3L4O D;  2I0S A;  2VDN A;  2XU7 A;  4D9S A;  4ES0 A;  1E5T A;  1BPO A;  3VI3 A;  4J78 A;  2AGZ A;  3RMZ D;  4EWR A;  1GXR A;  4JSX C;  3IUQ A;  1K8K C;  1VYH C;  4MMY A;  4UI9 R;  5CXB A;  4JT6 C;  5TDH B;  5KDO B;  3SFZ A;  5M5R A;  3IUN A;  1VE7 A;  2EIB A;  4O45 A;  2XYI A;  4R7A B;  3ZDX A;  1A12 A;  2PM9 B;  4L9O A;  4GGD A;  5I5I A;  5EML B;  4CI8 A;  1Q47 A;  3EI3 A;  2JKX A;  4QRJ A;  2IUR A;  3PXW D;  4J86 A;  5HYN B;  2YMU A;  4A08 A;  5E6R A;  5FKR A;  4GM8 A;  4O02 A;  3NIF A;  5HE2 B;  3T3M A;  5H14 A;  3JZH A;  3N0E A;  3OKW A;  5CXC B;  2HJ4 A;  3QI0 A;  3JRP A;  3RFG A;  2AQ5 A;  2QC5 A;  2VZ3 A;  3OKT A;  1S4U X;  3I8C A;  3P4F A;  3NIG A;  4PNK B;  3JAM g;  1GOH A;  3EMH A;  3FCS A;  2VDL A;  2P9L C;  3I7L A;  4AOW A;  4FB1 D;  5GXH A;  3IJ0 A;  4WJK A;  3OW8 A;  3NVN A;  4J77 A;  3UKU C;  1H2X A;  2H9M A;  4U1E I;  1K32 A;  4L1Q D;  3V4V A;  1H2W A;  2AGW A;  2B5M A;  4A0B A;  2VDP A;  1MDA H;  5EAL A;  1XKS A;  4K3I D;  4CY3 A;  4GQ1 A;  5CYK A;  4GM3 A;  3SMR A;  4GMB A;  3VI4 A;  5FKT A;  3V9F A;  3DM0 A;  2H9L A;  3O4J A;  5TEE A;  4CI2 A;  4ZOV A;  2UZX B;  3MZL A;  1JTD B;  3A0F A;  3NID A;  3PVW B;  4XYI A;  5CXC A;  2IUV A;  1QNI A;  4L3G D;  5HQG A;  5JWZ A;  3PXS D; 
#chains in the Genus database with same CATH homology
 3DXM C;  5HE1 B;  5FKQ A;  2PM6 B;  5IT9 g;  4Y5R D;  4IA9 A;  3HFQ A;  4J84 A;  5EM2 A;  5IGO A;  3PVU B;  1JMX B;  1RI6 A;  4JT5 C;  4XEI C;  5FKS A;  5IGQ A;  4QT8 A;  3SBP A;  3IJ1 A;  4BL0 A;  2YNN A;  1N6E A;  3PSC B;  3EI1 B;  3OKY B;  3UR4 A;  3SLE D;  2P9U C;  2H9N A;  1MG3 A;  5C2W B;  5A2Q g;  5H17 A;  2BCJ B;  3I7N A;  3FM0 A;  4D6V A;  3PXT D;  2IWK A;  3UKR C;  4JSP C;  2P9S C;  4HDJ A;  4H5I A;  3SVW D;  2UZY B;  1OLZ A;  3ZWL B;  4ZOX A;  4FHL A;  5CXB B;  4FAN D;  2Z2O A;  4PBY A;  2PM9 A;  4Z8L A;  5K1C C;  5GSA A;  2IAA A;  2H68 A;  2O9K A;  3RSE C;  3EI2 A;  2OK4 A;  1OMW B;  3MZK A;  3F3F A;  3MKS B;  4H5J A;  4JXM A;  5GMK n;  1GOT B;  2CE9 A;  4J82 A;  5AJA A;  2AH1 A;  2PM7 B;  1XIP A;  4J79 A;  4CZX A;  2AGL A;  2OVQ B;  3NVQ A;  2PBI B;  1MG2 A;  3FRX A;  4Y7R A;  4JD2 C;  1FWX A;  4IMM A;  4TZ4 A;  4J8B A;  3F3G A;  2CN3 A;  2P9N C;  2Z2N A;  2HKR A;  3L4M D;  1L0Q A;  2G99 A;  5IJ7 E;  2XL2 A;  5I5J A;  4LGN A;  2J56 H;  1PBY B;  3EI2 B;  4ZOY A;  2I0T A;  4A09 B;  2HKM A;  1JOF A;  2H6Q A;  4ESG A;  2B4E A;  4KFM B;  3UVL A;  2YB8 B;  4A0A A;  4FA5 D;  3RRM C;  3MXX A;  4X60 B;  3EI4 B;  1SQ9 A;  4GQ2 P;  3JB9 L;  5TF2 A;  2CO0 A;  4E5Z A;  4A0B B;  1SHY B;  2I3T A;  2IUQ A;  5IC7 A;  3IJC A;  2B5L A;  3ULE C;  3PSL A;  3EWE A;  4GGC A;  5IJ8 E;  4K3J B;  4FAV D;  4FWW A;  2H9P A;  4FA4 D;  3RN1 D;  2HES X;  3EU7 A;  2OVP B;  5TEF A;  4A2M A;  4ERQ A;  3OKY A;  3UVN A;  3I7H A;  5AFU 3;  2CNX A;  4GQB B;  4O3T B;  3RFH A;  3EG6 A;  3MKQ A;  2H6N A;  2IUP A;  3IKO A;  2YNO A;  4O1Q D;  3CFS B;  2I3S A;  4J87 A;  3JPX A;  2XL3 A;  4XYH A;  3EI4 A;  3N0D A;  1B9Y A;  4CZY A;  2HJB A;  4CC9 A;  1P22 A;  1U4C A;  4X63 B;  3EI1 A;  3DWL C;  5FA5 B;  4LG9 A;  3J81 g;  1GG2 B;  4CY2 A;  3F3P A;  3DSM A;  2J55 H;  3W15 A;  3I7K A;  1U2V C;  1R5M A;  4CI3 A;  2H3X A;  3CIK B;  4U7A A;  2J57 G;  3OL2 B;  4D0K A;  2Z2P A;  2I0R A;  1GP2 B;  4MK0 B;  1TYQ C;  3GFC A;  3V7D B;  3DXK C;  2TRC B;  4L3H D;  5K19 A;  4E54 B;  4A11 A;  4GGA A;  4ZN4 A;  4J8G A;  1YFQ A;  1B9X A;  4YVD A;  3SCY A;  1XHM A;  3JZG A;  2AGY A;  3SWS D;  1SQJ A;  5I5M A;  3OTT A;  4ERY A;  2Q7Q A;  5C2V B;  2OVR B;  4QL1 A;  3C99 A;  5EMJ B;  4PSW B;  4JSN C;  3AH8 B;  3ODT A;  3E0C A;  4JSV C;  3RLM D;  4OZU A;  4A08 B;  2OJY A;  3ORV D;  4J0W A;  2P9I C;  3CFV A;  4AEZ A;  4A09 A;  4GM9 A;  2H6K A;  3C5M A;  5EAP A;  5FLX g;  3V5W B;  1PGU A;  4A0A B;  3UVO A;  5EMM B;  3GRE A;  4A7J A;  4N14 A;  3JZN A;  3MMY A;  4LG8 A;  3KRX B;  3UVK A;  3SBR A;  1NR0 A;  4J0X A;  3IIY A;  4I79 A;  3BG0 A;  4G56 B;  5GXI A;  4FA9 D;  2YBA A;  4ERZ A;  5EMK B;  4A11 B;  3AL9 A;  3EI3 B;  5SXM A;  2G9A A;  3IIW A;  5AMS A;  2GC4 A;  2GNQ A;  2HXC A;  2EBS A;  5H1M A;  4NSX A;  3SJL D;  3NVX A;  3AL8 A;  4PSX B;  2MTA H;  3C75 H;  4PXW A;  4J73 A;  4PBZ A;  4O9D A;  3RN0 D;  2H14 A;  1NEX B;  4E5Z B;  2GC7 A;  3KRW B;  2W18 A;  3I8E A;  2P9K C;  4O3U B;  1N6F A;  5FXY A;  3SBQ A;  4GZ8 A;  3VH0 A;  2AGX A;  5CYK B;  3UVM A;  5HE0 B;  3I2N A;  5EAM A;  4FA1 D;  5EM2 B;  3BG1 A;  2OIZ A;  3SN6 B;  2YNP A;  1PEV A;  2HYE A;  4X3E A;  3BWS A;  3SXT D;  2B5N A;  2BBK H;  1JJU B;  3VA6 A;  2IWF A;  3JRO A;  4CY5 A;  3PE7 A;  3AL8 B;  3AFC A;  5EAR A;  5HE3 B;  2CN2 A;  3K26 A;  2AH0 A;  1TBG A;  3I7O A;  1JMZ B;  3U4Y A;  3B7F A;  4A2L A;  4CY1 A;  4E54 A;  4CZV A;  3K27 A;  4BH6 A;  5B4W A;  3VGZ A;  5THA A;  2H13 A;  4X61 B;  5FQD A;  1PI6 A;  5C9Z B;  3I7P A;  1A0R B;  4BUJ C;  4PC0 A;  4QQE A;  4ZOZ A;  2OK6 A;  2CO0 C;  1ERJ A;  3SHF A;  3OL2 A;  1N6D A;  3I89 A;  4CI1 A;  4J81 A;  3J80 g;  2CE8 A;  4OWR A;  2QXV A;  2P9P C;  2H47 A;  3FGB A;  3C9C A;  3L4O D;  2I0S A;  4ES0 A;  2XU7 A;  4J78 A;  2AGZ A;  3RMZ D;  4EWR A;  1GXR A;  4JSX C;  4UI9 R;  1K8K C;  1VYH C;  5TDH B;  5KDO B;  5CXB A;  4JT6 C;  3SFZ A;  4O45 A;  2XYI A;  4R7A B;  2PM9 B;  4L9O A;  4GGD A;  5I5I A;  5EML B;  4CI8 A;  1Q47 A;  3EI3 A;  4QRJ A;  2IUR A;  3PXW D;  4J86 A;  5HYN B;  2YMU A;  4A08 A;  5FKR A;  4GM8 A;  5HE2 B;  5H14 A;  3JZH A;  3N0E A;  3OKW A;  5CXC B;  2HJ4 A;  3JRP A;  3RFG A;  2AQ5 A;  2QC5 A;  3OKT A;  1S4U X;  3I8C A;  3P4F A;  4PNK B;  3JAM g;  3EMH A;  5GXH A;  2P9L C;  3I7L A;  4AOW A;  4FB1 D;  3IJ0 A;  3OW8 A;  3NVN A;  4J77 A;  3UKU C;  2H9M A;  4U1E I;  1K32 A;  4L1Q D;  2B5M A;  2AGW A;  4A0B A;  1MDA H;  5EAL A;  1XKS A;  4K3I D;  4CY3 A;  4GQ1 A;  5CYK A;  4GM3 A;  3SMR A;  4GMB A;  5FKT A;  3V9F A;  3DM0 A;  2H9L A;  5TEE A;  4CI2 A;  4ZOV A;  2UZX B;  3MZL A;  3A0F A;  3PVW B;  4XYI A;  5CXC A;  2IUV A;  1QNI A;  4L3G D;  5HQG A;  5JWZ A;  3PXS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...