3JAMg

Cryoem structure of 40s-eif1a-eif1 complex from yeast
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 18S rRNA
publication title Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 53
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jamg01
4JD2C 2J57G 5CXBB 1JJUB 2YB8B 4AEZA 3OTTA 3VA6A 3UVNA 4FA1D 4FAVD 3SWSD 3DXKC 2I3TA 1PEVA 3JROA 4JXMA 5FXYA 2I0TA 2EBSA 4PXWA 3SVWD 4PSXB 5AJAA 3V5WB 3SBRA 3JZHA 3F3GA 2I0RA 3PSLA 3BWSA 2IAAA 1FWXA 2H13A 3JPXA 3OKTA 3AL8A 3JAMg 4Z8LA 4JSXC 3I7PA 4JSPC 3KRWB 5A2Qg 1GOTB 2HXCA 4H5JA 4U1EI 1U2VC 3N0EA 1N6EA 2YNOA 1L0QA 2CE9A 3ORVD 4J82A 3AL8B 4PNKB 1JOFA 2AH0A 1XIPA 2H47A 1GXRA 3RFGA 5EAPA 1TBGA 5EARA 3I7HA 2AH1A 3BG0A 4J86A 3EI3A 5CXCA 4A0BA 3RSEC 2IUVA 3GFCA 4L3GD 2H3XA 3UKUC 4CY3A 4CZYA 3JRPA 4A09A 3PXSD 5GXHA 4ZN4A 1PBYB 2Z2NA 3C99A 4CY5A 3C5MA 3SBQA 3P4FA 3EI3B 2AGYA 4J87A 1SQ9A 4FHLA 1PI6A 5CXCB 4Y5RD 3FM0A 2H6QA 3IJ0A 2OK6A 3EI4A 2XU7A 2PM6B 3OL2B 4J84A 3MZKA 3I7LA 4KFMB 1JMZB 4J73A 2OVPB 3IKOA 3SBPA 5FKQA 1B9XA 4NSXA 5K19A 4CC9A 4R7AB 5HE2B 3PXTD 4A11A 3IIYA 4ZOZA 4X60B 3PVUB 5H1MA 1SQJA 4X61B 4CY1A 1K8KC 3IJCA 5GSAA 2IUQA 1QNIA 2O9KA 4J77A 1XHMA 5TEFA 4J81A 3W15A 2B5MA 4E54A 3FGBA 3OW8A 4A2LA 5TF2A 4A11B 3EU7A 2AGXA 5TEEA 4XYIA 4U7AA 3UVMA 2HJBA 3UVKA 5JWZA 5CYKB 3MZLA 2QC5A 3SFZA 5EALA 4J0WA 5EM2B 2OIZA 4GGAA 4JSNC 1OMWB 4PC0A 2OK4A 2HJ4A 4IA9A 3I7KA 4YVDA 2PM7B 4FA5D 3RLMD 5IJ7E 3K27A 4E5ZB 3MXXA 4HDJA 4TZ4A 1U4CA 2B4EA 2IURA 2HKRA 4CY2A 1TYQC 5FLXg 3CFVA 2P9LC 4FB1D 5THAA 2P9UC 4XYHA 1GP2B 3I7NA 1NR0A 4J78A 1R5MA 5I5JA 2CN2A 3SCYA 3F3PA 4FWWA 3I2NA 1P22A 4ZOVA 5HE1B 3JB9L 3DM0A 5KDOB 1N6FA 2W18A 4A2MA 4O3TB 4ES0A 3SN6B 3A0FA 5C2VB 5HYNB 3SLED 3ULEC 3ZWLB 3JZNA 5H17A 4FA4D 5EMKB 4ERQA 2PM9A 2H6KA 4PBZA 1SHYB 4CI8A 2IWFA 3I8CA 5EMMB 2GNQA 4A0BB 4A08A 4D0KA 5IJ8E 4UI9R 2B5NA 4A09B 3UVLA 4GM8A 1MDAH 3ODTA 3E0CA 3SHFA 3NVQA 4XEIC 2H14A 3B7FA 2HESX 3AL9A 1VYHC 5K1CC 4MK0B 4JT6C 3SXTD 2CO0A 3EWEA 2P9IC 2YBAA 3MMYA 4CZVA 3MKSB 3EI4B 3AFCA 3GREA 4LGNA 2H6NA 3PE7A 4ZOXA 2CE8A 2OVRB 5GMKn 2P9SC 1GG2B 5HE0B 3NVNA 3EI1A 4L3HD 2BBKH 2I0SA 3CFSB 4ERYA 4JT5C 5FKSA 5C9ZB 2H9MA 5AMSA 4AOWA 4L9OA 2H9LA 5EMJB 4A0AA 3I8EA 4E54B 4EWRA 3EI1B 4LG8A 4IMMA 5SXMA 2G99A 4ESGA 1MG3A 4PBYA 2UZYB 4FAND 3IJ1A 2IUPA 4D6VA 2I3SA 1RI6A 4O9DA 5TDHB 4J0XA 5FKRA 1S4UX 2P9PC 4GGCA 3RN1D 5FKTA 3RRMC 2Q7QA 2Z2OA 5FQDA 2AGZA 3BG1A 5I5IA 4CI2A 3SMRA 3UR4A 5HE3B 5IC7A 4K3ID 4J8BA 4A7JA 3AH8B 1PGUA 2HKMA 4CI3A 4GGDA 2OVQB 3JZGA 2PBIB 2XL3A 5IGQA 2CO0C 2GC4A 2H9PA 5IGOA 2AGLA 3SJLD 1A0RB 2YMUA 3K26A 4LG9A 3N0DA 3UVOA 4CI1A 2H68A 4GM9A 4X63B 3I7OA 1B9YA 5FA5B 2GC7A 1NEXB 2QXVA 3L4MD 4I79A 5H14A 1N6DA 4QL1A 2CN3A 3V7DB 3OKYA 4ERZA 3DSMA 3RFHA 1K32A 2G9AA 4QQEA 5EMLB 3I89A 3OKWA 2AQ5A 4OWRA 5EAMA 3KRXB 5C2WB 4GQBB 2YNNA 5HQGA 1YFQA 3OKYB 2PM9B 4GM3A 2IWKA 5I5MA 3OL2A 3EI2A 1XKSA 2YNPA 4J8GA 3V9FA 2J56H 3EG6A 4L1QD 2HYEA 2H9NA 4A08B 4O45A 5IT9g 3VH0A 1JMXB 2MTAH 3VGZA 1ERJA 4H5IA 4BUJC 4ZOYA 4X3EA 4QT8A 4QRJA 2XYIA 3FRXA 4Y7RA 2B5LA 3RN0D 4BL0A 3EI2B 4J79A 3DXMC 4K3JB 4JSVC 4GQ1A 4G56B 2BCJB 4CZXA 3PVWB 4GQ2P 2Z2PA 1OLZA 4O3UB 3C75H 5CYKA 4N14A 5EM2A 5AFU3 2AGWA 4O1QD 3NVXA 3PSCB 3U4YA 5B4WA 4PSWB 3J81g 3PXWD 3J80g 2OJYA 3EMHA 1MG2A 3CIKB 4OZUA 4GMBA 4FA9D 3HFQA 4GZ8A 1Q47A 3F3FA 3MKQA 5CXBA 2CNXA 4A0AB 3C9CA 3L4OD 3DWLC 3RMZD 3IIWA 2P9NC 2UZXB 2TRCB 4BH6A 4E5ZA 2XL2A 2P9KC 5GXIA 3UKRC 2J55H
chains in the Genus database with same CATH superfamily
3K72A 4Z7OA 2VDPA 3IVMA 2J57G 4JD2C 5CXBB 1JJUB 2YB8B 4AEZA 3OTTA 3GC3B 3VA6A 3UVNA 4FA1D 4FAVD 3SWSD 5C86A 3DXKC 2I3TA 3GD1I 1PEVA 4BP8A 4Z7NA 3JROA 4JXMA 1H2WA 1UOOA 2VDMA 5FXYA 2I0TA 2EBSA 1UTCA 4NBMA 4PXWA 3SVWD 4PSXB 5AJAA 3V5WB 3SBRA 3JZHA 4MMZA 3F3GA 2I0RA 3PSLA 1GOGA 3BWSA 1E5TA 1FWXA 2BKLA 2H13A 2IAAA 3JPXA 3OKTA 3AL8A 3JAMg 4Z8LA 4BCBA 4JSXC 3NIDA 3I7PA 4JSPC 3KRWB 5A2Qg 1GOTB 2HXCA 4BCDA 4H5JA 4U1EI 1U2VC 3N0EA 1N6EA 2YNOA 1L0QA 1C9LA 2CE9A 3ORVD 4J82A 3AL8B 4PNKB 3NIFA 5M5RA 1JOFA 2AH0A 1XIPA 2H47A 1GXRA 3RFGA 5EAPA 1TBGA 5EARA 3DDUA 2AH1A 3I7HA 3BG0A 4J86A 1K3IA 3EI3A 1VE7A 3IUQA 5CXCA 4A0BA 3RSEC 2IUVA 3GFCA 4L3GD 1A12A 2H3XA 3UKUC 4CY3A 4CZYA 3MUOA 3JRPA 4DNUA 1YR2A 4A09A 1UOQA 3PXSD 3QHYB 4ZN4A 5GXHA 1PBYB 2Z2NA 4AX4A 3C99A 4CY5A 3C5MA 3SBQA 3P4FA 1JTDB 3EI3B 2AGYA 4J87A 1SQ9A 4FHLA 1PI6A 5CXCB 2VDNA 3O4GA 4Y5RD 3FM0A 2H6QA 3IJ0A 2OK6A 3EI4A 3IUMA 4G1MA 2XU7A 2PM6B 3OL2B 4J84A 3MZKA 4AN1A 3I7LA 4G55A 4KFMB 1JMZB 4J73A 2OVPB 3IKOA 3SBPA 5FKQA 3IULA 1B9XA 4NSXA 5K19A 4CC9A 4R7AB 5HE2B 3PXTD 4A11A 3IIYA 4ZOZA 4X60B 4JHPC 3O4JA 3PVUB 5H1MA 1SQJA 4X61B 4CY1A 1K8KC 3IJCA 4NENA 4BCCA 5GSAA 2IUQA 1QNIA 2O9KA 4J77A 1XHMA 5TEFA 4J81A 3W15A 1BPOA 2B5MA 5M5SA 4E54A 3FGBA 3OW8A 3ZE1A 4A2LA 5TF2A 4A11B 3K6SA 3EU7A 2AGXA 5TEEA 4XYIA 4U7AA 3UVMA 2HJBA 3UVKA 5JWZA 5CYKB 2JKXA 3MZLA 2QC5A 3SFZA 5EALA 4J0WA 3O4HA 5EM2B 2XDWA 2OIZA 5HDBA 4GGAA 4JSNC 1OMWB 4PC0A 2OK4A 2HJ4A 4IA9A 3I7KA 1UOPA 4YVDA 2PM7B 4FA5D 2VDQA 1O6GA 3RLMD 5IJ7E 4BP9A 3K27A 4E5ZB 3MXXA 4HDJA 4O2WA 4TZ4A 4AN0A 1U4CA 2B4EA 2IURA 2HKRA 4CY2A 2EICA 4MMXA 1TYQC 5FLXg 3CFVA 5E6SA 2P9LC 4FB1D 5THAA 2VDKA 2P9UC 4XYHA 4UM8A 5C92A 1GP2B 3I7NA 1NR0A 4J78A 1R5MA 1H2XA 4IRZA 5I5JA 2CN2A 3SCYA 3F3PA 4FWWA 3I2NA 1P22A 4ZOVA 3MUNA 5HE1B 3JB9L 3DM0A 5KDOB 1N6FA 2W18A 4A2MA 3VI3A 4O3TB 2XZGA 3SN6B 4ES0A 3A0FA 4AMZA 4WK2A 5C2VB 5HYNB 3SLED 3ULEC 3ZWLB 3JZNA 5H17A 3EQ8A 3O4IA 4FA4D 5EMKB 4ERQA 2PM9A 1JV2A 2H6KA 4PBZA 1SHYB 1I2MB 4CI8A 2IWFA 3I8CA 5EMMB 2GNQA 4A0BB 4A08A 4D0KA 5IJ8E 4UI9R 2B5NA 4A09B 3UVLA 4GM8A 1MDAH 3ODTA 3ZE2A 3E0CA 4MMYA 3SHFA 3NVQA 4XEIC 2H14A 5M61A 3B7FA 2HESX 3AL9A 5E6RA 1VYHC 4RE6A 5K1CC 4MK0B 4JT6C 3SXTD 3EWEA 2CO0A 2P9IC 2YBAA 3MMYA 4CZVA 3MKSB 4DNVA 3EI4B 3AFCA 1T2XA 3GREA 4NAAA 4LGNA 2H6NA 3PE7A 4ZOXA 2CE8A 1C9IA 2OVRB 5GMKn 2P9SC 1GG2B 3KCIA 5HE0B 3NVNA 3EI1A 4L3HD 2BBKH 2I0SA 1QFMA 3CFSB 4ERYA 4JT5C 2VDOA 5FKSA 4UM9A 1TYEA 2H9MA 5C9ZB 5AMSA 4AOWA 4L9OA 2H9LA 5EMJB 4A0AA 3ZDYA 1E8NA 3I8EA 4E54B 4EWRA 3EI1B 4LG8A 1H2ZA 4IMMA 3V4VA 5SXMA 2EIEA 2G99A 1O6FA 3EQ9A 4ESGA 1M1XA 1MG3A 4PBYA 2UZYB 4O02A 3VI4A 3IUNA 4FAND 3IJ1A 2IUPA 3FCUA 4WJKA 2VDLA 3K71A 4D6VA 2I3SA 3V4PA 5FFOA 1RI6A 4O9DA 5TDHB 4J0XA 5FKRA 1S4UX 2P9PC 4GGCA 3RN1D 2EIDA 1VE6A 5FKTA 3MVDK 3RRMC 2Q7QA 2Z2OA 5FQDA 2AGZA 3NIGA 3BG1A 5I5IA 4CI2A 3SMRA 3UR4A 5HE3B 3T3PA 5IC7A 4K3ID 4J8BA 3IURA 4A7JA 3AH8B 1PGUA 2HKMA 4CI3A 4GGDA 2OVQB 3JZGA 2PBIB 2XL3A 5IGQA 2VDRA 2QZPA 2CO0C 2GC4A 3IJEA 2H9PA 5IGOA 2AGLA 3SJLD 1A0RB 2YMUA 3K26A 4LG9A 5E6UA 3N0DA 3UVOA 4CI1A 4WK4A 2H68A 4GM9A 1VZ2A 4X63B 3I7OA 1B9YA 5FA5B 4G1EA 2GC7A 1NEXB 2QXVA 3L4MD 4I79A 5FFGA 5H14A 1N6DA 4QL1A 1L5GA 2CN3A 1GOHA 3V7DB 3OF7A 3OKYA 4QAMA 4ERZA 3DSMA 3RFHA 1K32A 2G9AA 4QQEA 5EMLB 3I89A 3OKWA 2AQ5A 4NC4A 4OWRA 1QFSA 5EAMA 5M5UA 4L1MA 3IUJA 3QI0A 3KRXB 5C2WB 4WK0A 4GQBB 2YNNA 5HQGA 1YFQA 3OKYB 2PM9B 4GM3A 1H2YA 2IWKA 3ZE0A 5I5MA 2HU5A 3OL2A 3EI2A 1XKSA 2YNPA 4J8GA 3V9FA 2J56H 3EG6A 4L1QD 2HYEA 2H9NA 4A08B 4JHNA 4O45A 5IT9g 3VH0A 1JMXB 2MTAH 3VGZA 2XE4A 2VZ1A 1ERJA 4H5IA 4BUJC 4ZOYA 4X3EA 4QT8A 4QRJA 2XYIA 3FRXA 4Y7RA 2B5LA 3RN0D 4BL0A 3EI2B 4J79A 3DXMC 4K3JB 4RE5A 4JSVC 3FCSA 4GQ1A 4G56B 2BCJB 3ZDXA 3ZDZA 5M5VA 2VC2A 2HU8A 4CZXA 3PVWB 4GQ2P 2Z2PA 1OLZA 4D9SA 4O3UB 4Z7QA 3C75H 2EIBA 5CYKA 4N14A 5EM2A 5AFU3 2AGWA 4O1QD 3NVXA 2QR5A 3PSCB 3EQ7A 4PSWB 5B4WA 3U4YA 3J81g 3PXWD 3J80g 2OJYA 2HU7A 3EMHA 1GOFA 1MG2A 3CIKB 1U8CA 2VZ3A 4GMBA 4OZUA 4AMYA 4FA9D 3HFQA 4GZ8A 1Q47A 3F3FA 3MKQA 4DNWA 5CXBA 2CNXA 4A0AB 3C9CA 3L4OD 3T3MA 3DWLC 3RMZD 3IIWA 2P9NC 2UZXB 2WQ8A 1VZ3A 2TRCB 4BH6A 5M5TA 4E5ZA 2XL2A 2P9KC 5GXIA 3UKRC 1E8MA 2J55H
chains in the Genus database with same CATH topology
4JD2C 2J57G 5CXBB 1JJUB 2YB8B 4AEZA 3OTTA 3VA6A 3UVNA 4FA1D 4FAVD 3SWSD 3DXKC 2I3TA 1PEVA 3JROA 4JXMA 5FXYA 2I0TA 2EBSA 4PXWA 3SVWD 4PSXB 5AJAA 3V5WB 3SBRA 3JZHA 3F3GA 2I0RA 3PSLA 3BWSA 2IAAA 1FWXA 2H13A 3JPXA 3OKTA 3AL8A 3JAMg 4Z8LA 4JSXC 3I7PA 4JSPC 3KRWB 5A2Qg 1GOTB 2HXCA 4H5JA 4U1EI 1U2VC 3N0EA 1N6EA 2YNOA 1L0QA 2CE9A 3ORVD 4J82A 3AL8B 4PNKB 1JOFA 2AH0A 1XIPA 2H47A 1GXRA 3RFGA 5EAPA 1TBGA 5EARA 3I7HA 2AH1A 3BG0A 4J86A 3EI3A 5CXCA 4A0BA 3RSEC 2IUVA 3GFCA 4L3GD 2H3XA 3UKUC 4CY3A 4CZYA 3JRPA 4A09A 3PXSD 5GXHA 4ZN4A 1PBYB 2Z2NA 3C99A 4CY5A 3C5MA 3SBQA 3P4FA 3EI3B 2AGYA 4J87A 1SQ9A 4FHLA 1PI6A 5CXCB 4Y5RD 3FM0A 2H6QA 3IJ0A 2OK6A 3EI4A 2XU7A 2PM6B 3OL2B 4J84A 3MZKA 3I7LA 4KFMB 1JMZB 4J73A 2OVPB 3IKOA 3SBPA 5FKQA 1B9XA 4NSXA 5K19A 4CC9A 4R7AB 5HE2B 3PXTD 4A11A 3IIYA 4ZOZA 4X60B 3PVUB 5H1MA 1SQJA 4X61B 4CY1A 1K8KC 3IJCA 5GSAA 2IUQA 1QNIA 2O9KA 4J77A 1XHMA 5TEFA 4J81A 3W15A 2B5MA 4E54A 3FGBA 3OW8A 4A2LA 5TF2A 4A11B 3EU7A 2AGXA 5TEEA 4XYIA 4U7AA 3UVMA 2HJBA 3UVKA 5JWZA 5CYKB 3MZLA 2QC5A 3SFZA 5EALA 4J0WA 5EM2B 2OIZA 4GGAA 4JSNC 1OMWB 4PC0A 2OK4A 2HJ4A 4IA9A 3I7KA 4YVDA 2PM7B 4FA5D 3RLMD 5IJ7E 3K27A 4E5ZB 3MXXA 4HDJA 4TZ4A 1U4CA 2B4EA 2IURA 2HKRA 4CY2A 1TYQC 5FLXg 3CFVA 2P9LC 4FB1D 5THAA 2P9UC 4XYHA 1GP2B 3I7NA 1NR0A 4J78A 1R5MA 5I5JA 2CN2A 3SCYA 3F3PA 4FWWA 3I2NA 1P22A 4ZOVA 5HE1B 3JB9L 3DM0A 5KDOB 1N6FA 2W18A 4A2MA 4O3TB 4ES0A 3SN6B 3A0FA 5C2VB 5HYNB 3SLED 3ULEC 3ZWLB 3JZNA 5H17A 4FA4D 5EMKB 4ERQA 2PM9A 2H6KA 4PBZA 1SHYB 4CI8A 2IWFA 3I8CA 5EMMB 2GNQA 4A0BB 4A08A 4D0KA 5IJ8E 4UI9R 2B5NA 4A09B 3UVLA 4GM8A 1MDAH 3ODTA 3E0CA 3SHFA 3NVQA 4XEIC 2H14A 3B7FA 2HESX 3AL9A 1VYHC 5K1CC 4MK0B 4JT6C 3SXTD 2CO0A 3EWEA 2P9IC 2YBAA 3MMYA 4CZVA 3MKSB 3EI4B 3AFCA 3GREA 4LGNA 2H6NA 3PE7A 4ZOXA 2CE8A 2OVRB 5GMKn 2P9SC 1GG2B 5HE0B 3NVNA 3EI1A 4L3HD 2BBKH 2I0SA 3CFSB 4ERYA 4JT5C 5FKSA 5C9ZB 2H9MA 5AMSA 4AOWA 4L9OA 2H9LA 5EMJB 4A0AA 3I8EA 4E54B 4EWRA 3EI1B 4LG8A 4IMMA 5SXMA 2G99A 4ESGA 1MG3A 4PBYA 2UZYB 4FAND 3IJ1A 2IUPA 4D6VA 2I3SA 1RI6A 4O9DA 5TDHB 4J0XA 5FKRA 1S4UX 2P9PC 4GGCA 3RN1D 5FKTA 3RRMC 2Q7QA 2Z2OA 5FQDA 2AGZA 3BG1A 5I5IA 4CI2A 3SMRA 3UR4A 5HE3B 5IC7A 4K3ID 4J8BA 4A7JA 3AH8B 1PGUA 2HKMA 4CI3A 4GGDA 2OVQB 3JZGA 2PBIB 2XL3A 5IGQA 2CO0C 2GC4A 2H9PA 5IGOA 2AGLA 3SJLD 1A0RB 2YMUA 3K26A 4LG9A 3N0DA 3UVOA 4CI1A 2H68A 4GM9A 4X63B 3I7OA 1B9YA 5FA5B 2GC7A 1NEXB 2QXVA 3L4MD 4I79A 5H14A 1N6DA 4QL1A 2CN3A 3V7DB 3OKYA 4ERZA 3DSMA 3RFHA 1K32A 2G9AA 4QQEA 5EMLB 3I89A 3OKWA 2AQ5A 4OWRA 5EAMA 3KRXB 5C2WB 4GQBB 2YNNA 5HQGA 1YFQA 3OKYB 2PM9B 4GM3A 2IWKA 5I5MA 3OL2A 3EI2A 1XKSA 2YNPA 4J8GA 3V9FA 2J56H 3EG6A 4L1QD 2HYEA 2H9NA 4A08B 4O45A 5IT9g 3VH0A 1JMXB 2MTAH 3VGZA 1ERJA 4H5IA 4BUJC 4ZOYA 4X3EA 4QT8A 4QRJA 2XYIA 3FRXA 4Y7RA 2B5LA 3RN0D 4BL0A 3EI2B 4J79A 3DXMC 4K3JB 4JSVC 4GQ1A 4G56B 2BCJB 4CZXA 3PVWB 4GQ2P 2Z2PA 1OLZA 4O3UB 3C75H 5CYKA 4N14A 5EM2A 5AFU3 2AGWA 4O1QD 3NVXA 3PSCB 3U4YA 5B4WA 4PSWB 3J81g 3PXWD 3J80g 2OJYA 3EMHA 1MG2A 3CIKB 4OZUA 4GMBA 4FA9D 3HFQA 4GZ8A 1Q47A 3F3FA 3MKQA 5CXBA 2CNXA 4A0AB 3C9CA 3L4OD 3DWLC 3RMZD 3IIWA 2P9NC 2UZXB 2TRCB 4BH6A 4E5ZA 2XL2A 2P9KC 5GXIA 3UKRC 2J55H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD2 C;  2J57 G;  5CXB B;  1JJU B;  2YB8 B;  4AEZ A;  3OTT A;  3VA6 A;  3UVN A;  4FA1 D;  4FAV D;  3SWS D;  3DXK C;  2I3T A;  1PEV A;  3JRO A;  4JXM A;  5FXY A;  2I0T A;  2EBS A;  4PXW A;  3SVW D;  4PSX B;  5AJA A;  3V5W B;  3SBR A;  3JZH A;  3F3G A;  2I0R A;  3PSL A;  3BWS A;  2IAA A;  1FWX A;  2H13 A;  3JPX A;  3OKT A;  3AL8 A;  3JAM g;  4Z8L A;  4JSX C;  3I7P A;  4JSP C;  3KRW B;  5A2Q g;  1GOT B;  2HXC A;  4H5J A;  4U1E I;  1U2V C;  3N0E A;  1N6E A;  2YNO A;  1L0Q A;  2CE9 A;  3ORV D;  4J82 A;  3AL8 B;  4PNK B;  1JOF A;  2AH0 A;  1XIP A;  2H47 A;  1GXR A;  3RFG A;  5EAP A;  1TBG A;  5EAR A;  3I7H A;  2AH1 A;  3BG0 A;  4J86 A;  3EI3 A;  5CXC A;  4A0B A;  3RSE C;  2IUV A;  3GFC A;  4L3G D;  2H3X A;  3UKU C;  4CY3 A;  4CZY A;  3JRP A;  4A09 A;  3PXS D;  5GXH A;  4ZN4 A;  1PBY B;  2Z2N A;  3C99 A;  4CY5 A;  3C5M A;  3SBQ A;  3P4F A;  3EI3 B;  2AGY A;  4J87 A;  1SQ9 A;  4FHL A;  1PI6 A;  5CXC B;  4Y5R D;  3FM0 A;  2H6Q A;  3IJ0 A;  2OK6 A;  3EI4 A;  2XU7 A;  2PM6 B;  3OL2 B;  4J84 A;  3MZK A;  3I7L A;  4KFM B;  1JMZ B;  4J73 A;  2OVP B;  3IKO A;  3SBP A;  5FKQ A;  1B9X A;  4NSX A;  5K19 A;  4CC9 A;  4R7A B;  5HE2 B;  3PXT D;  4A11 A;  3IIY A;  4ZOZ A;  4X60 B;  3PVU B;  5H1M A;  1SQJ A;  4X61 B;  4CY1 A;  1K8K C;  3IJC A;  5GSA A;  2IUQ A;  1QNI A;  2O9K A;  4J77 A;  1XHM A;  5TEF A;  4J81 A;  3W15 A;  2B5M A;  4E54 A;  3FGB A;  3OW8 A;  4A2L A;  5TF2 A;  4A11 B;  3EU7 A;  2AGX A;  5TEE A;  4XYI A;  4U7A A;  3UVM A;  2HJB A;  3UVK A;  5JWZ A;  5CYK B;  3MZL A;  2QC5 A;  3SFZ A;  5EAL A;  4J0W A;  5EM2 B;  2OIZ A;  4GGA A;  4JSN C;  1OMW B;  4PC0 A;  2OK4 A;  2HJ4 A;  4IA9 A;  3I7K A;  4YVD A;  2PM7 B;  4FA5 D;  3RLM D;  5IJ7 E;  3K27 A;  4E5Z B;  3MXX A;  4HDJ A;  4TZ4 A;  1U4C A;  2B4E A;  2IUR A;  2HKR A;  4CY2 A;  1TYQ C;  5FLX g;  3CFV A;  2P9L C;  4FB1 D;  5THA A;  2P9U C;  4XYH A;  1GP2 B;  3I7N A;  1NR0 A;  4J78 A;  1R5M A;  5I5J A;  2CN2 A;  3SCY A;  3F3P A;  4FWW A;  3I2N A;  1P22 A;  4ZOV A;  5HE1 B;  3JB9 L;  3DM0 A;  5KDO B;  1N6F A;  2W18 A;  4A2M A;  4O3T B;  4ES0 A;  3SN6 B;  3A0F A;  5C2V B;  5HYN B;  3SLE D;  3ULE C;  3ZWL B;  3JZN A;  5H17 A;  4FA4 D;  5EMK B;  4ERQ A;  2PM9 A;  2H6K A;  4PBZ A;  1SHY B;  4CI8 A;  2IWF A;  3I8C A;  5EMM B;  2GNQ A;  4A0B B;  4A08 A;  4D0K A;  5IJ8 E;  4UI9 R;  2B5N A;  4A09 B;  3UVL A;  4GM8 A;  1MDA H;  3ODT A;  3E0C A;  3SHF A;  3NVQ A;  4XEI C;  2H14 A;  3B7F A;  2HES X;  3AL9 A;  1VYH C;  5K1C C;  4MK0 B;  4JT6 C;  3SXT D;  2CO0 A;  3EWE A;  2P9I C;  2YBA A;  3MMY A;  4CZV A;  3MKS B;  3EI4 B;  3AFC A;  3GRE A;  4LGN A;  2H6N A;  3PE7 A;  4ZOX A;  2CE8 A;  2OVR B;  5GMK n;  2P9S C;  1GG2 B;  5HE0 B;  3NVN A;  3EI1 A;  4L3H D;  2BBK H;  2I0S A;  3CFS B;  4ERY A;  4JT5 C;  5FKS A;  5C9Z B;  2H9M A;  5AMS A;  4AOW A;  4L9O A;  2H9L A;  5EMJ B;  4A0A A;  3I8E A;  4E54 B;  4EWR A;  3EI1 B;  4LG8 A;  4IMM A;  5SXM A;  2G99 A;  4ESG A;  1MG3 A;  4PBY A;  2UZY B;  4FAN D;  3IJ1 A;  2IUP A;  4D6V A;  2I3S A;  1RI6 A;  4O9D A;  5TDH B;  4J0X A;  5FKR A;  1S4U X;  2P9P C;  4GGC A;  3RN1 D;  5FKT A;  3RRM C;  2Q7Q A;  2Z2O A;  5FQD A;  2AGZ A;  3BG1 A;  5I5I A;  4CI2 A;  3SMR A;  3UR4 A;  5HE3 B;  5IC7 A;  4K3I D;  4J8B A;  4A7J A;  3AH8 B;  1PGU A;  2HKM A;  4CI3 A;  4GGD A;  2OVQ B;  3JZG A;  2PBI B;  2XL3 A;  5IGQ A;  2CO0 C;  2GC4 A;  2H9P A;  5IGO A;  2AGL A;  3SJL D;  1A0R B;  2YMU A;  3K26 A;  4LG9 A;  3N0D A;  3UVO A;  4CI1 A;  2H68 A;  4GM9 A;  4X63 B;  3I7O A;  1B9Y A;  5FA5 B;  2GC7 A;  1NEX B;  2QXV A;  3L4M D;  4I79 A;  5H14 A;  1N6D A;  4QL1 A;  2CN3 A;  3V7D B;  3OKY A;  4ERZ A;  3DSM A;  3RFH A;  1K32 A;  2G9A A;  4QQE A;  5EML B;  3I89 A;  3OKW A;  2AQ5 A;  4OWR A;  5EAM A;  3KRX B;  5C2W B;  4GQB B;  2YNN A;  5HQG A;  1YFQ A;  3OKY B;  2PM9 B;  4GM3 A;  2IWK A;  5I5M A;  3OL2 A;  3EI2 A;  1XKS A;  2YNP A;  4J8G A;  3V9F A;  2J56 H;  3EG6 A;  4L1Q D;  2HYE A;  2H9N A;  4A08 B;  4O45 A;  5IT9 g;  3VH0 A;  1JMX B;  2MTA H;  3VGZ A;  1ERJ A;  4H5I A;  4BUJ C;  4ZOY A;  4X3E A;  4QT8 A;  4QRJ A;  2XYI A;  3FRX A;  4Y7R A;  2B5L A;  3RN0 D;  4BL0 A;  3EI2 B;  4J79 A;  3DXM C;  4K3J B;  4JSV C;  4GQ1 A;  4G56 B;  2BCJ B;  4CZX A;  3PVW B;  4GQ2 P;  2Z2P A;  1OLZ A;  4O3U B;  3C75 H;  5CYK A;  4N14 A;  5EM2 A;  5AFU 3;  2AGW A;  4O1Q D;  3NVX A;  3PSC B;  3U4Y A;  5B4W A;  4PSW B;  3J81 g;  3PXW D;  3J80 g;  2OJY A;  3EMH A;  1MG2 A;  3CIK B;  4OZU A;  4GMB A;  4FA9 D;  3HFQ A;  4GZ8 A;  1Q47 A;  3F3F A;  3MKQ A;  5CXB A;  2CNX A;  4A0A B;  3C9C A;  3L4O D;  3DWL C;  3RMZ D;  3IIW A;  2P9N C;  2UZX B;  2TRC B;  4BH6 A;  4E5Z A;  2XL2 A;  2P9K C;  5GXI A;  3UKR C;  2J55 H; 
#chains in the Genus database with same CATH topology
 3K72 A;  4Z7O A;  2VDP A;  3IVM A;  2J57 G;  4JD2 C;  5CXB B;  1JJU B;  2YB8 B;  4AEZ A;  3OTT A;  3GC3 B;  3VA6 A;  3UVN A;  4FA1 D;  4FAV D;  3SWS D;  5C86 A;  3DXK C;  2I3T A;  3GD1 I;  1PEV A;  4BP8 A;  4Z7N A;  3JRO A;  4JXM A;  1H2W A;  1UOO A;  2VDM A;  5FXY A;  2I0T A;  2EBS A;  1UTC A;  4NBM A;  4PXW A;  3SVW D;  4PSX B;  5AJA A;  3V5W B;  3SBR A;  3JZH A;  4MMZ A;  3F3G A;  2I0R A;  3PSL A;  1GOG A;  3BWS A;  1E5T A;  1FWX A;  2BKL A;  2H13 A;  2IAA A;  3JPX A;  3OKT A;  3AL8 A;  3JAM g;  4Z8L A;  4BCB A;  4JSX C;  3NID A;  3I7P A;  4JSP C;  3KRW B;  5A2Q g;  1GOT B;  2HXC A;  4BCD A;  4H5J A;  4U1E I;  1U2V C;  3N0E A;  1N6E A;  2YNO A;  1L0Q A;  1C9L A;  2CE9 A;  3ORV D;  4J82 A;  3AL8 B;  4PNK B;  3NIF A;  5M5R A;  1JOF A;  2AH0 A;  1XIP A;  2H47 A;  1GXR A;  3RFG A;  5EAP A;  1TBG A;  5EAR A;  3DDU A;  2AH1 A;  3I7H A;  3BG0 A;  4J86 A;  1K3I A;  3EI3 A;  1VE7 A;  3IUQ A;  5CXC A;  4A0B A;  3RSE C;  2IUV A;  3GFC A;  4L3G D;  1A12 A;  2H3X A;  3UKU C;  4CY3 A;  4CZY A;  3MUO A;  3JRP A;  4DNU A;  1YR2 A;  4A09 A;  1UOQ A;  3PXS D;  3QHY B;  4ZN4 A;  5GXH A;  1PBY B;  2Z2N A;  4AX4 A;  3C99 A;  4CY5 A;  3C5M A;  3SBQ A;  3P4F A;  1JTD B;  3EI3 B;  2AGY A;  4J87 A;  1SQ9 A;  4FHL A;  1PI6 A;  5CXC B;  2VDN A;  3O4G A;  4Y5R D;  3FM0 A;  2H6Q A;  3IJ0 A;  2OK6 A;  3EI4 A;  3IUM A;  4G1M A;  2XU7 A;  2PM6 B;  3OL2 B;  4J84 A;  3MZK A;  4AN1 A;  3I7L A;  4G55 A;  4KFM B;  1JMZ B;  4J73 A;  2OVP B;  3IKO A;  3SBP A;  5FKQ A;  3IUL A;  1B9X A;  4NSX A;  5K19 A;  4CC9 A;  4R7A B;  5HE2 B;  3PXT D;  4A11 A;  3IIY A;  4ZOZ A;  4X60 B;  4JHP C;  3O4J A;  3PVU B;  5H1M A;  1SQJ A;  4X61 B;  4CY1 A;  1K8K C;  3IJC A;  4NEN A;  4BCC A;  5GSA A;  2IUQ A;  1QNI A;  2O9K A;  4J77 A;  1XHM A;  5TEF A;  4J81 A;  3W15 A;  1BPO A;  2B5M A;  5M5S A;  4E54 A;  3FGB A;  3OW8 A;  3ZE1 A;  4A2L A;  5TF2 A;  4A11 B;  3K6S A;  3EU7 A;  2AGX A;  5TEE A;  4XYI A;  4U7A A;  3UVM A;  2HJB A;  3UVK A;  5JWZ A;  5CYK B;  2JKX A;  3MZL A;  2QC5 A;  3SFZ A;  5EAL A;  4J0W A;  3O4H A;  5EM2 B;  2XDW A;  2OIZ A;  5HDB A;  4GGA A;  4JSN C;  1OMW B;  4PC0 A;  2OK4 A;  2HJ4 A;  4IA9 A;  3I7K A;  1UOP A;  4YVD A;  2PM7 B;  4FA5 D;  2VDQ A;  1O6G A;  3RLM D;  5IJ7 E;  4BP9 A;  3K27 A;  4E5Z B;  3MXX A;  4HDJ A;  4O2W A;  4TZ4 A;  4AN0 A;  1U4C A;  2B4E A;  2IUR A;  2HKR A;  4CY2 A;  2EIC A;  4MMX A;  1TYQ C;  5FLX g;  3CFV A;  5E6S A;  2P9L C;  4FB1 D;  5THA A;  2VDK A;  2P9U C;  4XYH A;  4UM8 A;  5C92 A;  1GP2 B;  3I7N A;  1NR0 A;  4J78 A;  1R5M A;  1H2X A;  4IRZ A;  5I5J A;  2CN2 A;  3SCY A;  3F3P A;  4FWW A;  3I2N A;  1P22 A;  4ZOV A;  3MUN A;  5HE1 B;  3JB9 L;  3DM0 A;  5KDO B;  1N6F A;  2W18 A;  4A2M A;  3VI3 A;  4O3T B;  2XZG A;  3SN6 B;  4ES0 A;  3A0F A;  4AMZ A;  4WK2 A;  5C2V B;  5HYN B;  3SLE D;  3ULE C;  3ZWL B;  3JZN A;  5H17 A;  3EQ8 A;  3O4I A;  4FA4 D;  5EMK B;  4ERQ A;  2PM9 A;  1JV2 A;  2H6K A;  4PBZ A;  1SHY B;  1I2M B;  4CI8 A;  2IWF A;  3I8C A;  5EMM B;  2GNQ A;  4A0B B;  4A08 A;  4D0K A;  5IJ8 E;  4UI9 R;  2B5N A;  4A09 B;  3UVL A;  4GM8 A;  1MDA H;  3ODT A;  3ZE2 A;  3E0C A;  4MMY A;  3SHF A;  3NVQ A;  4XEI C;  2H14 A;  5M61 A;  3B7F A;  2HES X;  3AL9 A;  5E6R A;  1VYH C;  4RE6 A;  5K1C C;  4MK0 B;  4JT6 C;  3SXT D;  3EWE A;  2CO0 A;  2P9I C;  2YBA A;  3MMY A;  4CZV A;  3MKS B;  4DNV A;  3EI4 B;  3AFC A;  1T2X A;  3GRE A;  4NAA A;  4LGN A;  2H6N A;  3PE7 A;  4ZOX A;  2CE8 A;  1C9I A;  2OVR B;  5GMK n;  2P9S C;  1GG2 B;  3KCI A;  5HE0 B;  3NVN A;  3EI1 A;  4L3H D;  2BBK H;  2I0S A;  1QFM A;  3CFS B;  4ERY A;  4JT5 C;  2VDO A;  5FKS A;  4UM9 A;  1TYE A;  2H9M A;  5C9Z B;  5AMS A;  4AOW A;  4L9O A;  2H9L A;  5EMJ B;  4A0A A;  3ZDY A;  1E8N A;  3I8E A;  4E54 B;  4EWR A;  3EI1 B;  4LG8 A;  1H2Z A;  4IMM A;  3V4V A;  5SXM A;  2EIE A;  2G99 A;  1O6F A;  3EQ9 A;  4ESG A;  1M1X A;  1MG3 A;  4PBY A;  2UZY B;  4O02 A;  3VI4 A;  3IUN A;  4FAN D;  3IJ1 A;  2IUP A;  3FCU A;  4WJK A;  2VDL A;  3K71 A;  4D6V A;  2I3S A;  3V4P A;  5FFO A;  1RI6 A;  4O9D A;  5TDH B;  4J0X A;  5FKR A;  1S4U X;  2P9P C;  4GGC A;  3RN1 D;  2EID A;  1VE6 A;  5FKT A;  3MVD K;  3RRM C;  2Q7Q A;  2Z2O A;  5FQD A;  2AGZ A;  3NIG A;  3BG1 A;  5I5I A;  4CI2 A;  3SMR A;  3UR4 A;  5HE3 B;  3T3P A;  5IC7 A;  4K3I D;  4J8B A;  3IUR A;  4A7J A;  3AH8 B;  1PGU A;  2HKM A;  4CI3 A;  4GGD A;  2OVQ B;  3JZG A;  2PBI B;  2XL3 A;  5IGQ A;  2VDR A;  2QZP A;  2CO0 C;  2GC4 A;  3IJE A;  2H9P A;  5IGO A;  2AGL A;  3SJL D;  1A0R B;  2YMU A;  3K26 A;  4LG9 A;  5E6U A;  3N0D A;  3UVO A;  4CI1 A;  4WK4 A;  2H68 A;  4GM9 A;  1VZ2 A;  4X63 B;  3I7O A;  1B9Y A;  5FA5 B;  4G1E A;  2GC7 A;  1NEX B;  2QXV A;  3L4M D;  4I79 A;  5FFG A;  5H14 A;  1N6D A;  4QL1 A;  1L5G A;  2CN3 A;  1GOH A;  3V7D B;  3OF7 A;  3OKY A;  4QAM A;  4ERZ A;  3DSM A;  3RFH A;  1K32 A;  2G9A A;  4QQE A;  5EML B;  3I89 A;  3OKW A;  2AQ5 A;  4NC4 A;  4OWR A;  1QFS A;  5EAM A;  5M5U A;  4L1M A;  3IUJ A;  3QI0 A;  3KRX B;  5C2W B;  4WK0 A;  4GQB B;  2YNN A;  5HQG A;  1YFQ A;  3OKY B;  2PM9 B;  4GM3 A;  1H2Y A;  2IWK A;  3ZE0 A;  5I5M A;  2HU5 A;  3OL2 A;  3EI2 A;  1XKS A;  2YNP A;  4J8G A;  3V9F A;  2J56 H;  3EG6 A;  4L1Q D;  2HYE A;  2H9N A;  4A08 B;  4JHN A;  4O45 A;  5IT9 g;  3VH0 A;  1JMX B;  2MTA H;  3VGZ A;  2XE4 A;  2VZ1 A;  1ERJ A;  4H5I A;  4BUJ C;  4ZOY A;  4X3E A;  4QT8 A;  4QRJ A;  2XYI A;  3FRX A;  4Y7R A;  2B5L A;  3RN0 D;  4BL0 A;  3EI2 B;  4J79 A;  3DXM C;  4K3J B;  4RE5 A;  4JSV C;  3FCS A;  4GQ1 A;  4G56 B;  2BCJ B;  3ZDX A;  3ZDZ A;  5M5V A;  2VC2 A;  2HU8 A;  4CZX A;  3PVW B;  4GQ2 P;  2Z2P A;  1OLZ A;  4D9S A;  4O3U B;  4Z7Q A;  3C75 H;  2EIB A;  5CYK A;  4N14 A;  5EM2 A;  5AFU 3;  2AGW A;  4O1Q D;  3NVX A;  2QR5 A;  3PSC B;  3EQ7 A;  4PSW B;  5B4W A;  3U4Y A;  3J81 g;  3PXW D;  3J80 g;  2OJY A;  2HU7 A;  3EMH A;  1GOF A;  1MG2 A;  3CIK B;  1U8C A;  2VZ3 A;  4GMB A;  4OZU A;  4AMY A;  4FA9 D;  3HFQ A;  4GZ8 A;  1Q47 A;  3F3F A;  3MKQ A;  4DNW A;  5CXB A;  2CNX A;  4A0A B;  3C9C A;  3L4O D;  3T3M A;  3DWL C;  3RMZ D;  3IIW A;  2P9N C;  2UZX B;  2WQ8 A;  1VZ3 A;  2TRC B;  4BH6 A;  5M5T A;  4E5Z A;  2XL2 A;  2P9K C;  5GXI A;  3UKR C;  1E8M A;  2J55 H; 
#chains in the Genus database with same CATH homology
 4JD2 C;  2J57 G;  5CXB B;  1JJU B;  2YB8 B;  4AEZ A;  3OTT A;  3VA6 A;  3UVN A;  4FA1 D;  4FAV D;  3SWS D;  3DXK C;  2I3T A;  1PEV A;  3JRO A;  4JXM A;  5FXY A;  2I0T A;  2EBS A;  4PXW A;  3SVW D;  4PSX B;  5AJA A;  3V5W B;  3SBR A;  3JZH A;  3F3G A;  2I0R A;  3PSL A;  3BWS A;  2IAA A;  1FWX A;  2H13 A;  3JPX A;  3OKT A;  3AL8 A;  3JAM g;  4Z8L A;  4JSX C;  3I7P A;  4JSP C;  3KRW B;  5A2Q g;  1GOT B;  2HXC A;  4H5J A;  4U1E I;  1U2V C;  3N0E A;  1N6E A;  2YNO A;  1L0Q A;  2CE9 A;  3ORV D;  4J82 A;  3AL8 B;  4PNK B;  1JOF A;  2AH0 A;  1XIP A;  2H47 A;  1GXR A;  3RFG A;  5EAP A;  1TBG A;  5EAR A;  3I7H A;  2AH1 A;  3BG0 A;  4J86 A;  3EI3 A;  5CXC A;  4A0B A;  3RSE C;  2IUV A;  3GFC A;  4L3G D;  2H3X A;  3UKU C;  4CY3 A;  4CZY A;  3JRP A;  4A09 A;  3PXS D;  5GXH A;  4ZN4 A;  1PBY B;  2Z2N A;  3C99 A;  4CY5 A;  3C5M A;  3SBQ A;  3P4F A;  3EI3 B;  2AGY A;  4J87 A;  1SQ9 A;  4FHL A;  1PI6 A;  5CXC B;  4Y5R D;  3FM0 A;  2H6Q A;  3IJ0 A;  2OK6 A;  3EI4 A;  2XU7 A;  2PM6 B;  3OL2 B;  4J84 A;  3MZK A;  3I7L A;  4KFM B;  1JMZ B;  4J73 A;  2OVP B;  3IKO A;  3SBP A;  5FKQ A;  1B9X A;  4NSX A;  5K19 A;  4CC9 A;  4R7A B;  5HE2 B;  3PXT D;  4A11 A;  3IIY A;  4ZOZ A;  4X60 B;  3PVU B;  5H1M A;  1SQJ A;  4X61 B;  4CY1 A;  1K8K C;  3IJC A;  5GSA A;  2IUQ A;  1QNI A;  2O9K A;  4J77 A;  1XHM A;  5TEF A;  4J81 A;  3W15 A;  2B5M A;  4E54 A;  3FGB A;  3OW8 A;  4A2L A;  5TF2 A;  4A11 B;  3EU7 A;  2AGX A;  5TEE A;  4XYI A;  4U7A A;  3UVM A;  2HJB A;  3UVK A;  5JWZ A;  5CYK B;  3MZL A;  2QC5 A;  3SFZ A;  5EAL A;  4J0W A;  5EM2 B;  2OIZ A;  4GGA A;  4JSN C;  1OMW B;  4PC0 A;  2OK4 A;  2HJ4 A;  4IA9 A;  3I7K A;  4YVD A;  2PM7 B;  4FA5 D;  3RLM D;  5IJ7 E;  3K27 A;  4E5Z B;  3MXX A;  4HDJ A;  4TZ4 A;  1U4C A;  2B4E A;  2IUR A;  2HKR A;  4CY2 A;  1TYQ C;  5FLX g;  3CFV A;  2P9L C;  4FB1 D;  5THA A;  2P9U C;  4XYH A;  1GP2 B;  3I7N A;  1NR0 A;  4J78 A;  1R5M A;  5I5J A;  2CN2 A;  3SCY A;  3F3P A;  4FWW A;  3I2N A;  1P22 A;  4ZOV A;  5HE1 B;  3JB9 L;  3DM0 A;  5KDO B;  1N6F A;  2W18 A;  4A2M A;  4O3T B;  4ES0 A;  3SN6 B;  3A0F A;  5C2V B;  5HYN B;  3SLE D;  3ULE C;  3ZWL B;  3JZN A;  5H17 A;  4FA4 D;  5EMK B;  4ERQ A;  2PM9 A;  2H6K A;  4PBZ A;  1SHY B;  4CI8 A;  2IWF A;  3I8C A;  5EMM B;  2GNQ A;  4A0B B;  4A08 A;  4D0K A;  5IJ8 E;  4UI9 R;  2B5N A;  4A09 B;  3UVL A;  4GM8 A;  1MDA H;  3ODT A;  3E0C A;  3SHF A;  3NVQ A;  4XEI C;  2H14 A;  3B7F A;  2HES X;  3AL9 A;  1VYH C;  5K1C C;  4MK0 B;  4JT6 C;  3SXT D;  2CO0 A;  3EWE A;  2P9I C;  2YBA A;  3MMY A;  4CZV A;  3MKS B;  3EI4 B;  3AFC A;  3GRE A;  4LGN A;  2H6N A;  3PE7 A;  4ZOX A;  2CE8 A;  2OVR B;  5GMK n;  2P9S C;  1GG2 B;  5HE0 B;  3NVN A;  3EI1 A;  4L3H D;  2BBK H;  2I0S A;  3CFS B;  4ERY A;  4JT5 C;  5FKS A;  5C9Z B;  2H9M A;  5AMS A;  4AOW A;  4L9O A;  2H9L A;  5EMJ B;  4A0A A;  3I8E A;  4E54 B;  4EWR A;  3EI1 B;  4LG8 A;  4IMM A;  5SXM A;  2G99 A;  4ESG A;  1MG3 A;  4PBY A;  2UZY B;  4FAN D;  3IJ1 A;  2IUP A;  4D6V A;  2I3S A;  1RI6 A;  4O9D A;  5TDH B;  4J0X A;  5FKR A;  1S4U X;  2P9P C;  4GGC A;  3RN1 D;  5FKT A;  3RRM C;  2Q7Q A;  2Z2O A;  5FQD A;  2AGZ A;  3BG1 A;  5I5I A;  4CI2 A;  3SMR A;  3UR4 A;  5HE3 B;  5IC7 A;  4K3I D;  4J8B A;  4A7J A;  3AH8 B;  1PGU A;  2HKM A;  4CI3 A;  4GGD A;  2OVQ B;  3JZG A;  2PBI B;  2XL3 A;  5IGQ A;  2CO0 C;  2GC4 A;  2H9P A;  5IGO A;  2AGL A;  3SJL D;  1A0R B;  2YMU A;  3K26 A;  4LG9 A;  3N0D A;  3UVO A;  4CI1 A;  2H68 A;  4GM9 A;  4X63 B;  3I7O A;  1B9Y A;  5FA5 B;  2GC7 A;  1NEX B;  2QXV A;  3L4M D;  4I79 A;  5H14 A;  1N6D A;  4QL1 A;  2CN3 A;  3V7D B;  3OKY A;  4ERZ A;  3DSM A;  3RFH A;  1K32 A;  2G9A A;  4QQE A;  5EML B;  3I89 A;  3OKW A;  2AQ5 A;  4OWR A;  5EAM A;  3KRX B;  5C2W B;  4GQB B;  2YNN A;  5HQG A;  1YFQ A;  3OKY B;  2PM9 B;  4GM3 A;  2IWK A;  5I5M A;  3OL2 A;  3EI2 A;  1XKS A;  2YNP A;  4J8G A;  3V9F A;  2J56 H;  3EG6 A;  4L1Q D;  2HYE A;  2H9N A;  4A08 B;  4O45 A;  5IT9 g;  3VH0 A;  1JMX B;  2MTA H;  3VGZ A;  1ERJ A;  4H5I A;  4BUJ C;  4ZOY A;  4X3E A;  4QT8 A;  4QRJ A;  2XYI A;  3FRX A;  4Y7R A;  2B5L A;  3RN0 D;  4BL0 A;  3EI2 B;  4J79 A;  3DXM C;  4K3J B;  4JSV C;  4GQ1 A;  4G56 B;  2BCJ B;  4CZX A;  3PVW B;  4GQ2 P;  2Z2P A;  1OLZ A;  4O3U B;  3C75 H;  5CYK A;  4N14 A;  5EM2 A;  5AFU 3;  2AGW A;  4O1Q D;  3NVX A;  3PSC B;  3U4Y A;  5B4W A;  4PSW B;  3J81 g;  3PXW D;  3J80 g;  2OJY A;  3EMH A;  1MG2 A;  3CIK B;  4OZU A;  4GMB A;  4FA9 D;  3HFQ A;  4GZ8 A;  1Q47 A;  3F3F A;  3MKQ A;  5CXB A;  2CNX A;  4A0A B;  3C9C A;  3L4O D;  3DWL C;  3RMZ D;  3IIW A;  2P9N C;  2UZX B;  2TRC B;  4BH6 A;  4E5Z A;  2XL2 A;  2P9K C;  5GXI A;  3UKR C;  2J55 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...