3J81g

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 49
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j81g01
3SFZA 5JWZA 4FA1D 5HE2B 2B5MA 4A2LA 2OIZA 4U7AA 2BCJB 5I5MA 2QXVA 4J79A 3OKTA 4O45A 3PXWD 3NVQA 2AH0A 2CO0A 3L4MD 3UVMA 4Y7RA 4QL1A 3ZWLB 1L0QA 3PSCB 5HQGA 5EALA 5IGQA 4JSXC 3C75H 4H5JA 4J81A 4JT6C 3MZLA 5C2VB 4MK0B 3ORVD 1VYHC 3EI3B 3AL8A 3V5WB 4CZVA 2J57G 5THAA 4FAVD 2I0SA 3EMHA 3RFHA 4G56B 4N14A 4E54A 2OVRB 3IIYA 3UVOA 2XL3A 3B7FA 3SLED 2Q7QA 5H17A 1MG2A 2B5LA 3I89A 2HJBA 4K3ID 2UZXB 4D6VA 4Z8LA 3VA6A 2G9AA 2H47A 4XEIC 1OLZA 3EU7A 5IJ8E 5HYNB 2CNXA 3U4YA 3NVNA 4ZOZA 2XU7A 3IJ0A 2OVPB 1S4UX 4A09B 3JZGA 1XKSA 2IWKA 2EBSA 3AL8B 2CN2A 3UVNA 4JSPC 4CI8A 4E54B 3IJ1A 1GOTB 3W15A 1JOFA 3MZKA 5EAMA 2B4EA 4IMMA 3P4FA 4J82A 4D0KA 5EMLB 4X3EA 3OL2A 2AGWA 3K27A 3I8EA 5HE0B 4ZOVA 4FA4D 4A7JA 3F3FA 3PVWB 1N6DA 5EM2B 4IA9A 2YNNA 3A0FA 4GQBB 3EWEA 2PBIB 5HE1B 4XYHA 1N6EA 3AFCA 1NR0A 3PXSD 3EI4B 2IUPA 2O9KA 4KFMB 2I3TA 2J56H 1QNIA 3GREA 5B4WA 4EWRA 2QC5A 5C9ZB 5H14A 2CE9A 2I0RA 3EI3A 4J86A 2AGZA 3JROA 4ZOXA 3RFGA 3OW8A 3N0DA 4I79A 4X63B 1GP2B 5FKTA 4A0BA 2H9LA 3UR4A 4O1QD 5FKSA 3V9FA 4CZYA 4J0WA 4PSXB 2I3SA 2J55H 1XIPA 4X61B 4GQ2P 5TEFA 2YB8B 3N0EA 1U2VC 2H9NA 4A09A 5GSAA 4HDJA 5FLXg 3MMYA 4FB1D 3RLMD 4L1QD 3L4OD 5EMJB 3DSMA 4JT5C 4CY1A 3SWSD 2HESX 5FKRA 4A08B 1P22A 3K26A 3RRMC 3ULEC 3KRWB 4A0BB 5EMKB 4GGAA 2W18A 4PSWB 2XYIA 2H13A 4U1EI 2P9IC 4LG9A 4CC9A 5EM2A 5IT9g 1B9YA 4XYIA 1B9XA 4OWRA 3SBRA 4O3TB 2IAAA 5CYKA 5A2Qg 2AGXA 3SMRA 4J78A 1RI6A 2OK6A 4QRJA 4GGDA 5FXYA 5CXBA 4GM3A 4K3JB 3EI4A 2YMUA 2GC4A 5EMMB 4J8GA 4YVDA 1JMXB 1K32A 4O3UB 3V7DB 4BL0A 3I7KA 1SHYB 4Y5RD 1PGUA 5EARA 4GM9A 4JSNC 2P9KC 4QT8A 1MDAH 3OTTA 4J84A 4ZOYA 5K19A 1PEVA 4L3HD 3RSEC 4ES0A 3SHFA 4FAND 4FA5D 4JD2C 4CI3A 1GXRA 5FKQA 3CFVA 4GMBA 4JXMA 5CYKB 2UZYB 4FHLA 3VGZA 2Z2PA 5CXBB 3PE7A 2IUVA 3OKYB 3RN1D 4X60B 3I2NA 3J81g 1MG3A 4PBYA 5GXHA 2P9UC 3JPXA 2YBAA 2YNOA 4CI2A 4A08A 3SBQA 3DM0A 2HKRA 3I7HA 4GQ1A 2MTAH 4R7AB 3NVXA 3SN6B 3JAMg 4J77A 3FM0A 4L3GD 2G99A 4ESGA 3I8CA 2PM7B 3C99A 4PNKB 3F3GA 3F3PA 3HFQA 3IKOA 4NSXA 2CO0C 1SQ9A 3VH0A 3I7OA 3OKWA 3SVWD 3BG0A 3PXTD 3MXXA 4J0XA 5GXIA 3SCYA 3E0CA 3JRPA 1GG2B 5TF2A 1A0RB 3MKSB 3EI2A 3GFCA 4OZUA 3FRXA 5CXCA 1JMZB 4J8BA 2I0TA 1FWXA 1SQJA 5K1CC 1U4CA 2B5NA 2P9NC 1TYQC 5AFU3 4BH6A 2HXCA 3CFSB 4PC0A 2H9PA 1K8KC 4JSVC 4ERYA 3RN0D 2AGLA 4CZXA 3FGBA 2OK4A 2OJYA 5KDOB 3EI1A 4A11A 3I7LA 3PVUB 3C5MA 4E5ZA 5IGOA 5H1MA 4CY2A 2HKMA 3IJCA 2P9PC 4O9DA 4GM8A 3J80g 5TDHB 4PXWA 3I7NA 4QQEA 2AH1A 3EI2B 2H6KA 3SXTD 5CXCB 3OKYA 1ERJA 2P9LC 4A0AA 2OVQB 3JB9L 2IWFA 3C9CA 4AOWA 2XL2A 3SJLD 1PI6A 3UVKA 2HYEA 5AJAA 4FA9D 4BUJC 1JJUB 5AMSA 3KRXB 2YNPA 3AL9A 3DXMC 3UVLA 3AH8B 5SXMA 5I5IA 3SBPA 2HJ4A 2H6QA 2IURA 2PM9A 1N6FA 3EI1B 4CY3A 3UKRC 4A11B 2PM6B 4LGNA 4GZ8A 4GGCA 4A2MA 4E5ZB 2BBKH 5FA5B 5HE3B 4ERQA 4J87A 3JZNA 1YFQA 2CE8A 3BG1A 5FQDA 2AQ5A 2H3XA 1Q47A 2H68A 3BWSA 2AGYA 2H6NA 4A0AB 3DWLC 5EAPA 2Z2NA 3MKQA 1NEXB 5IC7A 2IUQA 5C2WB 5GMKn 4J73A 4UI9R 3PSLA 4CI1A 2GNQA 3EG6A 3JZHA 3UKUC 2GC7A 1XHMA 3DXKC 1PBYB 5TEEA 4PBZA 5IJ7E 3CIKB 2H9MA 4AEZA 2PM9B 5I5JA 1OMWB 1R5MA 1TBGA 2CN3A 4CY5A 2TRCB 4ERZA 4FWWA 3IIWA 4L9OA 4TZ4A 3RMZD 3ODTA 4LG8A 2H14A 3I7PA 3OL2B 2Z2OA 4ZN4A 2P9SC 4H5IA
chains in the Genus database with same CATH superfamily
3SFZA 5JWZA 4FA1D 5HE2B 2B5MA 2BKLA 4A2LA 2OIZA 4Z7NA 4U7AA 2BCJB 5I5MA 4BCCA 2QXVA 4J79A 3O4GA 1TYEA 3OKTA 4O45A 3NIFA 3PXWD 3NVQA 2AH0A 2CO0A 3L4MD 3UVMA 4NBMA 4Y7RA 3GD1I 4QL1A 3ZWLB 1L0QA 3PSCB 5HQGA 5EALA 5IGQA 3C75H 4J81A 4H5JA 4JT6C 4JSXC 3MZLA 1GOGA 5C2VB 4MK0B 3ORVD 1VYHC 3EI3B 1UOQA 3AL8A 3V5WB 4CZVA 2J57G 5THAA 4FAVD 2I0SA 3EMHA 3RFHA 3VI4A 4G56B 4N14A 4E54A 2OVRB 3IIYA 3UVOA 2XL3A 3B7FA 3MVDK 3SLED 2Q7QA 5H17A 4AN1A 1MG2A 1U8CA 2B5LA 3I89A 2HJBA 4K3ID 2HU8A 2UZXB 4D6VA 4Z8LA 3VA6A 2G9AA 2H47A 4XEIC 1OLZA 3IUNA 3EU7A 5IJ8E 5HYNB 1H2WA 1GOFA 2CNXA 4NAAA 3U4YA 3NVNA 4IRZA 1I2MB 2XU7A 2HU7A 3IJ0A 4ZOZA 1UOPA 2OVPB 2EICA 1S4UX 4A09B 3ZE1A 1JV2A 4AX4A 3T3MA 3JZGA 5M61A 1XKSA 3DDUA 2IWKA 1VZ3A 2EBSA 3V4PA 3AL8B 2CN2A 3UVNA 4JSPC 4CI8A 3O4IA 4E54B 3IJ1A 1GOTB 3W15A 1JOFA 3ZDYA 4RE6A 3MZKA 5EAMA 2B4EA 4IMMA 3FCUA 3P4FA 4J82A 4D0KA 4QAMA 5EMLB 4X3EA 3OL2A 2AGWA 3K27A 1QFMA 3I8EA 3QI0A 5HE0B 2XE4A 4ZOVA 4FA4D 4A7JA 3F3FA 3PVWB 1N6DA 5EM2B 4IA9A 2YNNA 2HU5A 1E8NA 1C9IA 1H2XA 4AMYA 4AMZA 3A0FA 4GQBB 3EWEA 2PBIB 5HE1B 4XYHA 1N6EA 3AFCA 1NR0A 3PXSD 3EI4B 2IUPA 2O9KA 4KFMB 2I3TA 2J56H 1QNIA 3GREA 5B4WA 4EWRA 2QC5A 5C9ZB 5H14A 2CE9A 2I0RA 3IJEA 2VDNA 3EI3A 4J86A 2AGZA 3JROA 4ZOXA 3EQ7A 4MMYA 4UM9A 3RFGA 3OW8A 4DNUA 3N0DA 4I79A 4X63B 1GP2B 2VDPA 5FKTA 4A0BA 2H9LA 3UR4A 4O1QD 5FKSA 3V9FA 4CZYA 5M5UA 4WK2A 2VDOA 4J0WA 4PSXB 2I3SA 2J55H 2VDQA 1UTCA 1XIPA 4X61B 4GQ2P 5TEFA 2YB8B 3N0EA 1U2VC 2H9NA 4A09A 5M5RA 5GSAA 4HDJA 5FLXg 3MMYA 4FB1D 3RLMD 4L1QD 1E8MA 3L4OD 5EMJB 1T2XA 3DSMA 4JT5C 4CY1A 1E5TA 3SWSD 2HESX 5FKRA 4A08B 1P22A 3K26A 4G1EA 3RRMC 3ULEC 3KRWB 4A0BB 5EMKB 3ZE2A 3MUOA 4GGAA 2W18A 4PSWB 3T3PA 2XYIA 2H13A 4U1EI 2P9IC 4LG9A 4CC9A 5EM2A 1JTDB 5IT9g 1B9YA 4XYIA 2QR5A 1B9XA 4OWRA 5FFOA 3SBRA 4O3TB 2IAAA 5CYKA 5A2Qg 2AGXA 3KCIA 3SMRA 4J78A 1RI6A 2OK6A 3IUJA 4QRJA 4GGDA 5FXYA 5CXBA 4GM3A 3IVMA 4K3JB 3EI4A 2YMUA 1H2ZA 2GC4A 5EMMB 4J8GA 1VZ2A 4YVDA 1JMXB 1K32A 4G1MA 4JHNA 1O6FA 1QFSA 4O3UB 3V7DB 4JHPC 4BP8A 4BL0A 3IUMA 2VDRA 3I7KA 1SHYB 1K3IA 1PGUA 4Y5RD 5EARA 4GM9A 4JSNC 3IURA 2P9KC 4QT8A 3ZE0A 1MDAH 3OTTA 4J84A 4ZOYA 5K19A 1PEVA 5M5VA 4L3HD 5C86A 3RSEC 4ES0A 3SHFA 4FAND 4FA5D 4JD2C 4CI3A 1GXRA 5FKQA 3CFVA 4GMBA 4JXMA 5M5SA 3OF7A 5CYKB 2UZYB 4FHLA 3EQ8A 3VGZA 2Z2PA 3O4HA 5CXBB 3PE7A 2IUVA 3OKYB 3RN1D 4X60B 3I2NA 4BCBA 3J81g 1MG3A 4PBYA 3V4VA 4MMZA 3NIDA 5GXHA 1H2YA 2P9UC 3JPXA 2YBAA 2YNOA 5E6RA 4CI2A 3IUQA 4A08A 3SBQA 3FCSA 3DM0A 2HKRA 3I7HA 4GQ1A 2MTAH 4R7AB 3NVXA 3SN6B 3JAMg 4J77A 3FM0A 4L3GD 2G99A 3ZDZA 4WK0A 4ESGA 3I8CA 2PM7B 3C99A 4PNKB 3F3GA 3F3PA 3HFQA 3IKOA 4NSXA 2CO0C 5C92A 1SQ9A 3VH0A 3I7OA 3OKWA 4AN0A 4UM8A 3SVWD 3BG0A 3PXTD 3MXXA 4J0XA 5GXIA 3SCYA 3E0CA 4O02A 3JRPA 1GG2B 5E6SA 5TF2A 1A0RB 3MKSB 3EI2A 3GFCA 1M1XA 4OZUA 3FRXA 5CXCA 1JMZB 2VC2A 4J8BA 2EIEA 2I0TA 1FWXA 1L5GA 2JKXA 1SQJA 4DNVA 2EIBA 5K1CC 1U4CA 2B5NA 3K72A 3EQ9A 2P9NC 1TYQC 5AFU3 4BH6A 2HXCA 3CFSB 4PC0A 2H9PA 1K8KC 4JSVC 4ERYA 3RN0D 2AGLA 4CZXA 3FGBA 2OK4A 4BP9A 3O4JA 2OJYA 5KDOB 3EI1A 4A11A 3GC3B 3I7LA 3PVUB 4NC4A 3C5MA 4E5ZA 4WJKA 5IGOA 5H1MA 4CY2A 2HKMA 3MUNA 2EIDA 3IJCA 2P9PC 4O9DA 4GM8A 3J80g 1VE6A 2WQ8A 5TDHB 4D9SA 4PXWA 3I7NA 4QQEA 2AH1A 3EI2B 2H6KA 3SXTD 5CXCB 1C9LA 2VDKA 3OKYA 4DNWA 1ERJA 2P9LC 4A0AA 2OVQB 3JB9L 2IWFA 3C9CA 4AOWA 2XL2A 3SJLD 2QZPA 1PI6A 3UVKA 2HYEA 4MMXA 5AJAA 5FFGA 4FA9D 4BUJC 1VE7A 1JJUB 2VDLA 1YR2A 4O2WA 2VZ3A 3K71A 5AMSA 3ZDXA 3KRXB 2YNPA 3AL9A 3DXMC 3UVLA 3K6SA 3AH8B 4Z7OA 5SXMA 5I5IA 3SBPA 2HJ4A 2H6QA 2IURA 2PM9A 1N6FA 3EI1B 4CY3A 3UKRC 4A11B 2PM6B 4LGNA 4GZ8A 4GGCA 4A2MA 4E5ZB 2BBKH 2XZGA 5FA5B 3NIGA 5HE3B 4ERQA 4G55A 3QHYB 4J87A 3JZNA 4RE5A 1YFQA 4NENA 2CE8A 3BG1A 5FQDA 2AQ5A 5E6UA 2H3XA 1GOHA 1Q47A 2H68A 3IULA 3BWSA 4L1MA 3VI3A 2AGYA 2VZ1A 2H6NA 4A0AB 3DWLC 5EAPA 2Z2NA 3MKQA 1NEXB 1UOOA 5IC7A 2IUQA 5C2WB 2XDWA 5GMKn 4WK4A 4J73A 4UI9R 3PSLA 4CI1A 2GNQA 2VDMA 3EG6A 3JZHA 3UKUC 2GC7A 1XHMA 3DXKC 1PBYB 5TEEA 4PBZA 5IJ7E 5HDBA 3CIKB 2H9MA 4AEZA 1A12A 2PM9B 5I5JA 1OMWB 1R5MA 1TBGA 4BCDA 4Z7QA 5M5TA 2CN3A 4CY5A 2TRCB 4ERZA 4FWWA 3IIWA 4L9OA 4TZ4A 3RMZD 1O6GA 3ODTA 4LG8A 2H14A 3I7PA 1BPOA 3OL2B 2Z2OA 4ZN4A 2P9SC 4H5IA
chains in the Genus database with same CATH topology
3SFZA 5JWZA 4FA1D 5HE2B 2B5MA 4A2LA 2OIZA 4U7AA 2BCJB 5I5MA 2QXVA 4J79A 3OKTA 4O45A 3PXWD 3NVQA 2AH0A 2CO0A 3L4MD 3UVMA 4Y7RA 4QL1A 3ZWLB 1L0QA 3PSCB 5HQGA 5EALA 5IGQA 4JSXC 3C75H 4H5JA 4J81A 4JT6C 3MZLA 5C2VB 4MK0B 3ORVD 1VYHC 3EI3B 3AL8A 3V5WB 4CZVA 2J57G 5THAA 4FAVD 2I0SA 3EMHA 3RFHA 4G56B 4N14A 4E54A 2OVRB 3IIYA 3UVOA 2XL3A 3B7FA 3SLED 2Q7QA 5H17A 1MG2A 2B5LA 3I89A 2HJBA 4K3ID 2UZXB 4D6VA 4Z8LA 3VA6A 2G9AA 2H47A 4XEIC 1OLZA 3EU7A 5IJ8E 5HYNB 2CNXA 3U4YA 3NVNA 4ZOZA 2XU7A 3IJ0A 2OVPB 1S4UX 4A09B 3JZGA 1XKSA 2IWKA 2EBSA 3AL8B 2CN2A 3UVNA 4JSPC 4CI8A 4E54B 3IJ1A 1GOTB 3W15A 1JOFA 3MZKA 5EAMA 2B4EA 4IMMA 3P4FA 4J82A 4D0KA 5EMLB 4X3EA 3OL2A 2AGWA 3K27A 3I8EA 5HE0B 4ZOVA 4FA4D 4A7JA 3F3FA 3PVWB 1N6DA 5EM2B 4IA9A 2YNNA 3A0FA 4GQBB 3EWEA 2PBIB 5HE1B 4XYHA 1N6EA 3AFCA 1NR0A 3PXSD 3EI4B 2IUPA 2O9KA 4KFMB 2I3TA 2J56H 1QNIA 3GREA 5B4WA 4EWRA 2QC5A 5C9ZB 5H14A 2CE9A 2I0RA 3EI3A 4J86A 2AGZA 3JROA 4ZOXA 3RFGA 3OW8A 3N0DA 4I79A 4X63B 1GP2B 5FKTA 4A0BA 2H9LA 3UR4A 4O1QD 5FKSA 3V9FA 4CZYA 4J0WA 4PSXB 2I3SA 2J55H 1XIPA 4X61B 4GQ2P 5TEFA 2YB8B 3N0EA 1U2VC 2H9NA 4A09A 5GSAA 4HDJA 5FLXg 3MMYA 4FB1D 3RLMD 4L1QD 3L4OD 5EMJB 3DSMA 4JT5C 4CY1A 3SWSD 2HESX 5FKRA 4A08B 1P22A 3K26A 3RRMC 3ULEC 3KRWB 4A0BB 5EMKB 4GGAA 2W18A 4PSWB 2XYIA 2H13A 4U1EI 2P9IC 4LG9A 4CC9A 5EM2A 5IT9g 1B9YA 4XYIA 1B9XA 4OWRA 3SBRA 4O3TB 2IAAA 5CYKA 5A2Qg 2AGXA 3SMRA 4J78A 1RI6A 2OK6A 4QRJA 4GGDA 5FXYA 5CXBA 4GM3A 4K3JB 3EI4A 2YMUA 2GC4A 5EMMB 4J8GA 4YVDA 1JMXB 1K32A 4O3UB 3V7DB 4BL0A 3I7KA 1SHYB 4Y5RD 1PGUA 5EARA 4GM9A 4JSNC 2P9KC 4QT8A 1MDAH 3OTTA 4J84A 4ZOYA 5K19A 1PEVA 4L3HD 3RSEC 4ES0A 3SHFA 4FAND 4FA5D 4JD2C 4CI3A 1GXRA 5FKQA 3CFVA 4GMBA 4JXMA 5CYKB 2UZYB 4FHLA 3VGZA 2Z2PA 5CXBB 3PE7A 2IUVA 3OKYB 3RN1D 4X60B 3I2NA 3J81g 1MG3A 4PBYA 5GXHA 2P9UC 3JPXA 2YBAA 2YNOA 4CI2A 4A08A 3SBQA 3DM0A 2HKRA 3I7HA 4GQ1A 2MTAH 4R7AB 3NVXA 3SN6B 3JAMg 4J77A 3FM0A 4L3GD 2G99A 4ESGA 3I8CA 2PM7B 3C99A 4PNKB 3F3GA 3F3PA 3HFQA 3IKOA 4NSXA 2CO0C 1SQ9A 3VH0A 3I7OA 3OKWA 3SVWD 3BG0A 3PXTD 3MXXA 4J0XA 5GXIA 3SCYA 3E0CA 3JRPA 1GG2B 5TF2A 1A0RB 3MKSB 3EI2A 3GFCA 4OZUA 3FRXA 5CXCA 1JMZB 4J8BA 2I0TA 1FWXA 1SQJA 5K1CC 1U4CA 2B5NA 2P9NC 1TYQC 5AFU3 4BH6A 2HXCA 3CFSB 4PC0A 2H9PA 1K8KC 4JSVC 4ERYA 3RN0D 2AGLA 4CZXA 3FGBA 2OK4A 2OJYA 5KDOB 3EI1A 4A11A 3I7LA 3PVUB 3C5MA 4E5ZA 5IGOA 5H1MA 4CY2A 2HKMA 3IJCA 2P9PC 4O9DA 4GM8A 3J80g 5TDHB 4PXWA 3I7NA 4QQEA 2AH1A 3EI2B 2H6KA 3SXTD 5CXCB 3OKYA 1ERJA 2P9LC 4A0AA 2OVQB 3JB9L 2IWFA 3C9CA 4AOWA 2XL2A 3SJLD 1PI6A 3UVKA 2HYEA 5AJAA 4FA9D 4BUJC 1JJUB 5AMSA 3KRXB 2YNPA 3AL9A 3DXMC 3UVLA 3AH8B 5SXMA 5I5IA 3SBPA 2HJ4A 2H6QA 2IURA 2PM9A 1N6FA 3EI1B 4CY3A 3UKRC 4A11B 2PM6B 4LGNA 4GZ8A 4GGCA 4A2MA 4E5ZB 2BBKH 5FA5B 5HE3B 4ERQA 4J87A 3JZNA 1YFQA 2CE8A 3BG1A 5FQDA 2AQ5A 2H3XA 1Q47A 2H68A 3BWSA 2AGYA 2H6NA 4A0AB 3DWLC 5EAPA 2Z2NA 3MKQA 1NEXB 5IC7A 2IUQA 5C2WB 5GMKn 4J73A 4UI9R 3PSLA 4CI1A 2GNQA 3EG6A 3JZHA 3UKUC 2GC7A 1XHMA 3DXKC 1PBYB 5TEEA 4PBZA 5IJ7E 3CIKB 2H9MA 4AEZA 2PM9B 5I5JA 1OMWB 1R5MA 1TBGA 2CN3A 4CY5A 2TRCB 4ERZA 4FWWA 3IIWA 4L9OA 4TZ4A 3RMZD 3ODTA 4LG8A 2H14A 3I7PA 3OL2B 2Z2OA 4ZN4A 2P9SC 4H5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFZ A;  5JWZ A;  4FA1 D;  5HE2 B;  2B5M A;  4A2L A;  2OIZ A;  4U7A A;  2BCJ B;  5I5M A;  2QXV A;  4J79 A;  3OKT A;  4O45 A;  3PXW D;  3NVQ A;  2AH0 A;  2CO0 A;  3L4M D;  3UVM A;  4Y7R A;  4QL1 A;  3ZWL B;  1L0Q A;  3PSC B;  5HQG A;  5EAL A;  5IGQ A;  4JSX C;  3C75 H;  4H5J A;  4J81 A;  4JT6 C;  3MZL A;  5C2V B;  4MK0 B;  3ORV D;  1VYH C;  3EI3 B;  3AL8 A;  3V5W B;  4CZV A;  2J57 G;  5THA A;  4FAV D;  2I0S A;  3EMH A;  3RFH A;  4G56 B;  4N14 A;  4E54 A;  2OVR B;  3IIY A;  3UVO A;  2XL3 A;  3B7F A;  3SLE D;  2Q7Q A;  5H17 A;  1MG2 A;  2B5L A;  3I89 A;  2HJB A;  4K3I D;  2UZX B;  4D6V A;  4Z8L A;  3VA6 A;  2G9A A;  2H47 A;  4XEI C;  1OLZ A;  3EU7 A;  5IJ8 E;  5HYN B;  2CNX A;  3U4Y A;  3NVN A;  4ZOZ A;  2XU7 A;  3IJ0 A;  2OVP B;  1S4U X;  4A09 B;  3JZG A;  1XKS A;  2IWK A;  2EBS A;  3AL8 B;  2CN2 A;  3UVN A;  4JSP C;  4CI8 A;  4E54 B;  3IJ1 A;  1GOT B;  3W15 A;  1JOF A;  3MZK A;  5EAM A;  2B4E A;  4IMM A;  3P4F A;  4J82 A;  4D0K A;  5EML B;  4X3E A;  3OL2 A;  2AGW A;  3K27 A;  3I8E A;  5HE0 B;  4ZOV A;  4FA4 D;  4A7J A;  3F3F A;  3PVW B;  1N6D A;  5EM2 B;  4IA9 A;  2YNN A;  3A0F A;  4GQB B;  3EWE A;  2PBI B;  5HE1 B;  4XYH A;  1N6E A;  3AFC A;  1NR0 A;  3PXS D;  3EI4 B;  2IUP A;  2O9K A;  4KFM B;  2I3T A;  2J56 H;  1QNI A;  3GRE A;  5B4W A;  4EWR A;  2QC5 A;  5C9Z B;  5H14 A;  2CE9 A;  2I0R A;  3EI3 A;  4J86 A;  2AGZ A;  3JRO A;  4ZOX A;  3RFG A;  3OW8 A;  3N0D A;  4I79 A;  4X63 B;  1GP2 B;  5FKT A;  4A0B A;  2H9L A;  3UR4 A;  4O1Q D;  5FKS A;  3V9F A;  4CZY A;  4J0W A;  4PSX B;  2I3S A;  2J55 H;  1XIP A;  4X61 B;  4GQ2 P;  5TEF A;  2YB8 B;  3N0E A;  1U2V C;  2H9N A;  4A09 A;  5GSA A;  4HDJ A;  5FLX g;  3MMY A;  4FB1 D;  3RLM D;  4L1Q D;  3L4O D;  5EMJ B;  3DSM A;  4JT5 C;  4CY1 A;  3SWS D;  2HES X;  5FKR A;  4A08 B;  1P22 A;  3K26 A;  3RRM C;  3ULE C;  3KRW B;  4A0B B;  5EMK B;  4GGA A;  2W18 A;  4PSW B;  2XYI A;  2H13 A;  4U1E I;  2P9I C;  4LG9 A;  4CC9 A;  5EM2 A;  5IT9 g;  1B9Y A;  4XYI A;  1B9X A;  4OWR A;  3SBR A;  4O3T B;  2IAA A;  5CYK A;  5A2Q g;  2AGX A;  3SMR A;  4J78 A;  1RI6 A;  2OK6 A;  4QRJ A;  4GGD A;  5FXY A;  5CXB A;  4GM3 A;  4K3J B;  3EI4 A;  2YMU A;  2GC4 A;  5EMM B;  4J8G A;  4YVD A;  1JMX B;  1K32 A;  4O3U B;  3V7D B;  4BL0 A;  3I7K A;  1SHY B;  4Y5R D;  1PGU A;  5EAR A;  4GM9 A;  4JSN C;  2P9K C;  4QT8 A;  1MDA H;  3OTT A;  4J84 A;  4ZOY A;  5K19 A;  1PEV A;  4L3H D;  3RSE C;  4ES0 A;  3SHF A;  4FAN D;  4FA5 D;  4JD2 C;  4CI3 A;  1GXR A;  5FKQ A;  3CFV A;  4GMB A;  4JXM A;  5CYK B;  2UZY B;  4FHL A;  3VGZ A;  2Z2P A;  5CXB B;  3PE7 A;  2IUV A;  3OKY B;  3RN1 D;  4X60 B;  3I2N A;  3J81 g;  1MG3 A;  4PBY A;  5GXH A;  2P9U C;  3JPX A;  2YBA A;  2YNO A;  4CI2 A;  4A08 A;  3SBQ A;  3DM0 A;  2HKR A;  3I7H A;  4GQ1 A;  2MTA H;  4R7A B;  3NVX A;  3SN6 B;  3JAM g;  4J77 A;  3FM0 A;  4L3G D;  2G99 A;  4ESG A;  3I8C A;  2PM7 B;  3C99 A;  4PNK B;  3F3G A;  3F3P A;  3HFQ A;  3IKO A;  4NSX A;  2CO0 C;  1SQ9 A;  3VH0 A;  3I7O A;  3OKW A;  3SVW D;  3BG0 A;  3PXT D;  3MXX A;  4J0X A;  5GXI A;  3SCY A;  3E0C A;  3JRP A;  1GG2 B;  5TF2 A;  1A0R B;  3MKS B;  3EI2 A;  3GFC A;  4OZU A;  3FRX A;  5CXC A;  1JMZ B;  4J8B A;  2I0T A;  1FWX A;  1SQJ A;  5K1C C;  1U4C A;  2B5N A;  2P9N C;  1TYQ C;  5AFU 3;  4BH6 A;  2HXC A;  3CFS B;  4PC0 A;  2H9P A;  1K8K C;  4JSV C;  4ERY A;  3RN0 D;  2AGL A;  4CZX A;  3FGB A;  2OK4 A;  2OJY A;  5KDO B;  3EI1 A;  4A11 A;  3I7L A;  3PVU B;  3C5M A;  4E5Z A;  5IGO A;  5H1M A;  4CY2 A;  2HKM A;  3IJC A;  2P9P C;  4O9D A;  4GM8 A;  3J80 g;  5TDH B;  4PXW A;  3I7N A;  4QQE A;  2AH1 A;  3EI2 B;  2H6K A;  3SXT D;  5CXC B;  3OKY A;  1ERJ A;  2P9L C;  4A0A A;  2OVQ B;  3JB9 L;  2IWF A;  3C9C A;  4AOW A;  2XL2 A;  3SJL D;  1PI6 A;  3UVK A;  2HYE A;  5AJA A;  4FA9 D;  4BUJ C;  1JJU B;  5AMS A;  3KRX B;  2YNP A;  3AL9 A;  3DXM C;  3UVL A;  3AH8 B;  5SXM A;  5I5I A;  3SBP A;  2HJ4 A;  2H6Q A;  2IUR A;  2PM9 A;  1N6F A;  3EI1 B;  4CY3 A;  3UKR C;  4A11 B;  2PM6 B;  4LGN A;  4GZ8 A;  4GGC A;  4A2M A;  4E5Z B;  2BBK H;  5FA5 B;  5HE3 B;  4ERQ A;  4J87 A;  3JZN A;  1YFQ A;  2CE8 A;  3BG1 A;  5FQD A;  2AQ5 A;  2H3X A;  1Q47 A;  2H68 A;  3BWS A;  2AGY A;  2H6N A;  4A0A B;  3DWL C;  5EAP A;  2Z2N A;  3MKQ A;  1NEX B;  5IC7 A;  2IUQ A;  5C2W B;  5GMK n;  4J73 A;  4UI9 R;  3PSL A;  4CI1 A;  2GNQ A;  3EG6 A;  3JZH A;  3UKU C;  2GC7 A;  1XHM A;  3DXK C;  1PBY B;  5TEE A;  4PBZ A;  5IJ7 E;  3CIK B;  2H9M A;  4AEZ A;  2PM9 B;  5I5J A;  1OMW B;  1R5M A;  1TBG A;  2CN3 A;  4CY5 A;  2TRC B;  4ERZ A;  4FWW A;  3IIW A;  4L9O A;  4TZ4 A;  3RMZ D;  3ODT A;  4LG8 A;  2H14 A;  3I7P A;  3OL2 B;  2Z2O A;  4ZN4 A;  2P9S C;  4H5I A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  5JWZ A;  4FA1 D;  5HE2 B;  2B5M A;  2BKL A;  4A2L A;  2OIZ A;  4Z7N A;  4U7A A;  2BCJ B;  5I5M A;  4BCC A;  2QXV A;  4J79 A;  3O4G A;  1TYE A;  3OKT A;  4O45 A;  3NIF A;  3PXW D;  3NVQ A;  2AH0 A;  2CO0 A;  3L4M D;  3UVM A;  4NBM A;  4Y7R A;  3GD1 I;  4QL1 A;  3ZWL B;  1L0Q A;  3PSC B;  5HQG A;  5EAL A;  5IGQ A;  3C75 H;  4J81 A;  4H5J A;  4JT6 C;  4JSX C;  3MZL A;  1GOG A;  5C2V B;  4MK0 B;  3ORV D;  1VYH C;  3EI3 B;  1UOQ A;  3AL8 A;  3V5W B;  4CZV A;  2J57 G;  5THA A;  4FAV D;  2I0S A;  3EMH A;  3RFH A;  3VI4 A;  4G56 B;  4N14 A;  4E54 A;  2OVR B;  3IIY A;  3UVO A;  2XL3 A;  3B7F A;  3MVD K;  3SLE D;  2Q7Q A;  5H17 A;  4AN1 A;  1MG2 A;  1U8C A;  2B5L A;  3I89 A;  2HJB A;  4K3I D;  2HU8 A;  2UZX B;  4D6V A;  4Z8L A;  3VA6 A;  2G9A A;  2H47 A;  4XEI C;  1OLZ A;  3IUN A;  3EU7 A;  5IJ8 E;  5HYN B;  1H2W A;  1GOF A;  2CNX A;  4NAA A;  3U4Y A;  3NVN A;  4IRZ A;  1I2M B;  2XU7 A;  2HU7 A;  3IJ0 A;  4ZOZ A;  1UOP A;  2OVP B;  2EIC A;  1S4U X;  4A09 B;  3ZE1 A;  1JV2 A;  4AX4 A;  3T3M A;  3JZG A;  5M61 A;  1XKS A;  3DDU A;  2IWK A;  1VZ3 A;  2EBS A;  3V4P A;  3AL8 B;  2CN2 A;  3UVN A;  4JSP C;  4CI8 A;  3O4I A;  4E54 B;  3IJ1 A;  1GOT B;  3W15 A;  1JOF A;  3ZDY A;  4RE6 A;  3MZK A;  5EAM A;  2B4E A;  4IMM A;  3FCU A;  3P4F A;  4J82 A;  4D0K A;  4QAM A;  5EML B;  4X3E A;  3OL2 A;  2AGW A;  3K27 A;  1QFM A;  3I8E A;  3QI0 A;  5HE0 B;  2XE4 A;  4ZOV A;  4FA4 D;  4A7J A;  3F3F A;  3PVW B;  1N6D A;  5EM2 B;  4IA9 A;  2YNN A;  2HU5 A;  1E8N A;  1C9I A;  1H2X A;  4AMY A;  4AMZ A;  3A0F A;  4GQB B;  3EWE A;  2PBI B;  5HE1 B;  4XYH A;  1N6E A;  3AFC A;  1NR0 A;  3PXS D;  3EI4 B;  2IUP A;  2O9K A;  4KFM B;  2I3T A;  2J56 H;  1QNI A;  3GRE A;  5B4W A;  4EWR A;  2QC5 A;  5C9Z B;  5H14 A;  2CE9 A;  2I0R A;  3IJE A;  2VDN A;  3EI3 A;  4J86 A;  2AGZ A;  3JRO A;  4ZOX A;  3EQ7 A;  4MMY A;  4UM9 A;  3RFG A;  3OW8 A;  4DNU A;  3N0D A;  4I79 A;  4X63 B;  1GP2 B;  2VDP A;  5FKT A;  4A0B A;  2H9L A;  3UR4 A;  4O1Q D;  5FKS A;  3V9F A;  4CZY A;  5M5U A;  4WK2 A;  2VDO A;  4J0W A;  4PSX B;  2I3S A;  2J55 H;  2VDQ A;  1UTC A;  1XIP A;  4X61 B;  4GQ2 P;  5TEF A;  2YB8 B;  3N0E A;  1U2V C;  2H9N A;  4A09 A;  5M5R A;  5GSA A;  4HDJ A;  5FLX g;  3MMY A;  4FB1 D;  3RLM D;  4L1Q D;  1E8M A;  3L4O D;  5EMJ B;  1T2X A;  3DSM A;  4JT5 C;  4CY1 A;  1E5T A;  3SWS D;  2HES X;  5FKR A;  4A08 B;  1P22 A;  3K26 A;  4G1E A;  3RRM C;  3ULE C;  3KRW B;  4A0B B;  5EMK B;  3ZE2 A;  3MUO A;  4GGA A;  2W18 A;  4PSW B;  3T3P A;  2XYI A;  2H13 A;  4U1E I;  2P9I C;  4LG9 A;  4CC9 A;  5EM2 A;  1JTD B;  5IT9 g;  1B9Y A;  4XYI A;  2QR5 A;  1B9X A;  4OWR A;  5FFO A;  3SBR A;  4O3T B;  2IAA A;  5CYK A;  5A2Q g;  2AGX A;  3KCI A;  3SMR A;  4J78 A;  1RI6 A;  2OK6 A;  3IUJ A;  4QRJ A;  4GGD A;  5FXY A;  5CXB A;  4GM3 A;  3IVM A;  4K3J B;  3EI4 A;  2YMU A;  1H2Z A;  2GC4 A;  5EMM B;  4J8G A;  1VZ2 A;  4YVD A;  1JMX B;  1K32 A;  4G1M A;  4JHN A;  1O6F A;  1QFS A;  4O3U B;  3V7D B;  4JHP C;  4BP8 A;  4BL0 A;  3IUM A;  2VDR A;  3I7K A;  1SHY B;  1K3I A;  1PGU A;  4Y5R D;  5EAR A;  4GM9 A;  4JSN C;  3IUR A;  2P9K C;  4QT8 A;  3ZE0 A;  1MDA H;  3OTT A;  4J84 A;  4ZOY A;  5K19 A;  1PEV A;  5M5V A;  4L3H D;  5C86 A;  3RSE C;  4ES0 A;  3SHF A;  4FAN D;  4FA5 D;  4JD2 C;  4CI3 A;  1GXR A;  5FKQ A;  3CFV A;  4GMB A;  4JXM A;  5M5S A;  3OF7 A;  5CYK B;  2UZY B;  4FHL A;  3EQ8 A;  3VGZ A;  2Z2P A;  3O4H A;  5CXB B;  3PE7 A;  2IUV A;  3OKY B;  3RN1 D;  4X60 B;  3I2N A;  4BCB A;  3J81 g;  1MG3 A;  4PBY A;  3V4V A;  4MMZ A;  3NID A;  5GXH A;  1H2Y A;  2P9U C;  3JPX A;  2YBA A;  2YNO A;  5E6R A;  4CI2 A;  3IUQ A;  4A08 A;  3SBQ A;  3FCS A;  3DM0 A;  2HKR A;  3I7H A;  4GQ1 A;  2MTA H;  4R7A B;  3NVX A;  3SN6 B;  3JAM g;  4J77 A;  3FM0 A;  4L3G D;  2G99 A;  3ZDZ A;  4WK0 A;  4ESG A;  3I8C A;  2PM7 B;  3C99 A;  4PNK B;  3F3G A;  3F3P A;  3HFQ A;  3IKO A;  4NSX A;  2CO0 C;  5C92 A;  1SQ9 A;  3VH0 A;  3I7O A;  3OKW A;  4AN0 A;  4UM8 A;  3SVW D;  3BG0 A;  3PXT D;  3MXX A;  4J0X A;  5GXI A;  3SCY A;  3E0C A;  4O02 A;  3JRP A;  1GG2 B;  5E6S A;  5TF2 A;  1A0R B;  3MKS B;  3EI2 A;  3GFC A;  1M1X A;  4OZU A;  3FRX A;  5CXC A;  1JMZ B;  2VC2 A;  4J8B A;  2EIE A;  2I0T A;  1FWX A;  1L5G A;  2JKX A;  1SQJ A;  4DNV A;  2EIB A;  5K1C C;  1U4C A;  2B5N A;  3K72 A;  3EQ9 A;  2P9N C;  1TYQ C;  5AFU 3;  4BH6 A;  2HXC A;  3CFS B;  4PC0 A;  2H9P A;  1K8K C;  4JSV C;  4ERY A;  3RN0 D;  2AGL A;  4CZX A;  3FGB A;  2OK4 A;  4BP9 A;  3O4J A;  2OJY A;  5KDO B;  3EI1 A;  4A11 A;  3GC3 B;  3I7L A;  3PVU B;  4NC4 A;  3C5M A;  4E5Z A;  4WJK A;  5IGO A;  5H1M A;  4CY2 A;  2HKM A;  3MUN A;  2EID A;  3IJC A;  2P9P C;  4O9D A;  4GM8 A;  3J80 g;  1VE6 A;  2WQ8 A;  5TDH B;  4D9S A;  4PXW A;  3I7N A;  4QQE A;  2AH1 A;  3EI2 B;  2H6K A;  3SXT D;  5CXC B;  1C9L A;  2VDK A;  3OKY A;  4DNW A;  1ERJ A;  2P9L C;  4A0A A;  2OVQ B;  3JB9 L;  2IWF A;  3C9C A;  4AOW A;  2XL2 A;  3SJL D;  2QZP A;  1PI6 A;  3UVK A;  2HYE A;  4MMX A;  5AJA A;  5FFG A;  4FA9 D;  4BUJ C;  1VE7 A;  1JJU B;  2VDL A;  1YR2 A;  4O2W A;  2VZ3 A;  3K71 A;  5AMS A;  3ZDX A;  3KRX B;  2YNP A;  3AL9 A;  3DXM C;  3UVL A;  3K6S A;  3AH8 B;  4Z7O A;  5SXM A;  5I5I A;  3SBP A;  2HJ4 A;  2H6Q A;  2IUR A;  2PM9 A;  1N6F A;  3EI1 B;  4CY3 A;  3UKR C;  4A11 B;  2PM6 B;  4LGN A;  4GZ8 A;  4GGC A;  4A2M A;  4E5Z B;  2BBK H;  2XZG A;  5FA5 B;  3NIG A;  5HE3 B;  4ERQ A;  4G55 A;  3QHY B;  4J87 A;  3JZN A;  4RE5 A;  1YFQ A;  4NEN A;  2CE8 A;  3BG1 A;  5FQD A;  2AQ5 A;  5E6U A;  2H3X A;  1GOH A;  1Q47 A;  2H68 A;  3IUL A;  3BWS A;  4L1M A;  3VI3 A;  2AGY A;  2VZ1 A;  2H6N A;  4A0A B;  3DWL C;  5EAP A;  2Z2N A;  3MKQ A;  1NEX B;  1UOO A;  5IC7 A;  2IUQ A;  5C2W B;  2XDW A;  5GMK n;  4WK4 A;  4J73 A;  4UI9 R;  3PSL A;  4CI1 A;  2GNQ A;  2VDM A;  3EG6 A;  3JZH A;  3UKU C;  2GC7 A;  1XHM A;  3DXK C;  1PBY B;  5TEE A;  4PBZ A;  5IJ7 E;  5HDB A;  3CIK B;  2H9M A;  4AEZ A;  1A12 A;  2PM9 B;  5I5J A;  1OMW B;  1R5M A;  1TBG A;  4BCD A;  4Z7Q A;  5M5T A;  2CN3 A;  4CY5 A;  2TRC B;  4ERZ A;  4FWW A;  3IIW A;  4L9O A;  4TZ4 A;  3RMZ D;  1O6G A;  3ODT A;  4LG8 A;  2H14 A;  3I7P A;  1BPO A;  3OL2 B;  2Z2O A;  4ZN4 A;  2P9S C;  4H5I A; 
#chains in the Genus database with same CATH homology
 3SFZ A;  5JWZ A;  4FA1 D;  5HE2 B;  2B5M A;  4A2L A;  2OIZ A;  4U7A A;  2BCJ B;  5I5M A;  2QXV A;  4J79 A;  3OKT A;  4O45 A;  3PXW D;  3NVQ A;  2AH0 A;  2CO0 A;  3L4M D;  3UVM A;  4Y7R A;  4QL1 A;  3ZWL B;  1L0Q A;  3PSC B;  5HQG A;  5EAL A;  5IGQ A;  4JSX C;  3C75 H;  4H5J A;  4J81 A;  4JT6 C;  3MZL A;  5C2V B;  4MK0 B;  3ORV D;  1VYH C;  3EI3 B;  3AL8 A;  3V5W B;  4CZV A;  2J57 G;  5THA A;  4FAV D;  2I0S A;  3EMH A;  3RFH A;  4G56 B;  4N14 A;  4E54 A;  2OVR B;  3IIY A;  3UVO A;  2XL3 A;  3B7F A;  3SLE D;  2Q7Q A;  5H17 A;  1MG2 A;  2B5L A;  3I89 A;  2HJB A;  4K3I D;  2UZX B;  4D6V A;  4Z8L A;  3VA6 A;  2G9A A;  2H47 A;  4XEI C;  1OLZ A;  3EU7 A;  5IJ8 E;  5HYN B;  2CNX A;  3U4Y A;  3NVN A;  4ZOZ A;  2XU7 A;  3IJ0 A;  2OVP B;  1S4U X;  4A09 B;  3JZG A;  1XKS A;  2IWK A;  2EBS A;  3AL8 B;  2CN2 A;  3UVN A;  4JSP C;  4CI8 A;  4E54 B;  3IJ1 A;  1GOT B;  3W15 A;  1JOF A;  3MZK A;  5EAM A;  2B4E A;  4IMM A;  3P4F A;  4J82 A;  4D0K A;  5EML B;  4X3E A;  3OL2 A;  2AGW A;  3K27 A;  3I8E A;  5HE0 B;  4ZOV A;  4FA4 D;  4A7J A;  3F3F A;  3PVW B;  1N6D A;  5EM2 B;  4IA9 A;  2YNN A;  3A0F A;  4GQB B;  3EWE A;  2PBI B;  5HE1 B;  4XYH A;  1N6E A;  3AFC A;  1NR0 A;  3PXS D;  3EI4 B;  2IUP A;  2O9K A;  4KFM B;  2I3T A;  2J56 H;  1QNI A;  3GRE A;  5B4W A;  4EWR A;  2QC5 A;  5C9Z B;  5H14 A;  2CE9 A;  2I0R A;  3EI3 A;  4J86 A;  2AGZ A;  3JRO A;  4ZOX A;  3RFG A;  3OW8 A;  3N0D A;  4I79 A;  4X63 B;  1GP2 B;  5FKT A;  4A0B A;  2H9L A;  3UR4 A;  4O1Q D;  5FKS A;  3V9F A;  4CZY A;  4J0W A;  4PSX B;  2I3S A;  2J55 H;  1XIP A;  4X61 B;  4GQ2 P;  5TEF A;  2YB8 B;  3N0E A;  1U2V C;  2H9N A;  4A09 A;  5GSA A;  4HDJ A;  5FLX g;  3MMY A;  4FB1 D;  3RLM D;  4L1Q D;  3L4O D;  5EMJ B;  3DSM A;  4JT5 C;  4CY1 A;  3SWS D;  2HES X;  5FKR A;  4A08 B;  1P22 A;  3K26 A;  3RRM C;  3ULE C;  3KRW B;  4A0B B;  5EMK B;  4GGA A;  2W18 A;  4PSW B;  2XYI A;  2H13 A;  4U1E I;  2P9I C;  4LG9 A;  4CC9 A;  5EM2 A;  5IT9 g;  1B9Y A;  4XYI A;  1B9X A;  4OWR A;  3SBR A;  4O3T B;  2IAA A;  5CYK A;  5A2Q g;  2AGX A;  3SMR A;  4J78 A;  1RI6 A;  2OK6 A;  4QRJ A;  4GGD A;  5FXY A;  5CXB A;  4GM3 A;  4K3J B;  3EI4 A;  2YMU A;  2GC4 A;  5EMM B;  4J8G A;  4YVD A;  1JMX B;  1K32 A;  4O3U B;  3V7D B;  4BL0 A;  3I7K A;  1SHY B;  4Y5R D;  1PGU A;  5EAR A;  4GM9 A;  4JSN C;  2P9K C;  4QT8 A;  1MDA H;  3OTT A;  4J84 A;  4ZOY A;  5K19 A;  1PEV A;  4L3H D;  3RSE C;  4ES0 A;  3SHF A;  4FAN D;  4FA5 D;  4JD2 C;  4CI3 A;  1GXR A;  5FKQ A;  3CFV A;  4GMB A;  4JXM A;  5CYK B;  2UZY B;  4FHL A;  3VGZ A;  2Z2P A;  5CXB B;  3PE7 A;  2IUV A;  3OKY B;  3RN1 D;  4X60 B;  3I2N A;  3J81 g;  1MG3 A;  4PBY A;  5GXH A;  2P9U C;  3JPX A;  2YBA A;  2YNO A;  4CI2 A;  4A08 A;  3SBQ A;  3DM0 A;  2HKR A;  3I7H A;  4GQ1 A;  2MTA H;  4R7A B;  3NVX A;  3SN6 B;  3JAM g;  4J77 A;  3FM0 A;  4L3G D;  2G99 A;  4ESG A;  3I8C A;  2PM7 B;  3C99 A;  4PNK B;  3F3G A;  3F3P A;  3HFQ A;  3IKO A;  4NSX A;  2CO0 C;  1SQ9 A;  3VH0 A;  3I7O A;  3OKW A;  3SVW D;  3BG0 A;  3PXT D;  3MXX A;  4J0X A;  5GXI A;  3SCY A;  3E0C A;  3JRP A;  1GG2 B;  5TF2 A;  1A0R B;  3MKS B;  3EI2 A;  3GFC A;  4OZU A;  3FRX A;  5CXC A;  1JMZ B;  4J8B A;  2I0T A;  1FWX A;  1SQJ A;  5K1C C;  1U4C A;  2B5N A;  2P9N C;  1TYQ C;  5AFU 3;  4BH6 A;  2HXC A;  3CFS B;  4PC0 A;  2H9P A;  1K8K C;  4JSV C;  4ERY A;  3RN0 D;  2AGL A;  4CZX A;  3FGB A;  2OK4 A;  2OJY A;  5KDO B;  3EI1 A;  4A11 A;  3I7L A;  3PVU B;  3C5M A;  4E5Z A;  5IGO A;  5H1M A;  4CY2 A;  2HKM A;  3IJC A;  2P9P C;  4O9D A;  4GM8 A;  3J80 g;  5TDH B;  4PXW A;  3I7N A;  4QQE A;  2AH1 A;  3EI2 B;  2H6K A;  3SXT D;  5CXC B;  3OKY A;  1ERJ A;  2P9L C;  4A0A A;  2OVQ B;  3JB9 L;  2IWF A;  3C9C A;  4AOW A;  2XL2 A;  3SJL D;  1PI6 A;  3UVK A;  2HYE A;  5AJA A;  4FA9 D;  4BUJ C;  1JJU B;  5AMS A;  3KRX B;  2YNP A;  3AL9 A;  3DXM C;  3UVL A;  3AH8 B;  5SXM A;  5I5I A;  3SBP A;  2HJ4 A;  2H6Q A;  2IUR A;  2PM9 A;  1N6F A;  3EI1 B;  4CY3 A;  3UKR C;  4A11 B;  2PM6 B;  4LGN A;  4GZ8 A;  4GGC A;  4A2M A;  4E5Z B;  2BBK H;  5FA5 B;  5HE3 B;  4ERQ A;  4J87 A;  3JZN A;  1YFQ A;  2CE8 A;  3BG1 A;  5FQD A;  2AQ5 A;  2H3X A;  1Q47 A;  2H68 A;  3BWS A;  2AGY A;  2H6N A;  4A0A B;  3DWL C;  5EAP A;  2Z2N A;  3MKQ A;  1NEX B;  5IC7 A;  2IUQ A;  5C2W B;  5GMK n;  4J73 A;  4UI9 R;  3PSL A;  4CI1 A;  2GNQ A;  3EG6 A;  3JZH A;  3UKU C;  2GC7 A;  1XHM A;  3DXK C;  1PBY B;  5TEE A;  4PBZ A;  5IJ7 E;  3CIK B;  2H9M A;  4AEZ A;  2PM9 B;  5I5J A;  1OMW B;  1R5M A;  1TBG A;  2CN3 A;  4CY5 A;  2TRC B;  4ERZ A;  4FWW A;  3IIW A;  4L9O A;  4TZ4 A;  3RMZ D;  3ODT A;  4LG8 A;  2H14 A;  3I7P A;  3OL2 B;  2Z2O A;  4ZN4 A;  2P9S C;  4H5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...