3JB9L

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
299
structure length
293
Chain Sequence
PNLQMFGHTAEVLVARFDPSGSYFASGGMDRQILLWNVFDVKNYGVLNGCKGAITDLQWSRDSRVVYCSSSDTHLMSWDAVSGQKIRKHKGHAGVVNALDVLKVSELLTSVSDDCTMKVWDSRSKDCIKTIEEKYPLTAVAIAQQGTQVFIGGIDGAIKIWDLRNNHCSHVLKGHKDIITSLAISKDGSSLLSNSMDNTVRIFDVKAQRQLQIFEGAIHGQEHNLLGVAWSRNSRFVGAGSSDKNVYVWSATGDLRYVLPGHEGSVNHVDFHPHQDIILSCSSDRTIFLGELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 46
structure length 293
sequence length 299
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jb9L00
4HDJA 3UVNA 3B7FA 5EALA 5C9ZB 4H5JA 3CFSB 3ULEC 3P4FA 4XYHA 1PBYB 4QT8A 3RN1D 3DWLC 3EI2B 5KDOB 5CXCA 5HE0B 4A11B 4GGAA 3NVXA 3IJCA 3C99A 5B4WA 2XYIA 3CIKB 3JPXA 4J0WA 3DSMA 4PBZA 2P9KC 4GGDA 2AGXA 5EM2A 3DM0A 4FA9D 4A2MA 4A09B 1MDAH 2AGLA 5HE2B 3SFZA 5GXHA 3MMYA 5FQDA 3ZWLB 4CI1A 1A0RB 4X63B 3UKRC 2CE9A 4JT5C 4JXMA 2OIZA 5IGOA 3SWSD 2AQ5A 4A2LA 5FKTA 1K8KC 3FGBA 1TYQC 4A09A 2GNQA 2P9IC 2H47A 4CY5A 4K3JB 4X60B 3ORVD 3AL9A 3EWEA 2H9PA 3ODTA 2I0RA 2H6NA 1NEXB 3OTTA 3OKWA 4JSNC 4ERYA 5THAA 2HESX 4O9DA 4FB1D 1N6EA 4PSXB 4O1QD 3F3PA 3V9FA 2G99A 3RFGA 4J0XA 2HKMA 5FXYA 2HXCA 3I8CA 5TDHB 2H9MA 1P22A 4CI8A 5AJAA 2OVRB 4ZOVA 4BL0A 3MXXA 1MG3A 3UVMA 4CZXA 4J81A 2OK6A 5C2WB 2P9SC 3PSCB 2IUPA 3IJ0A 2HJ4A 2YMUA 5HQGA 3SJLD 4FA1D 4PXWA 4GZ8A 4J87A 2IUVA 5TEEA 2IWFA 3W15A 5HE3B 4J73A 3IIWA 4Z8LA 3BG1A 4FA4D 5EMJB 3C5MA 2I0SA 5FA5B 3CFVA 1GP2B 2I0TA 5TF2A 3L4OD 1B9XA 5EAMA 2Z2PA 4H5IA 4GQ2P 4E5ZB 4LG9A 4AEZA 4QL1A 3I89A 4PBYA 4ZOXA 2H6QA 4CY3A 3E0CA 2B5NA 4ERQA 1VYHC 4GGCA 5CYKB 2PM9B 4JSVC 4A0BB 1SHYB 2AH1A 1JMZB 4FA5D 4J84A 2IAAA 3F3GA 4R7AB 4A7JA 2PBIB 2J56H 1B9YA 2I3SA 3OKTA 4GMBA 1U4CA 4FWWA 4X3EA 4J78A 2PM9A 3RRMC 4J86A 4L1QD 4A0BA 1MG2A 2QXVA 2I3TA 1PGUA 4GQ1A 3JROA 3EI2A 3SBPA 2H68A 2P9PC 3GFCA 2XU7A 3JZHA 4A11A 4E54B 2CN3A 2H6KA 4LGNA 4MK0B 3FM0A 2TRCB 3I7OA 4PSWB 4ZN4A 1QNIA 4ESGA 3EU7A 3HFQA 5IC7A 5H14A 5HYNB 2CO0C 5EMLB 5IGQA 4OZUA 4EWRA 5GMKn 4OWRA 3KRXB 4X61B 3SCYA 4L3HD 3IJ1A 4QRJA 3C9CA 3MZKA 1OMWB 3AH8B 4CZVA 5I5JA 4Y7RA 3UKUC 3AFCA 4IA9A 3RMZD 3AL8B 4D6VA 5JWZA 4U7AA 3A0FA 1N6FA 2B5LA 2CE8A 2YNOA 3PXTD 3IKOA 3GREA 1PI6A 3KRWB 1Q47A 1SQJA 3PVWB 1GG2B 2BBKH 3VA6A 1FWXA 4JT6C 4G56B 3AL8A 5EMKB 2J57G 4UI9R 3JZGA 4CY2A 3MKSB 4BH6A 1GXRA 2H3XA 3K26A 4ZOYA 2CN2A 3UVLA 3J80g 3VGZA 2OVQB 1N6DA 3DXKC 4J79A 1U2VC 2OVPB 3UR4A 4J77A 4ES0A 3RN0D 4QQEA 4PNKB 2G9AA 3PE7A 1OLZA 3K27A 4ERZA 3EI3B 5H17A 4CI3A 5CXBB 1YFQA 3FRXA 3I2NA 5FKRA 2AH0A 2H9NA 3SN6B 4IMMA 5EARA 5GSAA 4J82A 2O9KA 3MKQA 3I7HA 2Z2OA 3IIYA 4L3GD 2AGZA 2YBAA 3RSEC 5AMSA 4E5ZA 1RI6A 1JJUB 4K3ID 3EI3A 5I5IA 1JMXB 2CO0A 4JSXC 5CXBA 2P9LC 5A2Qg 1L0QA 4XEIC 2H14A 3I8EA 5CYKA 5EM2B 3BG0A 4CI2A 3OW8A 2HYEA 3MZLA 3F3FA 1K32A 2YB8B 5HE1B 5IT9g 3SBRA 4CY1A 4O45A 4NSXA 2H13A 1SQ9A 3N0EA 3PVUB 3OKYB 3SVWD 2YNPA 4Y5RD 4L9OA 4LG8A 2XL3A 4A08B 2UZYB 3EG6A 1JOFA 4GM3A 2HJBA 3N0DA 4N14A 3JRPA 3I7PA 4E54A 2PM6B 3DXMC 2H9LA 5FKQA 1XKSA 3OL2B 2GC7A 3I7LA 4J8BA 3OKYA 3J81g 3EI4B 4BUJC 3SBQA 5H1MA 2J55H 2AGYA 3NVQA 4A08A 3V7DB 2OJYA 3SMRA 2MTAH 4I79A 2YNNA 3EI1B 4JD2C 4TZ4A 1TBGA 3I7NA 3VH0A 2BCJB 3UVOA 5EMMB 3U4YA 3OL2A 4U1EI 4GM8A 4O3TB 2Q7QA 3PXWD 5AFU3 4GQBB 3EI4A 4A0AB 3PSLA 2HKRA 5GXIA 5TEFA 4CZYA 3JZNA 2UZXB 1XHMA 3SLED 3RLMD 3EI1A 3JB9L 4AOWA 3UVKA 2B5MA 5K19A 3BWSA 3RFHA 5FLXg 4GM9A 1S4UX 4A0AA 3I7KA 2B4EA 4KFMB 4XYIA 3V5WB 2IWKA 4PC0A 5C2VB 1R5MA 2PM7B 4FHLA 4O3UB 3SXTD 2Z2NA 4FAND 1GOTB 4D0KA 1ERJA 1XIPA 3C75H 3JAMg 2OK4A 2AGWA 2QC5A 2XL2A 2W18A 4FAVD 3L4MD 2IUQA 2P9UC 2EBSA 2P9NC 5EAPA 3NVNA 2IURA 4JSPC 1NR0A 5I5MA 5SXMA 2CNXA 4YVDA 4ZOZA 5K1CC 4CC9A 5IJ7E 3PXSD 5CXCB 1PEVA 3SHFA 4J8GA 2GC4A 3EMHA 5FKSA 5IJ8E
chains in the Genus database with same CATH superfamily
4HDJA 3UVNA 3B7FA 5EALA 3FCSA 5C9ZB 4H5JA 3CFSB 3ULEC 3P4FA 5M5SA 4XYHA 1PBYB 4QT8A 3RN1D 3DWLC 3IUMA 3EI2B 5KDOB 5CXCA 5HE0B 2EICA 4A11B 4GGAA 3NVXA 3MUOA 3IJCA 3C99A 5B4WA 2XYIA 3CIKB 3JPXA 2VDKA 4J0WA 3DSMA 4PBZA 2P9KC 4GGDA 2AGXA 5EM2A 3DM0A 1UOPA 4FA9D 4A2MA 2EIBA 4UM9A 3O4HA 4A09B 1MDAH 2AGLA 5HE2B 3SFZA 1VE7A 5GXHA 3MMYA 5FQDA 3ZWLB 5M61A 4CI1A 1A0RB 4X63B 3UKRC 2CE9A 4JT5C 4G1EA 4JXMA 2OIZA 5IGOA 1QFSA 3SWSD 2AQ5A 4A2LA 5FKTA 1K8KC 3FGBA 4Z7OA 1TYQC 4A09A 2GNQA 2P9IC 2H47A 4CY5A 4K3JB 4X60B 3ORVD 3AL9A 3EWEA 2H9PA 3ODTA 2I0RA 2H6NA 1NEXB 3OTTA 4NENA 4AN0A 3OKWA 4AMYA 3IJEA 4JSNC 4G1MA 3GC3B 4ERYA 5THAA 2HESX 4O9DA 4FB1D 3V4PA 1N6EA 4O02A 4PSXB 4O1QD 3F3PA 3V9FA 2G99A 3RFGA 4J0XA 2HKMA 5FXYA 5C92A 4BP8A 5E6SA 2HXCA 5M5TA 3I8CA 5TDHB 5M5UA 2H9MA 1P22A 4CI8A 5AJAA 2OVRB 4UM8A 4ZOVA 4BL0A 1UTCA 3MXXA 1MG3A 4DNUA 3UVMA 4CZXA 4J81A 2OK6A 5C2WB 2P9SC 1T2XA 3PSCB 2IUPA 3IJ0A 2HJ4A 2YMUA 1UOQA 5HQGA 3VI3A 3SJLD 3EQ8A 4FA1D 4PXWA 1I2MB 4GZ8A 3IULA 4JHNA 4J87A 4MMXA 2IUVA 3IUQA 5TEEA 2IWFA 3W15A 5HE3B 4J73A 3IIWA 4Z8LA 3BG1A 4FA4D 5EMJB 3NIFA 3EQ7A 3C5MA 2I0SA 5FA5B 3CFVA 1JTDB 1GP2B 2I0TA 5TF2A 3L4OD 1B9XA 5EAMA 2Z2PA 4H5IA 4GQ2P 4WJKA 2BKLA 4E5ZB 1E8NA 3IVMA 4LG9A 4AEZA 5FFGA 4QL1A 3I89A 4PBYA 4ZOXA 2QZPA 4MMZA 2H6QA 4CY3A 4MMYA 3E0CA 2B5NA 4ERQA 1VYHC 4GGCA 5CYKB 2PM9B 4JSVC 4A0BB 1SHYB 2AH1A 1JMZB 1H2XA 4FA5D 4J84A 2IAAA 3O4IA 3F3GA 4DNVA 4R7AB 4A7JA 3QI0A 2PBIB 2J56H 1B9YA 2I3SA 3OKTA 4GMBA 4O2WA 5E6UA 1U4CA 4FWWA 2QR5A 4X3EA 4J78A 5C86A 2PM9A 3RRMC 4J86A 4L1QD 4A0BA 1MG2A 2QXVA 4D9SA 2I3TA 1PGUA 4GQ1A 3JROA 3EI2A 3SBPA 2H68A 2P9PC 3GFCA 2XU7A 3JZHA 4A11A 4G55A 4E54B 2CN3A 2H6KA 4LGNA 3NIGA 4MK0B 4NC4A 3FM0A 2TRCB 1VZ2A 3I7OA 4PSWB 4ZN4A 1QNIA 2XZGA 4ESGA 3EU7A 3HFQA 5IC7A 5H14A 5HYNB 2CO0C 5EMLB 1GOHA 5IGQA 2VDPA 4OZUA 4EWRA 5GMKn 4OWRA 3K6SA 3KRXB 4X61B 4BCDA 3SCYA 4L3HD 3IJ1A 4QRJA 1K3IA 3C9CA 3MZKA 1OMWB 3AH8B 4CZVA 3IUNA 4WK4A 5I5JA 4Y7RA 3UKUC 3AFCA 4IA9A 3RMZD 3AL8B 4D6VA 5JWZA 4U7AA 3A0FA 1N6FA 2B5LA 2CE8A 2YNOA 3PXTD 4NAAA 3IKOA 3T3MA 3GREA 1PI6A 3ZE1A 3ZDXA 3KRWB 1Q47A 1SQJA 3PVWB 1GG2B 2BBKH 3VA6A 1FWXA 4JT6C 4G56B 3AL8A 5EMKB 3V4VA 2J57G 4UI9R 3JZGA 5HDBA 4CY2A 3MKSB 4BH6A 1GXRA 2H3XA 3K26A 4RE5A 5FFOA 4ZOYA 4BCCA 2CN2A 3UVLA 2VDLA 3J80g 3VGZA 2OVQB 1N6DA 3DXKC 2WQ8A 4AMZA 4J79A 1U2VC 2OVPB 3UR4A 4J77A 4ES0A 3RN0D 3ZDZA 3KCIA 4QQEA 2VC2A 4PNKB 2G9AA 2VDNA 3PE7A 1OLZA 3K27A 4ERZA 3EI3B 5H17A 4CI3A 5CXBB 1YFQA 3FRXA 3I2NA 5FKRA 2AH0A 4RE6A 2H9NA 3SN6B 4IMMA 3K71A 5EARA 5GSAA 4J82A 2O9KA 1UOOA 3MKQA 3IURA 3I7HA 2Z2OA 3IIYA 4L3GD 2AGZA 2YBAA 3DDUA 3RSEC 2XDWA 5AMSA 5M5RA 4BCBA 4E5ZA 1RI6A 1VZ3A 1QFMA 3IUJA 1JJUB 4K3ID 3EI3A 5I5IA 4BP9A 1JMXB 4AX4A 2CO0A 3NIDA 4JSXC 5CXBA 4Z7QA 2P9LC 5A2Qg 1L0QA 1H2YA 4XEIC 4Z7NA 2H14A 3I8EA 5CYKA 5EM2B 3BG0A 2VDOA 4CI2A 3OW8A 2HYEA 3MZLA 1C9LA 3F3FA 1K32A 2YB8B 5HE1B 1VE6A 2HU8A 5IT9g 2JKXA 3SBRA 4CY1A 4O45A 4NSXA 2H13A 1E5TA 4QAMA 1SQ9A 3N0EA 3PVUB 3QHYB 3OKYB 2XE4A 3SVWD 2YNPA 4Y5RD 3VI4A 4L9OA 4LG8A 2XL3A 4A08B 2UZYB 3EG6A 1JOFA 4GM3A 3K72A 1BPOA 2HJBA 1A12A 3N0DA 4N14A 3JRPA 3O4GA 1U8CA 3I7PA 4E54A 2PM6B 3DXMC 2H9LA 5E6RA 5FKQA 1XKSA 3OL2B 2GC7A 3I7LA 4J8BA 3OKYA 3J81g 3EI4B 4BUJC 3SBQA 5H1MA 2J55H 2AGYA 3NVQA 4L1MA 2HU7A 3ZE0A 4A08A 2VDRA 3V7DB 2OJYA 3SMRA 2MTAH 4I79A 2YNNA 3EI1B 1YR2A 4JD2C 4TZ4A 1TBGA 1JV2A 3OF7A 3I7NA 3VH0A 2BCJB 3O4JA 4IRZA 1E8MA 3UVOA 5EMMB 3U4YA 2HU5A 4AN1A 3OL2A 3FCUA 4U1EI 4GM8A 4O3TB 2Q7QA 3PXWD 5AFU3 5M5VA 4GQBB 3EI4A 4A0AB 4NBMA 3PSLA 1O6GA 2HKRA 4JHPC 5GXIA 5TEFA 4CZYA 3JZNA 2UZXB 4WK0A 3T3PA 1XHMA 3SLED 3RLMD 3EI1A 3JB9L 3EQ9A 4AOWA 3UVKA 2B5MA 3ZE2A 5K19A 1C9IA 3BWSA 3RFHA 5FLXg 1M1XA 4GM9A 1S4UX 4A0AA 3I7KA 2B4EA 2VZ1A 4KFMB 4WK2A 4XYIA 3V5WB 1H2WA 2IWKA 4PC0A 5C2VB 3MUNA 1R5MA 2VDMA 2PM7B 4FHLA 2EIEA 1GOGA 3GD1I 2EIDA 4O3UB 2Z2NA 3SXTD 4FAND 1GOTB 3MVDK 4D0KA 1ERJA 1XIPA 3C75H 1TYEA 2OK4A 3JAMg 2AGWA 2QC5A 2XL2A 2W18A 4FAVD 3L4MD 2IUQA 2P9UC 2EBSA 2P9NC 5EAPA 3NVNA 2IURA 1H2ZA 4JSPC 1NR0A 5I5MA 5SXMA 2CNXA 1L5GA 4YVDA 4ZOZA 5K1CC 2VDQA 4CC9A 3ZDYA 3PXSD 5CXCB 5IJ7E 1PEVA 3SHFA 4J8GA 1O6FA 4DNWA 1GOFA 2GC4A 3EMHA 5FKSA 5IJ8E 2VZ3A
chains in the Genus database with same CATH topology
4HDJA 3UVNA 3B7FA 5EALA 5C9ZB 4H5JA 3CFSB 3ULEC 3P4FA 4XYHA 1PBYB 4QT8A 3RN1D 3DWLC 3EI2B 5KDOB 5CXCA 5HE0B 4A11B 4GGAA 3NVXA 3IJCA 3C99A 5B4WA 2XYIA 3CIKB 3JPXA 4J0WA 3DSMA 4PBZA 2P9KC 4GGDA 2AGXA 5EM2A 3DM0A 4FA9D 4A2MA 4A09B 1MDAH 2AGLA 5HE2B 3SFZA 5GXHA 3MMYA 5FQDA 3ZWLB 4CI1A 1A0RB 4X63B 3UKRC 2CE9A 4JT5C 4JXMA 2OIZA 5IGOA 3SWSD 2AQ5A 4A2LA 5FKTA 1K8KC 3FGBA 1TYQC 4A09A 2GNQA 2P9IC 2H47A 4CY5A 4K3JB 4X60B 3ORVD 3AL9A 3EWEA 2H9PA 3ODTA 2I0RA 2H6NA 1NEXB 3OTTA 3OKWA 4JSNC 4ERYA 5THAA 2HESX 4O9DA 4FB1D 1N6EA 4PSXB 4O1QD 3F3PA 3V9FA 2G99A 3RFGA 4J0XA 2HKMA 5FXYA 2HXCA 3I8CA 5TDHB 2H9MA 1P22A 4CI8A 5AJAA 2OVRB 4ZOVA 4BL0A 3MXXA 1MG3A 3UVMA 4CZXA 4J81A 2OK6A 5C2WB 2P9SC 3PSCB 2IUPA 3IJ0A 2HJ4A 2YMUA 5HQGA 3SJLD 4FA1D 4PXWA 4GZ8A 4J87A 2IUVA 5TEEA 2IWFA 3W15A 5HE3B 4J73A 3IIWA 4Z8LA 3BG1A 4FA4D 5EMJB 3C5MA 2I0SA 5FA5B 3CFVA 1GP2B 2I0TA 5TF2A 3L4OD 1B9XA 5EAMA 2Z2PA 4H5IA 4GQ2P 4E5ZB 4LG9A 4AEZA 4QL1A 3I89A 4PBYA 4ZOXA 2H6QA 4CY3A 3E0CA 2B5NA 4ERQA 1VYHC 4GGCA 5CYKB 2PM9B 4JSVC 4A0BB 1SHYB 2AH1A 1JMZB 4FA5D 4J84A 2IAAA 3F3GA 4R7AB 4A7JA 2PBIB 2J56H 1B9YA 2I3SA 3OKTA 4GMBA 1U4CA 4FWWA 4X3EA 4J78A 2PM9A 3RRMC 4J86A 4L1QD 4A0BA 1MG2A 2QXVA 2I3TA 1PGUA 4GQ1A 3JROA 3EI2A 3SBPA 2H68A 2P9PC 3GFCA 2XU7A 3JZHA 4A11A 4E54B 2CN3A 2H6KA 4LGNA 4MK0B 3FM0A 2TRCB 3I7OA 4PSWB 4ZN4A 1QNIA 4ESGA 3EU7A 3HFQA 5IC7A 5H14A 5HYNB 2CO0C 5EMLB 5IGQA 4OZUA 4EWRA 5GMKn 4OWRA 3KRXB 4X61B 3SCYA 4L3HD 3IJ1A 4QRJA 3C9CA 3MZKA 1OMWB 3AH8B 4CZVA 5I5JA 4Y7RA 3UKUC 3AFCA 4IA9A 3RMZD 3AL8B 4D6VA 5JWZA 4U7AA 3A0FA 1N6FA 2B5LA 2CE8A 2YNOA 3PXTD 3IKOA 3GREA 1PI6A 3KRWB 1Q47A 1SQJA 3PVWB 1GG2B 2BBKH 3VA6A 1FWXA 4JT6C 4G56B 3AL8A 5EMKB 2J57G 4UI9R 3JZGA 4CY2A 3MKSB 4BH6A 1GXRA 2H3XA 3K26A 4ZOYA 2CN2A 3UVLA 3J80g 3VGZA 2OVQB 1N6DA 3DXKC 4J79A 1U2VC 2OVPB 3UR4A 4J77A 4ES0A 3RN0D 4QQEA 4PNKB 2G9AA 3PE7A 1OLZA 3K27A 4ERZA 3EI3B 5H17A 4CI3A 5CXBB 1YFQA 3FRXA 3I2NA 5FKRA 2AH0A 2H9NA 3SN6B 4IMMA 5EARA 5GSAA 4J82A 2O9KA 3MKQA 3I7HA 2Z2OA 3IIYA 4L3GD 2AGZA 2YBAA 3RSEC 5AMSA 4E5ZA 1RI6A 1JJUB 4K3ID 3EI3A 5I5IA 1JMXB 2CO0A 4JSXC 5CXBA 2P9LC 5A2Qg 1L0QA 4XEIC 2H14A 3I8EA 5CYKA 5EM2B 3BG0A 4CI2A 3OW8A 2HYEA 3MZLA 3F3FA 1K32A 2YB8B 5HE1B 5IT9g 3SBRA 4CY1A 4O45A 4NSXA 2H13A 1SQ9A 3N0EA 3PVUB 3OKYB 3SVWD 2YNPA 4Y5RD 4L9OA 4LG8A 2XL3A 4A08B 2UZYB 3EG6A 1JOFA 4GM3A 2HJBA 3N0DA 4N14A 3JRPA 3I7PA 4E54A 2PM6B 3DXMC 2H9LA 5FKQA 1XKSA 3OL2B 2GC7A 3I7LA 4J8BA 3OKYA 3J81g 3EI4B 4BUJC 3SBQA 5H1MA 2J55H 2AGYA 3NVQA 4A08A 3V7DB 2OJYA 3SMRA 2MTAH 4I79A 2YNNA 3EI1B 4JD2C 4TZ4A 1TBGA 3I7NA 3VH0A 2BCJB 3UVOA 5EMMB 3U4YA 3OL2A 4U1EI 4GM8A 4O3TB 2Q7QA 3PXWD 5AFU3 4GQBB 3EI4A 4A0AB 3PSLA 2HKRA 5GXIA 5TEFA 4CZYA 3JZNA 2UZXB 1XHMA 3SLED 3RLMD 3EI1A 3JB9L 4AOWA 3UVKA 2B5MA 5K19A 3BWSA 3RFHA 5FLXg 4GM9A 1S4UX 4A0AA 3I7KA 2B4EA 4KFMB 4XYIA 3V5WB 2IWKA 4PC0A 5C2VB 1R5MA 2PM7B 4FHLA 4O3UB 3SXTD 2Z2NA 4FAND 1GOTB 4D0KA 1ERJA 1XIPA 3C75H 3JAMg 2OK4A 2AGWA 2QC5A 2XL2A 2W18A 4FAVD 3L4MD 2IUQA 2P9UC 2EBSA 2P9NC 5EAPA 3NVNA 2IURA 4JSPC 1NR0A 5I5MA 5SXMA 2CNXA 4YVDA 4ZOZA 5K1CC 4CC9A 5IJ7E 3PXSD 5CXCB 1PEVA 3SHFA 4J8GA 2GC4A 3EMHA 5FKSA 5IJ8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDJ A;  3UVN A;  3B7F A;  5EAL A;  5C9Z B;  4H5J A;  3CFS B;  3ULE C;  3P4F A;  4XYH A;  1PBY B;  4QT8 A;  3RN1 D;  3DWL C;  3EI2 B;  5KDO B;  5CXC A;  5HE0 B;  4A11 B;  4GGA A;  3NVX A;  3IJC A;  3C99 A;  5B4W A;  2XYI A;  3CIK B;  3JPX A;  4J0W A;  3DSM A;  4PBZ A;  2P9K C;  4GGD A;  2AGX A;  5EM2 A;  3DM0 A;  4FA9 D;  4A2M A;  4A09 B;  1MDA H;  2AGL A;  5HE2 B;  3SFZ A;  5GXH A;  3MMY A;  5FQD A;  3ZWL B;  4CI1 A;  1A0R B;  4X63 B;  3UKR C;  2CE9 A;  4JT5 C;  4JXM A;  2OIZ A;  5IGO A;  3SWS D;  2AQ5 A;  4A2L A;  5FKT A;  1K8K C;  3FGB A;  1TYQ C;  4A09 A;  2GNQ A;  2P9I C;  2H47 A;  4CY5 A;  4K3J B;  4X60 B;  3ORV D;  3AL9 A;  3EWE A;  2H9P A;  3ODT A;  2I0R A;  2H6N A;  1NEX B;  3OTT A;  3OKW A;  4JSN C;  4ERY A;  5THA A;  2HES X;  4O9D A;  4FB1 D;  1N6E A;  4PSX B;  4O1Q D;  3F3P A;  3V9F A;  2G99 A;  3RFG A;  4J0X A;  2HKM A;  5FXY A;  2HXC A;  3I8C A;  5TDH B;  2H9M A;  1P22 A;  4CI8 A;  5AJA A;  2OVR B;  4ZOV A;  4BL0 A;  3MXX A;  1MG3 A;  3UVM A;  4CZX A;  4J81 A;  2OK6 A;  5C2W B;  2P9S C;  3PSC B;  2IUP A;  3IJ0 A;  2HJ4 A;  2YMU A;  5HQG A;  3SJL D;  4FA1 D;  4PXW A;  4GZ8 A;  4J87 A;  2IUV A;  5TEE A;  2IWF A;  3W15 A;  5HE3 B;  4J73 A;  3IIW A;  4Z8L A;  3BG1 A;  4FA4 D;  5EMJ B;  3C5M A;  2I0S A;  5FA5 B;  3CFV A;  1GP2 B;  2I0T A;  5TF2 A;  3L4O D;  1B9X A;  5EAM A;  2Z2P A;  4H5I A;  4GQ2 P;  4E5Z B;  4LG9 A;  4AEZ A;  4QL1 A;  3I89 A;  4PBY A;  4ZOX A;  2H6Q A;  4CY3 A;  3E0C A;  2B5N A;  4ERQ A;  1VYH C;  4GGC A;  5CYK B;  2PM9 B;  4JSV C;  4A0B B;  1SHY B;  2AH1 A;  1JMZ B;  4FA5 D;  4J84 A;  2IAA A;  3F3G A;  4R7A B;  4A7J A;  2PBI B;  2J56 H;  1B9Y A;  2I3S A;  3OKT A;  4GMB A;  1U4C A;  4FWW A;  4X3E A;  4J78 A;  2PM9 A;  3RRM C;  4J86 A;  4L1Q D;  4A0B A;  1MG2 A;  2QXV A;  2I3T A;  1PGU A;  4GQ1 A;  3JRO A;  3EI2 A;  3SBP A;  2H68 A;  2P9P C;  3GFC A;  2XU7 A;  3JZH A;  4A11 A;  4E54 B;  2CN3 A;  2H6K A;  4LGN A;  4MK0 B;  3FM0 A;  2TRC B;  3I7O A;  4PSW B;  4ZN4 A;  1QNI A;  4ESG A;  3EU7 A;  3HFQ A;  5IC7 A;  5H14 A;  5HYN B;  2CO0 C;  5EML B;  5IGQ A;  4OZU A;  4EWR A;  5GMK n;  4OWR A;  3KRX B;  4X61 B;  3SCY A;  4L3H D;  3IJ1 A;  4QRJ A;  3C9C A;  3MZK A;  1OMW B;  3AH8 B;  4CZV A;  5I5J A;  4Y7R A;  3UKU C;  3AFC A;  4IA9 A;  3RMZ D;  3AL8 B;  4D6V A;  5JWZ A;  4U7A A;  3A0F A;  1N6F A;  2B5L A;  2CE8 A;  2YNO A;  3PXT D;  3IKO A;  3GRE A;  1PI6 A;  3KRW B;  1Q47 A;  1SQJ A;  3PVW B;  1GG2 B;  2BBK H;  3VA6 A;  1FWX A;  4JT6 C;  4G56 B;  3AL8 A;  5EMK B;  2J57 G;  4UI9 R;  3JZG A;  4CY2 A;  3MKS B;  4BH6 A;  1GXR A;  2H3X A;  3K26 A;  4ZOY A;  2CN2 A;  3UVL A;  3J80 g;  3VGZ A;  2OVQ B;  1N6D A;  3DXK C;  4J79 A;  1U2V C;  2OVP B;  3UR4 A;  4J77 A;  4ES0 A;  3RN0 D;  4QQE A;  4PNK B;  2G9A A;  3PE7 A;  1OLZ A;  3K27 A;  4ERZ A;  3EI3 B;  5H17 A;  4CI3 A;  5CXB B;  1YFQ A;  3FRX A;  3I2N A;  5FKR A;  2AH0 A;  2H9N A;  3SN6 B;  4IMM A;  5EAR A;  5GSA A;  4J82 A;  2O9K A;  3MKQ A;  3I7H A;  2Z2O A;  3IIY A;  4L3G D;  2AGZ A;  2YBA A;  3RSE C;  5AMS A;  4E5Z A;  1RI6 A;  1JJU B;  4K3I D;  3EI3 A;  5I5I A;  1JMX B;  2CO0 A;  4JSX C;  5CXB A;  2P9L C;  5A2Q g;  1L0Q A;  4XEI C;  2H14 A;  3I8E A;  5CYK A;  5EM2 B;  3BG0 A;  4CI2 A;  3OW8 A;  2HYE A;  3MZL A;  3F3F A;  1K32 A;  2YB8 B;  5HE1 B;  5IT9 g;  3SBR A;  4CY1 A;  4O45 A;  4NSX A;  2H13 A;  1SQ9 A;  3N0E A;  3PVU B;  3OKY B;  3SVW D;  2YNP A;  4Y5R D;  4L9O A;  4LG8 A;  2XL3 A;  4A08 B;  2UZY B;  3EG6 A;  1JOF A;  4GM3 A;  2HJB A;  3N0D A;  4N14 A;  3JRP A;  3I7P A;  4E54 A;  2PM6 B;  3DXM C;  2H9L A;  5FKQ A;  1XKS A;  3OL2 B;  2GC7 A;  3I7L A;  4J8B A;  3OKY A;  3J81 g;  3EI4 B;  4BUJ C;  3SBQ A;  5H1M A;  2J55 H;  2AGY A;  3NVQ A;  4A08 A;  3V7D B;  2OJY A;  3SMR A;  2MTA H;  4I79 A;  2YNN A;  3EI1 B;  4JD2 C;  4TZ4 A;  1TBG A;  3I7N A;  3VH0 A;  2BCJ B;  3UVO A;  5EMM B;  3U4Y A;  3OL2 A;  4U1E I;  4GM8 A;  4O3T B;  2Q7Q A;  3PXW D;  5AFU 3;  4GQB B;  3EI4 A;  4A0A B;  3PSL A;  2HKR A;  5GXI A;  5TEF A;  4CZY A;  3JZN A;  2UZX B;  1XHM A;  3SLE D;  3RLM D;  3EI1 A;  3JB9 L;  4AOW A;  3UVK A;  2B5M A;  5K19 A;  3BWS A;  3RFH A;  5FLX g;  4GM9 A;  1S4U X;  4A0A A;  3I7K A;  2B4E A;  4KFM B;  4XYI A;  3V5W B;  2IWK A;  4PC0 A;  5C2V B;  1R5M A;  2PM7 B;  4FHL A;  4O3U B;  3SXT D;  2Z2N A;  4FAN D;  1GOT B;  4D0K A;  1ERJ A;  1XIP A;  3C75 H;  3JAM g;  2OK4 A;  2AGW A;  2QC5 A;  2XL2 A;  2W18 A;  4FAV D;  3L4M D;  2IUQ A;  2P9U C;  2EBS A;  2P9N C;  5EAP A;  3NVN A;  2IUR A;  4JSP C;  1NR0 A;  5I5M A;  5SXM A;  2CNX A;  4YVD A;  4ZOZ A;  5K1C C;  4CC9 A;  5IJ7 E;  3PXS D;  5CXC B;  1PEV A;  3SHF A;  4J8G A;  2GC4 A;  3EMH A;  5FKS A;  5IJ8 E; 
#chains in the Genus database with same CATH topology
 4HDJ A;  3UVN A;  3B7F A;  5EAL A;  3FCS A;  5C9Z B;  4H5J A;  3CFS B;  3ULE C;  3P4F A;  5M5S A;  4XYH A;  1PBY B;  4QT8 A;  3RN1 D;  3DWL C;  3IUM A;  3EI2 B;  5KDO B;  5CXC A;  5HE0 B;  2EIC A;  4A11 B;  4GGA A;  3NVX A;  3MUO A;  3IJC A;  3C99 A;  5B4W A;  2XYI A;  3CIK B;  3JPX A;  2VDK A;  4J0W A;  3DSM A;  4PBZ A;  2P9K C;  4GGD A;  2AGX A;  5EM2 A;  3DM0 A;  1UOP A;  4FA9 D;  4A2M A;  2EIB A;  4UM9 A;  3O4H A;  4A09 B;  1MDA H;  2AGL A;  5HE2 B;  3SFZ A;  1VE7 A;  5GXH A;  3MMY A;  5FQD A;  3ZWL B;  5M61 A;  4CI1 A;  1A0R B;  4X63 B;  3UKR C;  2CE9 A;  4JT5 C;  4G1E A;  4JXM A;  2OIZ A;  5IGO A;  1QFS A;  3SWS D;  2AQ5 A;  4A2L A;  5FKT A;  1K8K C;  3FGB A;  4Z7O A;  1TYQ C;  4A09 A;  2GNQ A;  2P9I C;  2H47 A;  4CY5 A;  4K3J B;  4X60 B;  3ORV D;  3AL9 A;  3EWE A;  2H9P A;  3ODT A;  2I0R A;  2H6N A;  1NEX B;  3OTT A;  4NEN A;  4AN0 A;  3OKW A;  4AMY A;  3IJE A;  4JSN C;  4G1M A;  3GC3 B;  4ERY A;  5THA A;  2HES X;  4O9D A;  4FB1 D;  3V4P A;  1N6E A;  4O02 A;  4PSX B;  4O1Q D;  3F3P A;  3V9F A;  2G99 A;  3RFG A;  4J0X A;  2HKM A;  5FXY A;  5C92 A;  4BP8 A;  5E6S A;  2HXC A;  5M5T A;  3I8C A;  5TDH B;  5M5U A;  2H9M A;  1P22 A;  4CI8 A;  5AJA A;  2OVR B;  4UM8 A;  4ZOV A;  4BL0 A;  1UTC A;  3MXX A;  1MG3 A;  4DNU A;  3UVM A;  4CZX A;  4J81 A;  2OK6 A;  5C2W B;  2P9S C;  1T2X A;  3PSC B;  2IUP A;  3IJ0 A;  2HJ4 A;  2YMU A;  1UOQ A;  5HQG A;  3VI3 A;  3SJL D;  3EQ8 A;  4FA1 D;  4PXW A;  1I2M B;  4GZ8 A;  3IUL A;  4JHN A;  4J87 A;  4MMX A;  2IUV A;  3IUQ A;  5TEE A;  2IWF A;  3W15 A;  5HE3 B;  4J73 A;  3IIW A;  4Z8L A;  3BG1 A;  4FA4 D;  5EMJ B;  3NIF A;  3EQ7 A;  3C5M A;  2I0S A;  5FA5 B;  3CFV A;  1JTD B;  1GP2 B;  2I0T A;  5TF2 A;  3L4O D;  1B9X A;  5EAM A;  2Z2P A;  4H5I A;  4GQ2 P;  4WJK A;  2BKL A;  4E5Z B;  1E8N A;  3IVM A;  4LG9 A;  4AEZ A;  5FFG A;  4QL1 A;  3I89 A;  4PBY A;  4ZOX A;  2QZP A;  4MMZ A;  2H6Q A;  4CY3 A;  4MMY A;  3E0C A;  2B5N A;  4ERQ A;  1VYH C;  4GGC A;  5CYK B;  2PM9 B;  4JSV C;  4A0B B;  1SHY B;  2AH1 A;  1JMZ B;  1H2X A;  4FA5 D;  4J84 A;  2IAA A;  3O4I A;  3F3G A;  4DNV A;  4R7A B;  4A7J A;  3QI0 A;  2PBI B;  2J56 H;  1B9Y A;  2I3S A;  3OKT A;  4GMB A;  4O2W A;  5E6U A;  1U4C A;  4FWW A;  2QR5 A;  4X3E A;  4J78 A;  5C86 A;  2PM9 A;  3RRM C;  4J86 A;  4L1Q D;  4A0B A;  1MG2 A;  2QXV A;  4D9S A;  2I3T A;  1PGU A;  4GQ1 A;  3JRO A;  3EI2 A;  3SBP A;  2H68 A;  2P9P C;  3GFC A;  2XU7 A;  3JZH A;  4A11 A;  4G55 A;  4E54 B;  2CN3 A;  2H6K A;  4LGN A;  3NIG A;  4MK0 B;  4NC4 A;  3FM0 A;  2TRC B;  1VZ2 A;  3I7O A;  4PSW B;  4ZN4 A;  1QNI A;  2XZG A;  4ESG A;  3EU7 A;  3HFQ A;  5IC7 A;  5H14 A;  5HYN B;  2CO0 C;  5EML B;  1GOH A;  5IGQ A;  2VDP A;  4OZU A;  4EWR A;  5GMK n;  4OWR A;  3K6S A;  3KRX B;  4X61 B;  4BCD A;  3SCY A;  4L3H D;  3IJ1 A;  4QRJ A;  1K3I A;  3C9C A;  3MZK A;  1OMW B;  3AH8 B;  4CZV A;  3IUN A;  4WK4 A;  5I5J A;  4Y7R A;  3UKU C;  3AFC A;  4IA9 A;  3RMZ D;  3AL8 B;  4D6V A;  5JWZ A;  4U7A A;  3A0F A;  1N6F A;  2B5L A;  2CE8 A;  2YNO A;  3PXT D;  4NAA A;  3IKO A;  3T3M A;  3GRE A;  1PI6 A;  3ZE1 A;  3ZDX A;  3KRW B;  1Q47 A;  1SQJ A;  3PVW B;  1GG2 B;  2BBK H;  3VA6 A;  1FWX A;  4JT6 C;  4G56 B;  3AL8 A;  5EMK B;  3V4V A;  2J57 G;  4UI9 R;  3JZG A;  5HDB A;  4CY2 A;  3MKS B;  4BH6 A;  1GXR A;  2H3X A;  3K26 A;  4RE5 A;  5FFO A;  4ZOY A;  4BCC A;  2CN2 A;  3UVL A;  2VDL A;  3J80 g;  3VGZ A;  2OVQ B;  1N6D A;  3DXK C;  2WQ8 A;  4AMZ A;  4J79 A;  1U2V C;  2OVP B;  3UR4 A;  4J77 A;  4ES0 A;  3RN0 D;  3ZDZ A;  3KCI A;  4QQE A;  2VC2 A;  4PNK B;  2G9A A;  2VDN A;  3PE7 A;  1OLZ A;  3K27 A;  4ERZ A;  3EI3 B;  5H17 A;  4CI3 A;  5CXB B;  1YFQ A;  3FRX A;  3I2N A;  5FKR A;  2AH0 A;  4RE6 A;  2H9N A;  3SN6 B;  4IMM A;  3K71 A;  5EAR A;  5GSA A;  4J82 A;  2O9K A;  1UOO A;  3MKQ A;  3IUR A;  3I7H A;  2Z2O A;  3IIY A;  4L3G D;  2AGZ A;  2YBA A;  3DDU A;  3RSE C;  2XDW A;  5AMS A;  5M5R A;  4BCB A;  4E5Z A;  1RI6 A;  1VZ3 A;  1QFM A;  3IUJ A;  1JJU B;  4K3I D;  3EI3 A;  5I5I A;  4BP9 A;  1JMX B;  4AX4 A;  2CO0 A;  3NID A;  4JSX C;  5CXB A;  4Z7Q A;  2P9L C;  5A2Q g;  1L0Q A;  1H2Y A;  4XEI C;  4Z7N A;  2H14 A;  3I8E A;  5CYK A;  5EM2 B;  3BG0 A;  2VDO A;  4CI2 A;  3OW8 A;  2HYE A;  3MZL A;  1C9L A;  3F3F A;  1K32 A;  2YB8 B;  5HE1 B;  1VE6 A;  2HU8 A;  5IT9 g;  2JKX A;  3SBR A;  4CY1 A;  4O45 A;  4NSX A;  2H13 A;  1E5T A;  4QAM A;  1SQ9 A;  3N0E A;  3PVU B;  3QHY B;  3OKY B;  2XE4 A;  3SVW D;  2YNP A;  4Y5R D;  3VI4 A;  4L9O A;  4LG8 A;  2XL3 A;  4A08 B;  2UZY B;  3EG6 A;  1JOF A;  4GM3 A;  3K72 A;  1BPO A;  2HJB A;  1A12 A;  3N0D A;  4N14 A;  3JRP A;  3O4G A;  1U8C A;  3I7P A;  4E54 A;  2PM6 B;  3DXM C;  2H9L A;  5E6R A;  5FKQ A;  1XKS A;  3OL2 B;  2GC7 A;  3I7L A;  4J8B A;  3OKY A;  3J81 g;  3EI4 B;  4BUJ C;  3SBQ A;  5H1M A;  2J55 H;  2AGY A;  3NVQ A;  4L1M A;  2HU7 A;  3ZE0 A;  4A08 A;  2VDR A;  3V7D B;  2OJY A;  3SMR A;  2MTA H;  4I79 A;  2YNN A;  3EI1 B;  1YR2 A;  4JD2 C;  4TZ4 A;  1TBG A;  1JV2 A;  3OF7 A;  3I7N A;  3VH0 A;  2BCJ B;  3O4J A;  4IRZ A;  1E8M A;  3UVO A;  5EMM B;  3U4Y A;  2HU5 A;  4AN1 A;  3OL2 A;  3FCU A;  4U1E I;  4GM8 A;  4O3T B;  2Q7Q A;  3PXW D;  5AFU 3;  5M5V A;  4GQB B;  3EI4 A;  4A0A B;  4NBM A;  3PSL A;  1O6G A;  2HKR A;  4JHP C;  5GXI A;  5TEF A;  4CZY A;  3JZN A;  2UZX B;  4WK0 A;  3T3P A;  1XHM A;  3SLE D;  3RLM D;  3EI1 A;  3JB9 L;  3EQ9 A;  4AOW A;  3UVK A;  2B5M A;  3ZE2 A;  5K19 A;  1C9I A;  3BWS A;  3RFH A;  5FLX g;  1M1X A;  4GM9 A;  1S4U X;  4A0A A;  3I7K A;  2B4E A;  2VZ1 A;  4KFM B;  4WK2 A;  4XYI A;  3V5W B;  1H2W A;  2IWK A;  4PC0 A;  5C2V B;  3MUN A;  1R5M A;  2VDM A;  2PM7 B;  4FHL A;  2EIE A;  1GOG A;  3GD1 I;  2EID A;  4O3U B;  2Z2N A;  3SXT D;  4FAN D;  1GOT B;  3MVD K;  4D0K A;  1ERJ A;  1XIP A;  3C75 H;  1TYE A;  2OK4 A;  3JAM g;  2AGW A;  2QC5 A;  2XL2 A;  2W18 A;  4FAV D;  3L4M D;  2IUQ A;  2P9U C;  2EBS A;  2P9N C;  5EAP A;  3NVN A;  2IUR A;  1H2Z A;  4JSP C;  1NR0 A;  5I5M A;  5SXM A;  2CNX A;  1L5G A;  4YVD A;  4ZOZ A;  5K1C C;  2VDQ A;  4CC9 A;  3ZDY A;  3PXS D;  5CXC B;  5IJ7 E;  1PEV A;  3SHF A;  4J8G A;  1O6F A;  4DNW A;  1GOF A;  2GC4 A;  3EMH A;  5FKS A;  5IJ8 E;  2VZ3 A; 
#chains in the Genus database with same CATH homology
 4HDJ A;  3UVN A;  3B7F A;  5EAL A;  5C9Z B;  4H5J A;  3CFS B;  3ULE C;  3P4F A;  4XYH A;  1PBY B;  4QT8 A;  3RN1 D;  3DWL C;  3EI2 B;  5KDO B;  5CXC A;  5HE0 B;  4A11 B;  4GGA A;  3NVX A;  3IJC A;  3C99 A;  5B4W A;  2XYI A;  3CIK B;  3JPX A;  4J0W A;  3DSM A;  4PBZ A;  2P9K C;  4GGD A;  2AGX A;  5EM2 A;  3DM0 A;  4FA9 D;  4A2M A;  4A09 B;  1MDA H;  2AGL A;  5HE2 B;  3SFZ A;  5GXH A;  3MMY A;  5FQD A;  3ZWL B;  4CI1 A;  1A0R B;  4X63 B;  3UKR C;  2CE9 A;  4JT5 C;  4JXM A;  2OIZ A;  5IGO A;  3SWS D;  2AQ5 A;  4A2L A;  5FKT A;  1K8K C;  3FGB A;  1TYQ C;  4A09 A;  2GNQ A;  2P9I C;  2H47 A;  4CY5 A;  4K3J B;  4X60 B;  3ORV D;  3AL9 A;  3EWE A;  2H9P A;  3ODT A;  2I0R A;  2H6N A;  1NEX B;  3OTT A;  3OKW A;  4JSN C;  4ERY A;  5THA A;  2HES X;  4O9D A;  4FB1 D;  1N6E A;  4PSX B;  4O1Q D;  3F3P A;  3V9F A;  2G99 A;  3RFG A;  4J0X A;  2HKM A;  5FXY A;  2HXC A;  3I8C A;  5TDH B;  2H9M A;  1P22 A;  4CI8 A;  5AJA A;  2OVR B;  4ZOV A;  4BL0 A;  3MXX A;  1MG3 A;  3UVM A;  4CZX A;  4J81 A;  2OK6 A;  5C2W B;  2P9S C;  3PSC B;  2IUP A;  3IJ0 A;  2HJ4 A;  2YMU A;  5HQG A;  3SJL D;  4FA1 D;  4PXW A;  4GZ8 A;  4J87 A;  2IUV A;  5TEE A;  2IWF A;  3W15 A;  5HE3 B;  4J73 A;  3IIW A;  4Z8L A;  3BG1 A;  4FA4 D;  5EMJ B;  3C5M A;  2I0S A;  5FA5 B;  3CFV A;  1GP2 B;  2I0T A;  5TF2 A;  3L4O D;  1B9X A;  5EAM A;  2Z2P A;  4H5I A;  4GQ2 P;  4E5Z B;  4LG9 A;  4AEZ A;  4QL1 A;  3I89 A;  4PBY A;  4ZOX A;  2H6Q A;  4CY3 A;  3E0C A;  2B5N A;  4ERQ A;  1VYH C;  4GGC A;  5CYK B;  2PM9 B;  4JSV C;  4A0B B;  1SHY B;  2AH1 A;  1JMZ B;  4FA5 D;  4J84 A;  2IAA A;  3F3G A;  4R7A B;  4A7J A;  2PBI B;  2J56 H;  1B9Y A;  2I3S A;  3OKT A;  4GMB A;  1U4C A;  4FWW A;  4X3E A;  4J78 A;  2PM9 A;  3RRM C;  4J86 A;  4L1Q D;  4A0B A;  1MG2 A;  2QXV A;  2I3T A;  1PGU A;  4GQ1 A;  3JRO A;  3EI2 A;  3SBP A;  2H68 A;  2P9P C;  3GFC A;  2XU7 A;  3JZH A;  4A11 A;  4E54 B;  2CN3 A;  2H6K A;  4LGN A;  4MK0 B;  3FM0 A;  2TRC B;  3I7O A;  4PSW B;  4ZN4 A;  1QNI A;  4ESG A;  3EU7 A;  3HFQ A;  5IC7 A;  5H14 A;  5HYN B;  2CO0 C;  5EML B;  5IGQ A;  4OZU A;  4EWR A;  5GMK n;  4OWR A;  3KRX B;  4X61 B;  3SCY A;  4L3H D;  3IJ1 A;  4QRJ A;  3C9C A;  3MZK A;  1OMW B;  3AH8 B;  4CZV A;  5I5J A;  4Y7R A;  3UKU C;  3AFC A;  4IA9 A;  3RMZ D;  3AL8 B;  4D6V A;  5JWZ A;  4U7A A;  3A0F A;  1N6F A;  2B5L A;  2CE8 A;  2YNO A;  3PXT D;  3IKO A;  3GRE A;  1PI6 A;  3KRW B;  1Q47 A;  1SQJ A;  3PVW B;  1GG2 B;  2BBK H;  3VA6 A;  1FWX A;  4JT6 C;  4G56 B;  3AL8 A;  5EMK B;  2J57 G;  4UI9 R;  3JZG A;  4CY2 A;  3MKS B;  4BH6 A;  1GXR A;  2H3X A;  3K26 A;  4ZOY A;  2CN2 A;  3UVL A;  3J80 g;  3VGZ A;  2OVQ B;  1N6D A;  3DXK C;  4J79 A;  1U2V C;  2OVP B;  3UR4 A;  4J77 A;  4ES0 A;  3RN0 D;  4QQE A;  4PNK B;  2G9A A;  3PE7 A;  1OLZ A;  3K27 A;  4ERZ A;  3EI3 B;  5H17 A;  4CI3 A;  5CXB B;  1YFQ A;  3FRX A;  3I2N A;  5FKR A;  2AH0 A;  2H9N A;  3SN6 B;  4IMM A;  5EAR A;  5GSA A;  4J82 A;  2O9K A;  3MKQ A;  3I7H A;  2Z2O A;  3IIY A;  4L3G D;  2AGZ A;  2YBA A;  3RSE C;  5AMS A;  4E5Z A;  1RI6 A;  1JJU B;  4K3I D;  3EI3 A;  5I5I A;  1JMX B;  2CO0 A;  4JSX C;  5CXB A;  2P9L C;  5A2Q g;  1L0Q A;  4XEI C;  2H14 A;  3I8E A;  5CYK A;  5EM2 B;  3BG0 A;  4CI2 A;  3OW8 A;  2HYE A;  3MZL A;  3F3F A;  1K32 A;  2YB8 B;  5HE1 B;  5IT9 g;  3SBR A;  4CY1 A;  4O45 A;  4NSX A;  2H13 A;  1SQ9 A;  3N0E A;  3PVU B;  3OKY B;  3SVW D;  2YNP A;  4Y5R D;  4L9O A;  4LG8 A;  2XL3 A;  4A08 B;  2UZY B;  3EG6 A;  1JOF A;  4GM3 A;  2HJB A;  3N0D A;  4N14 A;  3JRP A;  3I7P A;  4E54 A;  2PM6 B;  3DXM C;  2H9L A;  5FKQ A;  1XKS A;  3OL2 B;  2GC7 A;  3I7L A;  4J8B A;  3OKY A;  3J81 g;  3EI4 B;  4BUJ C;  3SBQ A;  5H1M A;  2J55 H;  2AGY A;  3NVQ A;  4A08 A;  3V7D B;  2OJY A;  3SMR A;  2MTA H;  4I79 A;  2YNN A;  3EI1 B;  4JD2 C;  4TZ4 A;  1TBG A;  3I7N A;  3VH0 A;  2BCJ B;  3UVO A;  5EMM B;  3U4Y A;  3OL2 A;  4U1E I;  4GM8 A;  4O3T B;  2Q7Q A;  3PXW D;  5AFU 3;  4GQB B;  3EI4 A;  4A0A B;  3PSL A;  2HKR A;  5GXI A;  5TEF A;  4CZY A;  3JZN A;  2UZX B;  1XHM A;  3SLE D;  3RLM D;  3EI1 A;  3JB9 L;  4AOW A;  3UVK A;  2B5M A;  5K19 A;  3BWS A;  3RFH A;  5FLX g;  4GM9 A;  1S4U X;  4A0A A;  3I7K A;  2B4E A;  4KFM B;  4XYI A;  3V5W B;  2IWK A;  4PC0 A;  5C2V B;  1R5M A;  2PM7 B;  4FHL A;  4O3U B;  3SXT D;  2Z2N A;  4FAN D;  1GOT B;  4D0K A;  1ERJ A;  1XIP A;  3C75 H;  3JAM g;  2OK4 A;  2AGW A;  2QC5 A;  2XL2 A;  2W18 A;  4FAV D;  3L4M D;  2IUQ A;  2P9U C;  2EBS A;  2P9N C;  5EAP A;  3NVN A;  2IUR A;  4JSP C;  1NR0 A;  5I5M A;  5SXM A;  2CNX A;  4YVD A;  4ZOZ A;  5K1C C;  4CC9 A;  5IJ7 E;  3PXS D;  5CXC B;  1PEV A;  3SHF A;  4J8G A;  2GC4 A;  3EMH A;  5FKS A;  5IJ8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...