3J80g

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j80g01
1NEXB 4A0AB 4CZVA 2MTAH 4PSWB 4K3JB 3EMHA 4KFMB 4QT8A 5HE2B 5HE1B 4N14A 3ORVD 4U1EI 2P9UC 2YBAA 5GXHA 1XHMA 3ULEC 2H9LA 4CI3A 3BWSA 3I7HA 2PM7B 3OKYB 4FA5D 3UR4A 5FQDA 3JPXA 5H14A 3EI2A 2AGWA 5FKRA 3I89A 3SWSD 4BL0A 2J57G 3UVOA 3F3PA 2Z2OA 4GMBA 4A08A 3EWEA 3F3FA 5FKTA 1N6FA 2P9NC 3JZGA 4GGCA 5EM2B 4ZOVA 5GSAA 5SXMA 3BG0A 1NR0A 3MXXA 1GG2B 4E5ZB 3JRPA 4G56B 4ERZA 4JSVC 3OKTA 1YFQA 2I0SA 3IIWA 2HJBA 3EI4A 3HFQA 2XYIA 4ESGA 4L9OA 1K8KC 3PSLA 3W15A 2YNOA 5AFU3 1PEVA 3J81g 3SMRA 2HKMA 3BG1A 3U4YA 4ERQA 3I8CA 3RSEC 4OZUA 2IURA 5THAA 4L3GD 4Y5RD 2QC5A 4Y7RA 5IGOA 2PM9B 3JZNA 3CFSB 4FWWA 5EAMA 5EMKB 3ZWLB 4O9DA 1FWXA 2W18A 1GP2B 2H13A 4MK0B 3K26A 5TEFA 5EM2A 3C99A 5HE0B 3OL2B 1U4CA 4H5JA 1P22A 4PXWA 2OVQB 4J81A 2G99A 4UI9R 4ZOXA 3PE7A 5TF2A 5JWZA 4E54B 4PBZA 4FA9D 2H47A 4XEIC 3NVXA 2IUVA 1RI6A 4CY1A 5A2Qg 2HYEA 1U2VC 3PSCB 4BH6A 4TZ4A 2CN2A 2I0RA 4FA4D 3JB9L 2XL2A 3SCYA 3VA6A 5CXCB 2YNPA 3RRMC 1JJUB 3I7PA 3N0EA 4A2LA 4FHLA 2Z2NA 4CC9A 2O9KA 3C75H 3N0DA 4JSNC 2AGYA 1XIPA 4FAVD 2BCJB 3JROA 4L1QD 3DM0A 5C2WB 4PSXB 3EI1A 4GGDA 5FA5B 3I2NA 3IJCA 3C9CA 5EAPA 2CE8A 2J56H 2P9SC 4A0BA 3AL8A 3V7DB 2YMUA 4E54A 5FXYA 4IMMA 3RN1D 5I5MA 4LG8A 4H5IA 3PXTD 3RLMD 4A09A 2B5LA 4J8BA 4O1QD 4IA9A 4AOWA 2XU7A 2HJ4A 3SBRA 4QQEA 1L0QA 3MZKA 1VYHC 2OK4A 1OLZA 5I5JA 4L3HD 4BUJC 5TEEA 2H3XA 4FB1D 2Z2PA 3PXSD 2QXVA 4JXMA 2UZXB 2IUPA 2H68A 4D6VA 3GFCA 2BBKH 3MZLA 4JD2C 4JT6C 4J0WA 3L4MD 4A0AA 3IJ0A 5IGQA 2OIZA 3RFHA 2CO0A 2I3TA 3MKQA 4GM9A 3SVWD 4ES0A 3EI3B 4CY5A 4J0XA 5EMLB 3MMYA 3UKUC 5GXIA 2P9KC 3OKYA 1S4UX 3JAMg 2H14A 4I79A 4A11B 4OWRA 2IWFA 5I5IA 5CYKB 3EG6A 2AGZA 5GMKn 3RFGA 5C2VB 3JZHA 3SN6B 2H6QA 4R7AB 4JSPC 4CI2A 2CNXA 5KDOB 4PC0A 4J73A 1SHYB 4E5ZA 3SFZA 4J8GA 3ODTA 4A0BB 4XYHA 2YNNA 2GC7A 4FAND 3C5MA 4LGNA 3SXTD 2IAAA 5FKQA 5H17A 3DSMA 1N6EA 4NSXA 3I8EA 3I7KA 2UZYB 1JMZB 4GM8A 3B7FA 4U7AA 3UVMA 4YVDA 3EI2B 2H9NA 2CE9A 4CI1A 3IJ1A 3RN0D 1N6DA 4X60B 5CXBB 4CY3A 4A08B 2J55H 2CO0C 3SHFA 3L4OD 5HE3B 2HESX 2B4EA 3J80g 5EARA 5HYNB 2AGLA 2B5MA 2PM9A 4X63B 4K3ID 4CI8A 2OVPB 3NVQA 2PM6B 3OL2A 1QNIA 2AQ5A 3A0FA 3I7OA 4FA1D 5AMSA 2IWKA 4PNKB 5FKSA 4PBYA 1JMXB 3EI4B 3GREA 3OKWA 4XYIA 2AH1A 4O45A 4QRJA 1B9YA 4J78A 5HQGA 3I7LA 3V9FA 1MG2A 3NVNA 1SQ9A 3PXWD 5IT9g 1JOFA 2G9AA 4J79A 5FLXg 3VGZA 3FM0A 5CXCA 3KRXB 2OK6A 3RMZD 3UKRC 1XKSA 2EBSA 4GZ8A 2GNQA 2H9PA 4GGAA 4GQ1A 5B4WA 4CZXA 1B9XA 5CXBA 2TRCB 2P9IC 2GC4A 3VH0A 5IJ7E 4LG9A 4Z8LA 2AGXA 3MKSB 3AH8B 3DXMC 4ZOYA 1Q47A 4GQBB 1TBGA 5EMMB 4GQ2P 3SLED 1K32A 4O3UB 3OW8A 4J87A 3E0CA 1OMWB 4X3EA 5EALA 1R5MA 2HXCA 2AH0A 2YB8B 3F3GA 3SBPA 5C9ZB 5AJAA 4J77A 1PGUA 4CZYA 1GOTB 4CY2A 5K1CC 3CIKB 2H6NA 3V5WB 4ERYA 5TDHB 2P9PC 3I7NA 4J84A 3FGBA 4QL1A 2OVRB 1TYQC 3IIYA 3UVLA 1MG3A 5H1MA 4A7JA 3P4FA 3EI1B 3OTTA 1ERJA 5K19A 3DXKC 1MDAH 2IUQA 4D0KA 2OJYA 4J86A 3SJLD 3AFCA 2HKRA 2XL3A 3UVNA 4ZOZA 3EI3A 3AL8B 5IC7A 3PVWB 1GXRA 2I3SA 3PVUB 3FRXA 4JT5C 4GM3A 4O3TB 4A11A 4A09B 4EWRA 3KRWB 3SBQA 5CYKA 1SQJA 2CN3A 4HDJA 3IKOA 2H6KA 2P9LC 2PBIB 3EU7A 2H9MA 5IJ8E 3CFVA 1A0RB 3DWLC 3K27A 4X61B 4A2MA 3UVKA 1PI6A 4AEZA 2B5NA 2Q7QA 4ZN4A 2I0TA 4JSXC 5EMJB 3AL9A 1PBYB 4J82A
chains in the Genus database with same CATH superfamily
1NEXB 4A0AB 4CZVA 2MTAH 4PSWB 4K3JB 3EMHA 3VI4A 4KFMB 4QT8A 4RE5A 5HE2B 5HE1B 4N14A 2VDOA 3ORVD 2P9UC 2YBAA 4U1EI 5GXHA 1XHMA 3ULEC 2H9LA 4CI3A 3BWSA 3I7HA 1VZ3A 3O4GA 2PM7B 3OKYB 4D9SA 3UR4A 4FA5D 1E8NA 5FQDA 3JPXA 3ZDYA 5H14A 3EI2A 2AGWA 5FKRA 3I89A 3KCIA 3DDUA 3SWSD 4BL0A 2J57G 4NENA 1BPOA 3V4VA 3UVOA 3F3PA 2Z2OA 4GMBA 4A08A 3EQ8A 4DNVA 3EWEA 3F3FA 5FKTA 1N6FA 2P9NC 3JZGA 4GGCA 1U8CA 5EM2B 4ZOVA 5GSAA 5SXMA 3BG0A 1NR0A 3MXXA 2VDNA 1GG2B 2XDWA 4E5ZB 3JRPA 4G56B 4ERZA 4JSVC 3OKTA 1YFQA 2I0SA 2JKXA 5FFGA 3IIWA 2HJBA 3EI4A 3HFQA 2XYIA 3ZE1A 4ESGA 4L9OA 5M61A 1K8KC 3PSLA 3W15A 2YNOA 5AFU3 1PEVA 2BKLA 1E5TA 3J81g 3SMRA 2HKMA 2EIEA 3BG1A 3U4YA 4RE6A 4ERQA 3MVDK 1QFSA 3I8CA 3RSEC 4OZUA 2IURA 4MMYA 5THAA 4L3GD 4Y5RD 2QC5A 4Y7RA 5IGOA 2PM9B 3JZNA 3CFSB 4FWWA 5EAMA 5EMKB 3ZWLB 4O9DA 1FWXA 2W18A 1E8MA 1GP2B 2H13A 4MK0B 3K26A 5TEFA 4WJKA 5EM2A 3C99A 5HE0B 2WQ8A 3OL2B 1VE6A 1U4CA 4H5JA 1P22A 4PXWA 2OVQB 4J81A 2G99A 4UI9R 4ZOXA 3PE7A 5TF2A 5JWZA 4E54B 4PBZA 4FA9D 3T3MA 2H47A 2HU8A 4XEIC 3NVXA 2IUVA 1H2YA 1RI6A 4CY1A 3VI3A 5A2Qg 2EIBA 2HYEA 2QR5A 1U2VC 3PSCB 4BH6A 5M5VA 4TZ4A 2CN2A 2I0RA 4FA4D 3JB9L 2XL2A 3IUJA 3SCYA 3VA6A 5CXCB 1H2WA 2YNPA 3RRMC 1JJUB 3I7PA 3N0EA 4A2LA 2VZ1A 4FHLA 2Z2NA 3IUNA 4CC9A 2O9KA 3C75H 3N0DA 4JSNC 5M5SA 3QI0A 2AGYA 1XIPA 4FAVD 2BCJB 3JROA 4DNUA 4L1QD 3DM0A 5C2WB 4PSXB 3EI1A 4GGDA 5FA5B 3I2NA 3IJCA 4IRZA 1UOQA 3C9CA 2VDRA 5EAPA 2CE8A 2J56H 2P9SC 4A0BA 3AL8A 3V7DB 2YMUA 4E54A 4AMZA 1TYEA 2EICA 5FXYA 4IMMA 3RN1D 5I5MA 4LG8A 4H5IA 3PXTD 3RLMD 3ZE2A 3MUNA 4JHNA 4A09A 2B5LA 4J8BA 4O1QD 4IA9A 4AOWA 2XU7A 2HJ4A 3GC3B 3SBRA 4QQEA 1L0QA 3MZKA 3O4HA 1VYHC 2OK4A 1OLZA 5I5JA 4L3HD 4BUJC 5TEEA 2H3XA 3EQ7A 4FB1D 2Z2PA 3PXSD 2QXVA 4O2WA 4JXMA 2UZXB 4NBMA 2IUPA 2H68A 4D6VA 3GFCA 2BBKH 3MZLA 4JD2C 5C92A 4JT6C 4J0WA 3L4MD 3IJEA 4A0AA 3IJ0A 5M5RA 5IGQA 2OIZA 3RFHA 2CO0A 2I3TA 3FCUA 3MKQA 3O4IA 4GM9A 3SVWD 4ES0A 3EI3B 1T2XA 1VE7A 4CY5A 4J0XA 5EMLB 4AN1A 3MMYA 4BCDA 3UKUC 5GXIA 2P9KC 2VDKA 1K3IA 3OKYA 1S4UX 3IUMA 3JAMg 2H14A 4I79A 4A11B 1GOGA 4OWRA 1A12A 3T3PA 2IWFA 5I5IA 4WK2A 5CYKB 1C9IA 3EG6A 2AGZA 5GMKn 4Z7OA 3RFGA 5C2VB 2VDPA 3JZHA 3QHYB 5C86A 3SN6B 2H6QA 4R7AB 4JSPC 4CI2A 2CNXA 5KDOB 4PC0A 4J73A 1SHYB 4E5ZA 3SFZA 4G1EA 4J8GA 3ODTA 1JTDB 4XYHA 4A0BB 2YNNA 2GC7A 4FAND 3C5MA 4LGNA 3SXTD 2IAAA 5FKQA 5H17A 4DNWA 3DSMA 1JV2A 1N6EA 2VC2A 4NSXA 3I8EA 3I7KA 4AMYA 2UZYB 1JMZB 4GM8A 3B7FA 1O6GA 4U7AA 5FFOA 3UVMA 4YVDA 3EI2B 2H9NA 2CE9A 4WK0A 4CI1A 3IJ1A 3RN0D 1N6DA 4X60B 5CXBB 3IVMA 4CY3A 4A08B 2J55H 2CO0C 3IULA 3SHFA 3L4OD 4BP9A 5HE3B 2HESX 2XE4A 2B4EA 3J80g 5EARA 5HYNB 2AGLA 2B5MA 2PM9A 4X63B 3IURA 4K3ID 2VDMA 4O02A 2VZ3A 2OVPB 4CI8A 1UOPA 3NVQA 2VDLA 2PM6B 3ZDZA 3K71A 3OL2A 1QNIA 2AQ5A 3A0FA 3I7OA 4FA1D 5AMSA 3IUQA 2IWKA 4AX4A 4PNKB 5FKSA 4PBYA 1JMXB 3EI4B 3GREA 3OKWA 4XYIA 4BCCA 2AH1A 4O45A 4QRJA 1B9YA 4J78A 5HQGA 3I7LA 3V9FA 1MG2A 4BP8A 3NVNA 1SQ9A 3PXWD 1UOOA 5IT9g 1JOFA 2G9AA 4J79A 5FLXg 3VGZA 3FM0A 5CXCA 3KRXB 3NIFA 2OK6A 3FCSA 3RMZD 1GOHA 4Z7QA 3UKRC 1XKSA 2EBSA 4GZ8A 2GNQA 2H9PA 4GGAA 4GQ1A 5B4WA 4CZXA 4NAAA 3MUOA 1B9XA 5CXBA 2TRCB 2P9IC 2GC4A 3VH0A 3ZDXA 5IJ7E 4LG9A 4Z8LA 5E6RA 1UTCA 2AGXA 1C9LA 3MKSB 3AH8B 1O6FA 3DXMC 2HU7A 4ZOYA 1Q47A 4GQBB 1TBGA 5EMMB 4GQ2P 3SLED 2EIDA 1K32A 4O3UB 3OW8A 5HDBA 4J87A 3E0CA 1OMWB 4X3EA 5EALA 4L1MA 1R5MA 2VDQA 2HXCA 2AH0A 2YB8B 3F3GA 3SBPA 5E6SA 5C9ZB 1I2MB 5AJAA 4J77A 3ZE0A 3NIDA 1PGUA 4CZYA 1GOTB 5M5UA 3NIGA 4CY2A 5K1CC 4Z7NA 4UM9A 3CIKB 2H6NA 3V5WB 1VZ2A 4ERYA 5TDHB 2P9PC 2XZGA 1YR2A 4G55A 1H2ZA 3I7NA 4J84A 3FGBA 4QL1A 2OVRB 4AN0A 1TYQC 4JHPC 5E6UA 3EQ9A 3IIYA 3O4JA 4G1MA 3UVLA 1MG3A 5H1MA 4A7JA 3P4FA 3EI1B 3OTTA 1ERJA 4BCBA 5K19A 3DXKC 5M5TA 1MDAH 2IUQA 4MMXA 4D0KA 2OJYA 4J86A 3SJLD 3AFCA 1GOFA 4NC4A 2HKRA 2XL3A 2QZPA 3UVNA 4ZOZA 3EI3A 3K72A 1L5GA 3OF7A 3AL8B 5IC7A 3PVWB 1GXRA 4UM8A 4WK4A 2I3SA 1H2XA 2HU5A 3PVUB 3FRXA 1M1XA 4JT5C 4MMZA 3K6SA 4GM3A 4O3TB 4A11A 1QFMA 4A09B 4EWRA 3KRWB 3SBQA 3V4PA 5CYKA 1SQJA 2CN3A 4HDJA 3IKOA 2H6KA 2P9LC 2PBIB 3EU7A 2H9MA 5IJ8E 3CFVA 1A0RB 3DWLC 3K27A 4X61B 4A2MA 3UVKA 1PI6A 4AEZA 2B5NA 3GD1I 4QAMA 2Q7QA 4ZN4A 2I0TA 4JSXC 5EMJB 3AL9A 1PBYB 4J82A
chains in the Genus database with same CATH topology
1NEXB 4A0AB 4CZVA 2MTAH 4PSWB 4K3JB 3EMHA 4KFMB 4QT8A 5HE2B 5HE1B 4N14A 3ORVD 4U1EI 2P9UC 2YBAA 5GXHA 1XHMA 3ULEC 2H9LA 4CI3A 3BWSA 3I7HA 2PM7B 3OKYB 4FA5D 3UR4A 5FQDA 3JPXA 5H14A 3EI2A 2AGWA 5FKRA 3I89A 3SWSD 4BL0A 2J57G 3UVOA 3F3PA 2Z2OA 4GMBA 4A08A 3EWEA 3F3FA 5FKTA 1N6FA 2P9NC 3JZGA 4GGCA 5EM2B 4ZOVA 5GSAA 5SXMA 3BG0A 1NR0A 3MXXA 1GG2B 4E5ZB 3JRPA 4G56B 4ERZA 4JSVC 3OKTA 1YFQA 2I0SA 3IIWA 2HJBA 3EI4A 3HFQA 2XYIA 4ESGA 4L9OA 1K8KC 3PSLA 3W15A 2YNOA 5AFU3 1PEVA 3J81g 3SMRA 2HKMA 3BG1A 3U4YA 4ERQA 3I8CA 3RSEC 4OZUA 2IURA 5THAA 4L3GD 4Y5RD 2QC5A 4Y7RA 5IGOA 2PM9B 3JZNA 3CFSB 4FWWA 5EAMA 5EMKB 3ZWLB 4O9DA 1FWXA 2W18A 1GP2B 2H13A 4MK0B 3K26A 5TEFA 5EM2A 3C99A 5HE0B 3OL2B 1U4CA 4H5JA 1P22A 4PXWA 2OVQB 4J81A 2G99A 4UI9R 4ZOXA 3PE7A 5TF2A 5JWZA 4E54B 4PBZA 4FA9D 2H47A 4XEIC 3NVXA 2IUVA 1RI6A 4CY1A 5A2Qg 2HYEA 1U2VC 3PSCB 4BH6A 4TZ4A 2CN2A 2I0RA 4FA4D 3JB9L 2XL2A 3SCYA 3VA6A 5CXCB 2YNPA 3RRMC 1JJUB 3I7PA 3N0EA 4A2LA 4FHLA 2Z2NA 4CC9A 2O9KA 3C75H 3N0DA 4JSNC 2AGYA 1XIPA 4FAVD 2BCJB 3JROA 4L1QD 3DM0A 5C2WB 4PSXB 3EI1A 4GGDA 5FA5B 3I2NA 3IJCA 3C9CA 5EAPA 2CE8A 2J56H 2P9SC 4A0BA 3AL8A 3V7DB 2YMUA 4E54A 5FXYA 4IMMA 3RN1D 5I5MA 4LG8A 4H5IA 3PXTD 3RLMD 4A09A 2B5LA 4J8BA 4O1QD 4IA9A 4AOWA 2XU7A 2HJ4A 3SBRA 4QQEA 1L0QA 3MZKA 1VYHC 2OK4A 1OLZA 5I5JA 4L3HD 4BUJC 5TEEA 2H3XA 4FB1D 2Z2PA 3PXSD 2QXVA 4JXMA 2UZXB 2IUPA 2H68A 4D6VA 3GFCA 2BBKH 3MZLA 4JD2C 4JT6C 4J0WA 3L4MD 4A0AA 3IJ0A 5IGQA 2OIZA 3RFHA 2CO0A 2I3TA 3MKQA 4GM9A 3SVWD 4ES0A 3EI3B 4CY5A 4J0XA 5EMLB 3MMYA 3UKUC 5GXIA 2P9KC 3OKYA 1S4UX 3JAMg 2H14A 4I79A 4A11B 4OWRA 2IWFA 5I5IA 5CYKB 3EG6A 2AGZA 5GMKn 3RFGA 5C2VB 3JZHA 3SN6B 2H6QA 4R7AB 4JSPC 4CI2A 2CNXA 5KDOB 4PC0A 4J73A 1SHYB 4E5ZA 3SFZA 4J8GA 3ODTA 4A0BB 4XYHA 2YNNA 2GC7A 4FAND 3C5MA 4LGNA 3SXTD 2IAAA 5FKQA 5H17A 3DSMA 1N6EA 4NSXA 3I8EA 3I7KA 2UZYB 1JMZB 4GM8A 3B7FA 4U7AA 3UVMA 4YVDA 3EI2B 2H9NA 2CE9A 4CI1A 3IJ1A 3RN0D 1N6DA 4X60B 5CXBB 4CY3A 4A08B 2J55H 2CO0C 3SHFA 3L4OD 5HE3B 2HESX 2B4EA 3J80g 5EARA 5HYNB 2AGLA 2B5MA 2PM9A 4X63B 4K3ID 4CI8A 2OVPB 3NVQA 2PM6B 3OL2A 1QNIA 2AQ5A 3A0FA 3I7OA 4FA1D 5AMSA 2IWKA 4PNKB 5FKSA 4PBYA 1JMXB 3EI4B 3GREA 3OKWA 4XYIA 2AH1A 4O45A 4QRJA 1B9YA 4J78A 5HQGA 3I7LA 3V9FA 1MG2A 3NVNA 1SQ9A 3PXWD 5IT9g 1JOFA 2G9AA 4J79A 5FLXg 3VGZA 3FM0A 5CXCA 3KRXB 2OK6A 3RMZD 3UKRC 1XKSA 2EBSA 4GZ8A 2GNQA 2H9PA 4GGAA 4GQ1A 5B4WA 4CZXA 1B9XA 5CXBA 2TRCB 2P9IC 2GC4A 3VH0A 5IJ7E 4LG9A 4Z8LA 2AGXA 3MKSB 3AH8B 3DXMC 4ZOYA 1Q47A 4GQBB 1TBGA 5EMMB 4GQ2P 3SLED 1K32A 4O3UB 3OW8A 4J87A 3E0CA 1OMWB 4X3EA 5EALA 1R5MA 2HXCA 2AH0A 2YB8B 3F3GA 3SBPA 5C9ZB 5AJAA 4J77A 1PGUA 4CZYA 1GOTB 4CY2A 5K1CC 3CIKB 2H6NA 3V5WB 4ERYA 5TDHB 2P9PC 3I7NA 4J84A 3FGBA 4QL1A 2OVRB 1TYQC 3IIYA 3UVLA 1MG3A 5H1MA 4A7JA 3P4FA 3EI1B 3OTTA 1ERJA 5K19A 3DXKC 1MDAH 2IUQA 4D0KA 2OJYA 4J86A 3SJLD 3AFCA 2HKRA 2XL3A 3UVNA 4ZOZA 3EI3A 3AL8B 5IC7A 3PVWB 1GXRA 2I3SA 3PVUB 3FRXA 4JT5C 4GM3A 4O3TB 4A11A 4A09B 4EWRA 3KRWB 3SBQA 5CYKA 1SQJA 2CN3A 4HDJA 3IKOA 2H6KA 2P9LC 2PBIB 3EU7A 2H9MA 5IJ8E 3CFVA 1A0RB 3DWLC 3K27A 4X61B 4A2MA 3UVKA 1PI6A 4AEZA 2B5NA 2Q7QA 4ZN4A 2I0TA 4JSXC 5EMJB 3AL9A 1PBYB 4J82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEX B;  4A0A B;  4CZV A;  2MTA H;  4PSW B;  4K3J B;  3EMH A;  4KFM B;  4QT8 A;  5HE2 B;  5HE1 B;  4N14 A;  3ORV D;  4U1E I;  2P9U C;  2YBA A;  5GXH A;  1XHM A;  3ULE C;  2H9L A;  4CI3 A;  3BWS A;  3I7H A;  2PM7 B;  3OKY B;  4FA5 D;  3UR4 A;  5FQD A;  3JPX A;  5H14 A;  3EI2 A;  2AGW A;  5FKR A;  3I89 A;  3SWS D;  4BL0 A;  2J57 G;  3UVO A;  3F3P A;  2Z2O A;  4GMB A;  4A08 A;  3EWE A;  3F3F A;  5FKT A;  1N6F A;  2P9N C;  3JZG A;  4GGC A;  5EM2 B;  4ZOV A;  5GSA A;  5SXM A;  3BG0 A;  1NR0 A;  3MXX A;  1GG2 B;  4E5Z B;  3JRP A;  4G56 B;  4ERZ A;  4JSV C;  3OKT A;  1YFQ A;  2I0S A;  3IIW A;  2HJB A;  3EI4 A;  3HFQ A;  2XYI A;  4ESG A;  4L9O A;  1K8K C;  3PSL A;  3W15 A;  2YNO A;  5AFU 3;  1PEV A;  3J81 g;  3SMR A;  2HKM A;  3BG1 A;  3U4Y A;  4ERQ A;  3I8C A;  3RSE C;  4OZU A;  2IUR A;  5THA A;  4L3G D;  4Y5R D;  2QC5 A;  4Y7R A;  5IGO A;  2PM9 B;  3JZN A;  3CFS B;  4FWW A;  5EAM A;  5EMK B;  3ZWL B;  4O9D A;  1FWX A;  2W18 A;  1GP2 B;  2H13 A;  4MK0 B;  3K26 A;  5TEF A;  5EM2 A;  3C99 A;  5HE0 B;  3OL2 B;  1U4C A;  4H5J A;  1P22 A;  4PXW A;  2OVQ B;  4J81 A;  2G99 A;  4UI9 R;  4ZOX A;  3PE7 A;  5TF2 A;  5JWZ A;  4E54 B;  4PBZ A;  4FA9 D;  2H47 A;  4XEI C;  3NVX A;  2IUV A;  1RI6 A;  4CY1 A;  5A2Q g;  2HYE A;  1U2V C;  3PSC B;  4BH6 A;  4TZ4 A;  2CN2 A;  2I0R A;  4FA4 D;  3JB9 L;  2XL2 A;  3SCY A;  3VA6 A;  5CXC B;  2YNP A;  3RRM C;  1JJU B;  3I7P A;  3N0E A;  4A2L A;  4FHL A;  2Z2N A;  4CC9 A;  2O9K A;  3C75 H;  3N0D A;  4JSN C;  2AGY A;  1XIP A;  4FAV D;  2BCJ B;  3JRO A;  4L1Q D;  3DM0 A;  5C2W B;  4PSX B;  3EI1 A;  4GGD A;  5FA5 B;  3I2N A;  3IJC A;  3C9C A;  5EAP A;  2CE8 A;  2J56 H;  2P9S C;  4A0B A;  3AL8 A;  3V7D B;  2YMU A;  4E54 A;  5FXY A;  4IMM A;  3RN1 D;  5I5M A;  4LG8 A;  4H5I A;  3PXT D;  3RLM D;  4A09 A;  2B5L A;  4J8B A;  4O1Q D;  4IA9 A;  4AOW A;  2XU7 A;  2HJ4 A;  3SBR A;  4QQE A;  1L0Q A;  3MZK A;  1VYH C;  2OK4 A;  1OLZ A;  5I5J A;  4L3H D;  4BUJ C;  5TEE A;  2H3X A;  4FB1 D;  2Z2P A;  3PXS D;  2QXV A;  4JXM A;  2UZX B;  2IUP A;  2H68 A;  4D6V A;  3GFC A;  2BBK H;  3MZL A;  4JD2 C;  4JT6 C;  4J0W A;  3L4M D;  4A0A A;  3IJ0 A;  5IGQ A;  2OIZ A;  3RFH A;  2CO0 A;  2I3T A;  3MKQ A;  4GM9 A;  3SVW D;  4ES0 A;  3EI3 B;  4CY5 A;  4J0X A;  5EML B;  3MMY A;  3UKU C;  5GXI A;  2P9K C;  3OKY A;  1S4U X;  3JAM g;  2H14 A;  4I79 A;  4A11 B;  4OWR A;  2IWF A;  5I5I A;  5CYK B;  3EG6 A;  2AGZ A;  5GMK n;  3RFG A;  5C2V B;  3JZH A;  3SN6 B;  2H6Q A;  4R7A B;  4JSP C;  4CI2 A;  2CNX A;  5KDO B;  4PC0 A;  4J73 A;  1SHY B;  4E5Z A;  3SFZ A;  4J8G A;  3ODT A;  4A0B B;  4XYH A;  2YNN A;  2GC7 A;  4FAN D;  3C5M A;  4LGN A;  3SXT D;  2IAA A;  5FKQ A;  5H17 A;  3DSM A;  1N6E A;  4NSX A;  3I8E A;  3I7K A;  2UZY B;  1JMZ B;  4GM8 A;  3B7F A;  4U7A A;  3UVM A;  4YVD A;  3EI2 B;  2H9N A;  2CE9 A;  4CI1 A;  3IJ1 A;  3RN0 D;  1N6D A;  4X60 B;  5CXB B;  4CY3 A;  4A08 B;  2J55 H;  2CO0 C;  3SHF A;  3L4O D;  5HE3 B;  2HES X;  2B4E A;  3J80 g;  5EAR A;  5HYN B;  2AGL A;  2B5M A;  2PM9 A;  4X63 B;  4K3I D;  4CI8 A;  2OVP B;  3NVQ A;  2PM6 B;  3OL2 A;  1QNI A;  2AQ5 A;  3A0F A;  3I7O A;  4FA1 D;  5AMS A;  2IWK A;  4PNK B;  5FKS A;  4PBY A;  1JMX B;  3EI4 B;  3GRE A;  3OKW A;  4XYI A;  2AH1 A;  4O45 A;  4QRJ A;  1B9Y A;  4J78 A;  5HQG A;  3I7L A;  3V9F A;  1MG2 A;  3NVN A;  1SQ9 A;  3PXW D;  5IT9 g;  1JOF A;  2G9A A;  4J79 A;  5FLX g;  3VGZ A;  3FM0 A;  5CXC A;  3KRX B;  2OK6 A;  3RMZ D;  3UKR C;  1XKS A;  2EBS A;  4GZ8 A;  2GNQ A;  2H9P A;  4GGA A;  4GQ1 A;  5B4W A;  4CZX A;  1B9X A;  5CXB A;  2TRC B;  2P9I C;  2GC4 A;  3VH0 A;  5IJ7 E;  4LG9 A;  4Z8L A;  2AGX A;  3MKS B;  3AH8 B;  3DXM C;  4ZOY A;  1Q47 A;  4GQB B;  1TBG A;  5EMM B;  4GQ2 P;  3SLE D;  1K32 A;  4O3U B;  3OW8 A;  4J87 A;  3E0C A;  1OMW B;  4X3E A;  5EAL A;  1R5M A;  2HXC A;  2AH0 A;  2YB8 B;  3F3G A;  3SBP A;  5C9Z B;  5AJA A;  4J77 A;  1PGU A;  4CZY A;  1GOT B;  4CY2 A;  5K1C C;  3CIK B;  2H6N A;  3V5W B;  4ERY A;  5TDH B;  2P9P C;  3I7N A;  4J84 A;  3FGB A;  4QL1 A;  2OVR B;  1TYQ C;  3IIY A;  3UVL A;  1MG3 A;  5H1M A;  4A7J A;  3P4F A;  3EI1 B;  3OTT A;  1ERJ A;  5K19 A;  3DXK C;  1MDA H;  2IUQ A;  4D0K A;  2OJY A;  4J86 A;  3SJL D;  3AFC A;  2HKR A;  2XL3 A;  3UVN A;  4ZOZ A;  3EI3 A;  3AL8 B;  5IC7 A;  3PVW B;  1GXR A;  2I3S A;  3PVU B;  3FRX A;  4JT5 C;  4GM3 A;  4O3T B;  4A11 A;  4A09 B;  4EWR A;  3KRW B;  3SBQ A;  5CYK A;  1SQJ A;  2CN3 A;  4HDJ A;  3IKO A;  2H6K A;  2P9L C;  2PBI B;  3EU7 A;  2H9M A;  5IJ8 E;  3CFV A;  1A0R B;  3DWL C;  3K27 A;  4X61 B;  4A2M A;  3UVK A;  1PI6 A;  4AEZ A;  2B5N A;  2Q7Q A;  4ZN4 A;  2I0T A;  4JSX C;  5EMJ B;  3AL9 A;  1PBY B;  4J82 A; 
#chains in the Genus database with same CATH topology
 1NEX B;  4A0A B;  4CZV A;  2MTA H;  4PSW B;  4K3J B;  3EMH A;  3VI4 A;  4KFM B;  4QT8 A;  4RE5 A;  5HE2 B;  5HE1 B;  4N14 A;  2VDO A;  3ORV D;  2P9U C;  2YBA A;  4U1E I;  5GXH A;  1XHM A;  3ULE C;  2H9L A;  4CI3 A;  3BWS A;  3I7H A;  1VZ3 A;  3O4G A;  2PM7 B;  3OKY B;  4D9S A;  3UR4 A;  4FA5 D;  1E8N A;  5FQD A;  3JPX A;  3ZDY A;  5H14 A;  3EI2 A;  2AGW A;  5FKR A;  3I89 A;  3KCI A;  3DDU A;  3SWS D;  4BL0 A;  2J57 G;  4NEN A;  1BPO A;  3V4V A;  3UVO A;  3F3P A;  2Z2O A;  4GMB A;  4A08 A;  3EQ8 A;  4DNV A;  3EWE A;  3F3F A;  5FKT A;  1N6F A;  2P9N C;  3JZG A;  4GGC A;  1U8C A;  5EM2 B;  4ZOV A;  5GSA A;  5SXM A;  3BG0 A;  1NR0 A;  3MXX A;  2VDN A;  1GG2 B;  2XDW A;  4E5Z B;  3JRP A;  4G56 B;  4ERZ A;  4JSV C;  3OKT A;  1YFQ A;  2I0S A;  2JKX A;  5FFG A;  3IIW A;  2HJB A;  3EI4 A;  3HFQ A;  2XYI A;  3ZE1 A;  4ESG A;  4L9O A;  5M61 A;  1K8K C;  3PSL A;  3W15 A;  2YNO A;  5AFU 3;  1PEV A;  2BKL A;  1E5T A;  3J81 g;  3SMR A;  2HKM A;  2EIE A;  3BG1 A;  3U4Y A;  4RE6 A;  4ERQ A;  3MVD K;  1QFS A;  3I8C A;  3RSE C;  4OZU A;  2IUR A;  4MMY A;  5THA A;  4L3G D;  4Y5R D;  2QC5 A;  4Y7R A;  5IGO A;  2PM9 B;  3JZN A;  3CFS B;  4FWW A;  5EAM A;  5EMK B;  3ZWL B;  4O9D A;  1FWX A;  2W18 A;  1E8M A;  1GP2 B;  2H13 A;  4MK0 B;  3K26 A;  5TEF A;  4WJK A;  5EM2 A;  3C99 A;  5HE0 B;  2WQ8 A;  3OL2 B;  1VE6 A;  1U4C A;  4H5J A;  1P22 A;  4PXW A;  2OVQ B;  4J81 A;  2G99 A;  4UI9 R;  4ZOX A;  3PE7 A;  5TF2 A;  5JWZ A;  4E54 B;  4PBZ A;  4FA9 D;  3T3M A;  2H47 A;  2HU8 A;  4XEI C;  3NVX A;  2IUV A;  1H2Y A;  1RI6 A;  4CY1 A;  3VI3 A;  5A2Q g;  2EIB A;  2HYE A;  2QR5 A;  1U2V C;  3PSC B;  4BH6 A;  5M5V A;  4TZ4 A;  2CN2 A;  2I0R A;  4FA4 D;  3JB9 L;  2XL2 A;  3IUJ A;  3SCY A;  3VA6 A;  5CXC B;  1H2W A;  2YNP A;  3RRM C;  1JJU B;  3I7P A;  3N0E A;  4A2L A;  2VZ1 A;  4FHL A;  2Z2N A;  3IUN A;  4CC9 A;  2O9K A;  3C75 H;  3N0D A;  4JSN C;  5M5S A;  3QI0 A;  2AGY A;  1XIP A;  4FAV D;  2BCJ B;  3JRO A;  4DNU A;  4L1Q D;  3DM0 A;  5C2W B;  4PSX B;  3EI1 A;  4GGD A;  5FA5 B;  3I2N A;  3IJC A;  4IRZ A;  1UOQ A;  3C9C A;  2VDR A;  5EAP A;  2CE8 A;  2J56 H;  2P9S C;  4A0B A;  3AL8 A;  3V7D B;  2YMU A;  4E54 A;  4AMZ A;  1TYE A;  2EIC A;  5FXY A;  4IMM A;  3RN1 D;  5I5M A;  4LG8 A;  4H5I A;  3PXT D;  3RLM D;  3ZE2 A;  3MUN A;  4JHN A;  4A09 A;  2B5L A;  4J8B A;  4O1Q D;  4IA9 A;  4AOW A;  2XU7 A;  2HJ4 A;  3GC3 B;  3SBR A;  4QQE A;  1L0Q A;  3MZK A;  3O4H A;  1VYH C;  2OK4 A;  1OLZ A;  5I5J A;  4L3H D;  4BUJ C;  5TEE A;  2H3X A;  3EQ7 A;  4FB1 D;  2Z2P A;  3PXS D;  2QXV A;  4O2W A;  4JXM A;  2UZX B;  4NBM A;  2IUP A;  2H68 A;  4D6V A;  3GFC A;  2BBK H;  3MZL A;  4JD2 C;  5C92 A;  4JT6 C;  4J0W A;  3L4M D;  3IJE A;  4A0A A;  3IJ0 A;  5M5R A;  5IGQ A;  2OIZ A;  3RFH A;  2CO0 A;  2I3T A;  3FCU A;  3MKQ A;  3O4I A;  4GM9 A;  3SVW D;  4ES0 A;  3EI3 B;  1T2X A;  1VE7 A;  4CY5 A;  4J0X A;  5EML B;  4AN1 A;  3MMY A;  4BCD A;  3UKU C;  5GXI A;  2P9K C;  2VDK A;  1K3I A;  3OKY A;  1S4U X;  3IUM A;  3JAM g;  2H14 A;  4I79 A;  4A11 B;  1GOG A;  4OWR A;  1A12 A;  3T3P A;  2IWF A;  5I5I A;  4WK2 A;  5CYK B;  1C9I A;  3EG6 A;  2AGZ A;  5GMK n;  4Z7O A;  3RFG A;  5C2V B;  2VDP A;  3JZH A;  3QHY B;  5C86 A;  3SN6 B;  2H6Q A;  4R7A B;  4JSP C;  4CI2 A;  2CNX A;  5KDO B;  4PC0 A;  4J73 A;  1SHY B;  4E5Z A;  3SFZ A;  4G1E A;  4J8G A;  3ODT A;  1JTD B;  4XYH A;  4A0B B;  2YNN A;  2GC7 A;  4FAN D;  3C5M A;  4LGN A;  3SXT D;  2IAA A;  5FKQ A;  5H17 A;  4DNW A;  3DSM A;  1JV2 A;  1N6E A;  2VC2 A;  4NSX A;  3I8E A;  3I7K A;  4AMY A;  2UZY B;  1JMZ B;  4GM8 A;  3B7F A;  1O6G A;  4U7A A;  5FFO A;  3UVM A;  4YVD A;  3EI2 B;  2H9N A;  2CE9 A;  4WK0 A;  4CI1 A;  3IJ1 A;  3RN0 D;  1N6D A;  4X60 B;  5CXB B;  3IVM A;  4CY3 A;  4A08 B;  2J55 H;  2CO0 C;  3IUL A;  3SHF A;  3L4O D;  4BP9 A;  5HE3 B;  2HES X;  2XE4 A;  2B4E A;  3J80 g;  5EAR A;  5HYN B;  2AGL A;  2B5M A;  2PM9 A;  4X63 B;  3IUR A;  4K3I D;  2VDM A;  4O02 A;  2VZ3 A;  2OVP B;  4CI8 A;  1UOP A;  3NVQ A;  2VDL A;  2PM6 B;  3ZDZ A;  3K71 A;  3OL2 A;  1QNI A;  2AQ5 A;  3A0F A;  3I7O A;  4FA1 D;  5AMS A;  3IUQ A;  2IWK A;  4AX4 A;  4PNK B;  5FKS A;  4PBY A;  1JMX B;  3EI4 B;  3GRE A;  3OKW A;  4XYI A;  4BCC A;  2AH1 A;  4O45 A;  4QRJ A;  1B9Y A;  4J78 A;  5HQG A;  3I7L A;  3V9F A;  1MG2 A;  4BP8 A;  3NVN A;  1SQ9 A;  3PXW D;  1UOO A;  5IT9 g;  1JOF A;  2G9A A;  4J79 A;  5FLX g;  3VGZ A;  3FM0 A;  5CXC A;  3KRX B;  3NIF A;  2OK6 A;  3FCS A;  3RMZ D;  1GOH A;  4Z7Q A;  3UKR C;  1XKS A;  2EBS A;  4GZ8 A;  2GNQ A;  2H9P A;  4GGA A;  4GQ1 A;  5B4W A;  4CZX A;  4NAA A;  3MUO A;  1B9X A;  5CXB A;  2TRC B;  2P9I C;  2GC4 A;  3VH0 A;  3ZDX A;  5IJ7 E;  4LG9 A;  4Z8L A;  5E6R A;  1UTC A;  2AGX A;  1C9L A;  3MKS B;  3AH8 B;  1O6F A;  3DXM C;  2HU7 A;  4ZOY A;  1Q47 A;  4GQB B;  1TBG A;  5EMM B;  4GQ2 P;  3SLE D;  2EID A;  1K32 A;  4O3U B;  3OW8 A;  5HDB A;  4J87 A;  3E0C A;  1OMW B;  4X3E A;  5EAL A;  4L1M A;  1R5M A;  2VDQ A;  2HXC A;  2AH0 A;  2YB8 B;  3F3G A;  3SBP A;  5E6S A;  5C9Z B;  1I2M B;  5AJA A;  4J77 A;  3ZE0 A;  3NID A;  1PGU A;  4CZY A;  1GOT B;  5M5U A;  3NIG A;  4CY2 A;  5K1C C;  4Z7N A;  4UM9 A;  3CIK B;  2H6N A;  3V5W B;  1VZ2 A;  4ERY A;  5TDH B;  2P9P C;  2XZG A;  1YR2 A;  4G55 A;  1H2Z A;  3I7N A;  4J84 A;  3FGB A;  4QL1 A;  2OVR B;  4AN0 A;  1TYQ C;  4JHP C;  5E6U A;  3EQ9 A;  3IIY A;  3O4J A;  4G1M A;  3UVL A;  1MG3 A;  5H1M A;  4A7J A;  3P4F A;  3EI1 B;  3OTT A;  1ERJ A;  4BCB A;  5K19 A;  3DXK C;  5M5T A;  1MDA H;  2IUQ A;  4MMX A;  4D0K A;  2OJY A;  4J86 A;  3SJL D;  3AFC A;  1GOF A;  4NC4 A;  2HKR A;  2XL3 A;  2QZP A;  3UVN A;  4ZOZ A;  3EI3 A;  3K72 A;  1L5G A;  3OF7 A;  3AL8 B;  5IC7 A;  3PVW B;  1GXR A;  4UM8 A;  4WK4 A;  2I3S A;  1H2X A;  2HU5 A;  3PVU B;  3FRX A;  1M1X A;  4JT5 C;  4MMZ A;  3K6S A;  4GM3 A;  4O3T B;  4A11 A;  1QFM A;  4A09 B;  4EWR A;  3KRW B;  3SBQ A;  3V4P A;  5CYK A;  1SQJ A;  2CN3 A;  4HDJ A;  3IKO A;  2H6K A;  2P9L C;  2PBI B;  3EU7 A;  2H9M A;  5IJ8 E;  3CFV A;  1A0R B;  3DWL C;  3K27 A;  4X61 B;  4A2M A;  3UVK A;  1PI6 A;  4AEZ A;  2B5N A;  3GD1 I;  4QAM A;  2Q7Q A;  4ZN4 A;  2I0T A;  4JSX C;  5EMJ B;  3AL9 A;  1PBY B;  4J82 A; 
#chains in the Genus database with same CATH homology
 1NEX B;  4A0A B;  4CZV A;  2MTA H;  4PSW B;  4K3J B;  3EMH A;  4KFM B;  4QT8 A;  5HE2 B;  5HE1 B;  4N14 A;  3ORV D;  4U1E I;  2P9U C;  2YBA A;  5GXH A;  1XHM A;  3ULE C;  2H9L A;  4CI3 A;  3BWS A;  3I7H A;  2PM7 B;  3OKY B;  4FA5 D;  3UR4 A;  5FQD A;  3JPX A;  5H14 A;  3EI2 A;  2AGW A;  5FKR A;  3I89 A;  3SWS D;  4BL0 A;  2J57 G;  3UVO A;  3F3P A;  2Z2O A;  4GMB A;  4A08 A;  3EWE A;  3F3F A;  5FKT A;  1N6F A;  2P9N C;  3JZG A;  4GGC A;  5EM2 B;  4ZOV A;  5GSA A;  5SXM A;  3BG0 A;  1NR0 A;  3MXX A;  1GG2 B;  4E5Z B;  3JRP A;  4G56 B;  4ERZ A;  4JSV C;  3OKT A;  1YFQ A;  2I0S A;  3IIW A;  2HJB A;  3EI4 A;  3HFQ A;  2XYI A;  4ESG A;  4L9O A;  1K8K C;  3PSL A;  3W15 A;  2YNO A;  5AFU 3;  1PEV A;  3J81 g;  3SMR A;  2HKM A;  3BG1 A;  3U4Y A;  4ERQ A;  3I8C A;  3RSE C;  4OZU A;  2IUR A;  5THA A;  4L3G D;  4Y5R D;  2QC5 A;  4Y7R A;  5IGO A;  2PM9 B;  3JZN A;  3CFS B;  4FWW A;  5EAM A;  5EMK B;  3ZWL B;  4O9D A;  1FWX A;  2W18 A;  1GP2 B;  2H13 A;  4MK0 B;  3K26 A;  5TEF A;  5EM2 A;  3C99 A;  5HE0 B;  3OL2 B;  1U4C A;  4H5J A;  1P22 A;  4PXW A;  2OVQ B;  4J81 A;  2G99 A;  4UI9 R;  4ZOX A;  3PE7 A;  5TF2 A;  5JWZ A;  4E54 B;  4PBZ A;  4FA9 D;  2H47 A;  4XEI C;  3NVX A;  2IUV A;  1RI6 A;  4CY1 A;  5A2Q g;  2HYE A;  1U2V C;  3PSC B;  4BH6 A;  4TZ4 A;  2CN2 A;  2I0R A;  4FA4 D;  3JB9 L;  2XL2 A;  3SCY A;  3VA6 A;  5CXC B;  2YNP A;  3RRM C;  1JJU B;  3I7P A;  3N0E A;  4A2L A;  4FHL A;  2Z2N A;  4CC9 A;  2O9K A;  3C75 H;  3N0D A;  4JSN C;  2AGY A;  1XIP A;  4FAV D;  2BCJ B;  3JRO A;  4L1Q D;  3DM0 A;  5C2W B;  4PSX B;  3EI1 A;  4GGD A;  5FA5 B;  3I2N A;  3IJC A;  3C9C A;  5EAP A;  2CE8 A;  2J56 H;  2P9S C;  4A0B A;  3AL8 A;  3V7D B;  2YMU A;  4E54 A;  5FXY A;  4IMM A;  3RN1 D;  5I5M A;  4LG8 A;  4H5I A;  3PXT D;  3RLM D;  4A09 A;  2B5L A;  4J8B A;  4O1Q D;  4IA9 A;  4AOW A;  2XU7 A;  2HJ4 A;  3SBR A;  4QQE A;  1L0Q A;  3MZK A;  1VYH C;  2OK4 A;  1OLZ A;  5I5J A;  4L3H D;  4BUJ C;  5TEE A;  2H3X A;  4FB1 D;  2Z2P A;  3PXS D;  2QXV A;  4JXM A;  2UZX B;  2IUP A;  2H68 A;  4D6V A;  3GFC A;  2BBK H;  3MZL A;  4JD2 C;  4JT6 C;  4J0W A;  3L4M D;  4A0A A;  3IJ0 A;  5IGQ A;  2OIZ A;  3RFH A;  2CO0 A;  2I3T A;  3MKQ A;  4GM9 A;  3SVW D;  4ES0 A;  3EI3 B;  4CY5 A;  4J0X A;  5EML B;  3MMY A;  3UKU C;  5GXI A;  2P9K C;  3OKY A;  1S4U X;  3JAM g;  2H14 A;  4I79 A;  4A11 B;  4OWR A;  2IWF A;  5I5I A;  5CYK B;  3EG6 A;  2AGZ A;  5GMK n;  3RFG A;  5C2V B;  3JZH A;  3SN6 B;  2H6Q A;  4R7A B;  4JSP C;  4CI2 A;  2CNX A;  5KDO B;  4PC0 A;  4J73 A;  1SHY B;  4E5Z A;  3SFZ A;  4J8G A;  3ODT A;  4A0B B;  4XYH A;  2YNN A;  2GC7 A;  4FAN D;  3C5M A;  4LGN A;  3SXT D;  2IAA A;  5FKQ A;  5H17 A;  3DSM A;  1N6E A;  4NSX A;  3I8E A;  3I7K A;  2UZY B;  1JMZ B;  4GM8 A;  3B7F A;  4U7A A;  3UVM A;  4YVD A;  3EI2 B;  2H9N A;  2CE9 A;  4CI1 A;  3IJ1 A;  3RN0 D;  1N6D A;  4X60 B;  5CXB B;  4CY3 A;  4A08 B;  2J55 H;  2CO0 C;  3SHF A;  3L4O D;  5HE3 B;  2HES X;  2B4E A;  3J80 g;  5EAR A;  5HYN B;  2AGL A;  2B5M A;  2PM9 A;  4X63 B;  4K3I D;  4CI8 A;  2OVP B;  3NVQ A;  2PM6 B;  3OL2 A;  1QNI A;  2AQ5 A;  3A0F A;  3I7O A;  4FA1 D;  5AMS A;  2IWK A;  4PNK B;  5FKS A;  4PBY A;  1JMX B;  3EI4 B;  3GRE A;  3OKW A;  4XYI A;  2AH1 A;  4O45 A;  4QRJ A;  1B9Y A;  4J78 A;  5HQG A;  3I7L A;  3V9F A;  1MG2 A;  3NVN A;  1SQ9 A;  3PXW D;  5IT9 g;  1JOF A;  2G9A A;  4J79 A;  5FLX g;  3VGZ A;  3FM0 A;  5CXC A;  3KRX B;  2OK6 A;  3RMZ D;  3UKR C;  1XKS A;  2EBS A;  4GZ8 A;  2GNQ A;  2H9P A;  4GGA A;  4GQ1 A;  5B4W A;  4CZX A;  1B9X A;  5CXB A;  2TRC B;  2P9I C;  2GC4 A;  3VH0 A;  5IJ7 E;  4LG9 A;  4Z8L A;  2AGX A;  3MKS B;  3AH8 B;  3DXM C;  4ZOY A;  1Q47 A;  4GQB B;  1TBG A;  5EMM B;  4GQ2 P;  3SLE D;  1K32 A;  4O3U B;  3OW8 A;  4J87 A;  3E0C A;  1OMW B;  4X3E A;  5EAL A;  1R5M A;  2HXC A;  2AH0 A;  2YB8 B;  3F3G A;  3SBP A;  5C9Z B;  5AJA A;  4J77 A;  1PGU A;  4CZY A;  1GOT B;  4CY2 A;  5K1C C;  3CIK B;  2H6N A;  3V5W B;  4ERY A;  5TDH B;  2P9P C;  3I7N A;  4J84 A;  3FGB A;  4QL1 A;  2OVR B;  1TYQ C;  3IIY A;  3UVL A;  1MG3 A;  5H1M A;  4A7J A;  3P4F A;  3EI1 B;  3OTT A;  1ERJ A;  5K19 A;  3DXK C;  1MDA H;  2IUQ A;  4D0K A;  2OJY A;  4J86 A;  3SJL D;  3AFC A;  2HKR A;  2XL3 A;  3UVN A;  4ZOZ A;  3EI3 A;  3AL8 B;  5IC7 A;  3PVW B;  1GXR A;  2I3S A;  3PVU B;  3FRX A;  4JT5 C;  4GM3 A;  4O3T B;  4A11 A;  4A09 B;  4EWR A;  3KRW B;  3SBQ A;  5CYK A;  1SQJ A;  2CN3 A;  4HDJ A;  3IKO A;  2H6K A;  2P9L C;  2PBI B;  3EU7 A;  2H9M A;  5IJ8 E;  3CFV A;  1A0R B;  3DWL C;  3K27 A;  4X61 B;  4A2M A;  3UVK A;  1PI6 A;  4AEZ A;  2B5N A;  2Q7Q A;  4ZN4 A;  2I0T A;  4JSX C;  5EMJ B;  3AL9 A;  1PBY B;  4J82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...