3SVWD

Crystal structure of the p107v-maug/pre-methylamine dehydrogenase complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 97
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3svwD00
4TZ4A 1ERJA 5EMLB 3RRMC 3ODTA 5EAMA 4GGAA 3AFCA 2P9LC 4O3UB 4BL0A 2Q7QA 5B4WA 3V9FA 4ZN4A 1Q47A 5EALA 2H6NA 2PM7B 3SXTD 3SLED 3I8EA 3DWLC 3U4YA 1MG2A 5TDHB 3AL9A 3MKQA 4K3JB 1S4UX 3F3PA 4JSXC 4OZUA 3P4FA 3CFVA 1SQ9A 4FA9D 2QC5A 4I79A 3I2NA 4A7JA 5FKSA 4JSNC 3OTTA 1QNIA 2HJBA 3N0DA 5THAA 3AL8B 4R7AB 5K19A 5H17A 4A0AA 3A0FA 3F3GA 4E5ZB 3DSMA 4ES0A 3C9CA 4ERZA 4E54A 4PBZA 2Z2OA 2HKRA 2Z2PA 5EMJB 4FA4D 4GMBA 1OMWB 4O9DA 4HDJA 4CY5A 4GGDA 3V5WB 5EARA 4G56B 3MMYA 3VGZA 2CNXA 4FHLA 3KRWB 3PVWB 4GQ2P 3GFCA 1PI6A 2H6KA 4CY1A 4CZXA 4ZOZA 4ZOYA 2I3SA 3HFQA 4LGNA 2J57G 3SBRA 4AEZA 5H14A 3PXSD 2IURA 4QRJA 2H9NA 5GXHA 1TBGA 2YNNA 5K1CC 1PEVA 2H9LA 2W18A 1OLZA 4A11A 3SN6B 4CZVA 3JB9L 3DM0A 3CIKB 2GC4A 2H9MA 3EU7A 1PGUA 4CI8A 5GXIA 3SBPA 3JPXA 1FWXA 3MZKA 5HYNB 3F3FA 4AOWA 3PE7A 3E0CA 3SJLD 4FAVD 2BBKH 3EI1B 3L4MD 4JSVC 2CN3A 2OVPB 2J56H 3EMHA 3B7FA 2MTAH 4J82A 5IJ7E 2YB8B 4IA9A 2PM9B 2OK4A 5GMKn 3KRXB 3SWSD 2P9SC 4GZ8A 3J80g 5EM2B 1SQJA 4ZOXA 5FKTA 4CI2A 4E54B 4IMMA 2AH1A 2YNOA 1JJUB 5AJAA 4QQEA 4X61B 3JZHA 2G99A 2PM6B 2YNPA 3CFSB 4JT6C 3VH0A 2B4EA 3OKWA 4CC9A 2G9AA 5AMSA 5HE0B 1PBYB 2H13A 4ERQA 3EI1A 3IJCA 5FXYA 2OJYA 2H3XA 5CYKB 4A2MA 2P9NC 3K26A 4MK0B 2H6QA 4D6VA 5HE1B 2PM9A 3I8CA 5FLXg 4Y7RA 4Z8LA 1MDAH 4A11B 4H5JA 4U7AA 5EM2A 1GXRA 2XYIA 4GQ1A 4GM3A 5TF2A 3EI3B 4CY3A 3FRXA 4J86A 2OK6A 3IJ1A 4PC0A 3UVOA 5IGOA 3AH8B 4XYHA 3L4OD 3FM0A 4J8BA 2B5NA 4N14A 1L0QA 4ERYA 4CZYA 4O45A 5TEEA 3VA6A 5EMMB 2I0SA 4L3HD 2UZXB 5CYKA 3C75H 3ZWLB 3OKYA 3ORVD 4J0WA 3JROA 3ULEC 4A08B 4PSXB 2OIZA 3I7PA 4L3GD 2XL3A 4LG9A 2YMUA 3N0EA 5KDOB 4J73A 5FKQA 2AGZA 3UR4A 4H5IA 5A2Qg 4A09A 1GP2B 3PVUB 3SVWD 4K3ID 5GSAA 3EI3A 3IIWA 3NVXA 4ESGA 2AQ5A 1N6EA 2J55H 2CO0A 1JOFA 5I5IA 4J87A 5C9ZB 2GC7A 3I7NA 3RLMD 3C99A 3UVMA 2H9PA 1RI6A 3FGBA 4JSPC 5TEFA 3JZGA 4L1QD 4A0BB 2IUVA 3MXXA 4BH6A 4CI1A 3RN0D 4FB1D 1N6FA 3SHFA 1B9YA 5C2VB 3SBQA 2O9KA 1K8KC 4A08A 4X3EA 4FA1D 4LG8A 4YVDA 4NSXA 3MKSB 4CY2A 5I5JA 1GOTB 4PBYA 5SXMA 3BG1A 4A2LA 4D0KA 4GQBB 2IWKA 3BG0A 3RN1D 3EI2A 2I0RA 4GM8A 4J0XA 4GM9A 3UKUC 4GGCA 4O3TB 2XU7A 3BWSA 3RSEC 4FA5D 1NEXB 4J81A 4EWRA 5CXCB 1GG2B 5IJ8E 5HQGA 2YBAA 3UKRC 5I5MA 4O1QD 4J84A 3OL2A 2P9KC 1VYHC 3C5MA 3OKYB 5H1MA 2HYEA 3PXWD 1TYQC 2HESX 3W15A 3EWEA 1JMZB 4A0BA 2AGXA 2XL2A 2HXCA 2OVRB 3UVKA 3DXMC 2IUPA 4A09B 3SCYA 5FA5B 3IJ0A 1JMXB 4J77A 1A0RB 2H68A 3PXTD 3EI4A 3JZNA 5EAPA 3OKTA 4X60B 3K27A 4X63B 4FAND 2B5MA 1P22A 3I7OA 4J78A 4J8GA 2P9UC 4XEIC 5CXCA 5IT9g 5AFU3 2IAAA 4Y5RD 3I89A 2P9PC 2AGLA 3MZLA 3RFGA 4UI9R 4QL1A 2BCJB 2TRCB 4XYIA 4L9OA 2CE9A 2B5LA 1MG3A 2IWFA 3JRPA 1XHMA 3I7LA 1SHYB 3NVQA 4FWWA 5C2WB 1B9XA 3EG6A 1XKSA 2P9IC 4PXWA 3V7DB 1K32A 2Z2NA 1U2VC 5CXBB 5JWZA 3J81g 1YFQA 3EI2B 2PBIB 3OW8A 3SMRA 4BUJC 2CE8A 3UVNA 4QT8A 5HE2B 2H14A 2IUQA 2H47A 3GREA 3AL8A 4JD2C 4OWRA 3SFZA 3UVLA 4JT5C 4E5ZA 3RMZD 2GNQA 3IKOA 3OL2B 5IGQA 2HJ4A 5HE3B 4JXMA 1XIPA 3I7HA 3DXKC 4ZOVA 4KFMB 1R5MA 4J79A 3RFHA 2EBSA 3IIYA 2HKMA 4PSWB 2UZYB 5IC7A 2QXVA 2AGWA 3JAMg 4PNKB 3PSLA 2CO0C 2I0TA 3PSCB 1U4CA 5FQDA 5FKRA 2CN2A 3I7KA 1N6DA 3NVNA 3EI4B 2OVQB 2AGYA 5EMKB 4U1EI 4CI3A 5CXBA 4A0AB 2AH0A 2I3TA 1NR0A
chains in the Genus database with same CATH superfamily
1QFMA 3EQ9A 4TZ4A 1ERJA 5EMLB 3RRMC 3ODTA 1VZ3A 5EAMA 2QZPA 4GGAA 3AFCA 2P9LC 4O3UB 4BL0A 2Q7QA 1C9IA 5B4WA 3V9FA 4ZN4A 1Q47A 5EALA 2H6NA 2PM7B 3SXTD 3SLED 5M5UA 3I8EA 1E8MA 3DWLC 3U4YA 1MG2A 5TDHB 3AL9A 2HU5A 3MKQA 1H2ZA 1T2XA 4K3JB 1S4UX 3F3PA 4JSXC 4OZUA 3P4FA 3KCIA 3CFVA 1SQ9A 4FA9D 2QC5A 4I79A 3I2NA 4A7JA 4AX4A 5FKSA 2WQ8A 4JSNC 5M5TA 2VDMA 3OTTA 4Z7QA 1QNIA 2HJBA 3N0DA 5THAA 3AL8B 4R7AB 5K19A 5H17A 4A0AA 3A0FA 3F3GA 3VI3A 4E5ZB 3DSMA 3IJEA 1UOPA 4ES0A 3C9CA 3O4GA 5M5SA 4ERZA 2VDKA 3MVDK 1GOHA 4E54A 4PBZA 2Z2OA 2HKRA 4JHNA 2Z2PA 5EMJB 4FA4D 3MUOA 4GMBA 4O2WA 1OMWB 4O9DA 4D9SA 4HDJA 4CY5A 4GGDA 3V5WB 1JV2A 1QFSA 5EARA 4G56B 3MMYA 3VGZA 2CNXA 4FHLA 1H2XA 3KRWB 3PVWB 4GQ2P 3GFCA 1PI6A 2H6KA 4CY1A 1H2WA 4CZXA 4ZOZA 4ZOYA 1I2MB 1JTDB 2JKXA 4DNVA 2I3SA 3HFQA 4LGNA 2J57G 3SBRA 4AEZA 5H14A 3PXSD 3V4VA 2IURA 1L5GA 4QRJA 2H9NA 5GXHA 4WJKA 1TBGA 2YNNA 5K1CC 1PEVA 2BKLA 3IUMA 1BPOA 2H9LA 2W18A 1OLZA 4A11A 3SN6B 4CZVA 3MUNA 2EIEA 3DM0A 3JB9L 3QI0A 1M1XA 3CIKB 2GC4A 2H9MA 3EU7A 1PGUA 4CI8A 5GXIA 3SBPA 3JPXA 1FWXA 4Z7OA 3MZKA 4AMYA 5HYNB 4NBMA 3F3FA 4G1MA 4AOWA 3PE7A 3E0CA 3SJLD 4FAVD 2BBKH 3EI1B 3L4MD 3O4JA 4JSVC 2CN3A 2OVPB 2J56H 3EMHA 3B7FA 2MTAH 4J82A 5IJ7E 3NIGA 2YB8B 1VE7A 4IA9A 2PM9B 2OK4A 5GMKn 3KRXB 3SWSD 2VDNA 2P9SC 4GZ8A 4MMXA 3J80g 5EM2B 1SQJA 5C92A 4ZOXA 5FKTA 4CI2A 4E54B 4IMMA 2AH1A 2YNOA 1JJUB 5AJAA 4AN0A 4QQEA 4X61B 3JZHA 2G99A 2PM6B 2YNPA 3CFSB 4JT6C 3VH0A 1O6FA 2B4EA 3OKWA 4WK0A 4CC9A 2G9AA 5FFOA 4NENA 1UOQA 5AMSA 5E6UA 5HE0B 1PBYB 2H13A 4ERQA 3EI1A 3IJCA 5FXYA 2OJYA 2H3XA 2VZ1A 5CYKB 4A2MA 2P9NC 2EIDA 3K26A 4MK0B 3K71A 1E5TA 2H6QA 4D6VA 5HE1B 2PM9A 3I8CA 2HU8A 3ZDXA 5FLXg 4WK4A 3FCUA 4DNUA 4Y7RA 1O6GA 4Z8LA 3T3PA 1MDAH 4A11B 4H5JA 4U7AA 5EM2A 1GXRA 2XYIA 4O02A 4GQ1A 4GM3A 2VC2A 5TF2A 3EI3B 3ZDZA 4CY3A 3FRXA 4J86A 2OK6A 3IJ1A 4PC0A 3UVOA 5IGOA 5M5VA 3AH8B 4XYHA 3IVMA 3L4OD 3FM0A 4J8BA 3ZDYA 3ZE2A 2B5NA 3OF7A 4N14A 4NAAA 1L0QA 4ERYA 4CZYA 5M61A 4O45A 5TEEA 3VA6A 5EMMB 2I0SA 4L3HD 2UZXB 5CYKA 3C75H 3ZWLB 3OKYA 3ORVD 4J0WA 3JROA 3ULEC 4A08B 1U8CA 2OIZA 3IUJA 3I7PA 4PSXB 4L3GD 2XL3A 4LG9A 1UOOA 1H2YA 2YMUA 3N0EA 5KDOB 4J73A 5FKQA 2AGZA 3UR4A 4H5IA 4AN1A 5A2Qg 3FCSA 4G1EA 4A09A 1GP2B 3PVUB 3NIFA 3SVWD 4K3ID 5GSAA 3EI3A 3IIWA 2VDLA 3NVXA 1GOFA 4ESGA 2AQ5A 1N6EA 2J55H 2CO0A 1JOFA 1A12A 5I5IA 4J87A 5C9ZB 2GC7A 4AMZA 3I7NA 3RLMD 3EQ7A 3C99A 3UVMA 3O4IA 2H9PA 1RI6A 3FGBA 4JSPC 5TEFA 3O4HA 3JZGA 4L1QD 4A0BB 2IUVA 3MXXA 4BH6A 3IUQA 4CI1A 3RN0D 4FB1D 1N6FA 3SHFA 1B9YA 5C2VB 3DDUA 3SBQA 2O9KA 1K8KC 4A08A 3T3MA 4X3EA 1E8NA 4FA1D 3QHYB 5C86A 4LG8A 4YVDA 4NSXA 3MKSB 4CY2A 5I5JA 1GOTB 4PBYA 5SXMA 3BG1A 4A2LA 4D0KA 4GQBB 2IWKA 3BG0A 3RN1D 3EI2A 2I0RA 4GM8A 5HDBA 4J0XA 3NIDA 4GM9A 3UKUC 4GGCA 4O3TB 4UM8A 4BCCA 2XU7A 3BWSA 3RSEC 1K3IA 4FA5D 1NEXB 4J81A 4UM9A 4EWRA 5CXCB 1GG2B 5IJ8E 5HQGA 2YBAA 3UKRC 5I5MA 3K6SA 4O1QD 4J84A 3OL2A 2P9KC 2XE4A 1VYHC 3C5MA 3OKYB 5E6RA 5H1MA 2HYEA 3IUNA 2QR5A 3GC3B 3PXWD 1TYQC 2HESX 3W15A 3EWEA 1JMZB 4A0BA 2AGXA 2XL2A 2HXCA 3IURA 2OVRB 5E6SA 3UVKA 3K72A 3ZE1A 3DXMC 2IUPA 4A09B 5M5RA 3SCYA 5FA5B 3IJ0A 1JMXB 4J77A 1A0RB 2H68A 4BCDA 3EQ8A 3PXTD 3EI4A 3JZNA 4IRZA 4MMZA 5EAPA 4G55A 3OKTA 2VDPA 4L1MA 4X60B 3K27A 4X63B 4FAND 2B5MA 1P22A 3I7OA 4J78A 4J8GA 2P9UC 4XEIC 5CXCA 5IT9g 5AFU3 2IAAA 4Y5RD 3I89A 2P9PC 2AGLA 3MZLA 3RFGA 4UI9R 4QL1A 2BCJB 2TRCB 4XYIA 4L9OA 2CE9A 2VZ3A 2B5LA 2EICA 1MG3A 2IWFA 1TYEA 3JRPA 1XHMA 3I7LA 1SHYB 4MMYA 3ZE0A 3NVQA 4FWWA 4NC4A 5C2WB 1B9XA 3EG6A 4RE6A 1XKSA 4DNWA 2P9IC 4PXWA 3V7DB 1YR2A 1K32A 2Z2NA 1U2VC 5CXBB 5JWZA 3J81g 1YFQA 3EI2B 2PBIB 3OW8A 3SMRA 2XZGA 2CE8A 3UVNA 4BUJC 4QT8A 5HE2B 2H14A 2VDRA 3V4PA 1VE6A 2VDQA 2IUQA 2H47A 3GREA 1C9LA 3AL8A 4JD2C 4OWRA 3SFZA 3UVLA 4JT5C 1VZ2A 4E5ZA 2HU7A 3RMZD 2GNQA 3IKOA 3OL2B 5IGQA 2HJ4A 5HE3B 4JXMA 4JHPC 4Z7NA 1XIPA 3GD1I 3I7HA 3DXKC 4ZOVA 1GOGA 4KFMB 1R5MA 4J79A 4QAMA 2EIBA 2EBSA 3RFHA 3IIYA 1UTCA 2HKMA 4PSWB 2UZYB 5IC7A 3VI4A 2QXVA 2AGWA 3JAMg 4BP8A 4PNKB 2XDWA 3PSLA 2CO0C 2I0TA 3IULA 3PSCB 1U4CA 5FQDA 5FKRA 2CN2A 3I7KA 1N6DA 3NVNA 3EI4B 2OVQB 2AGYA 4BCBA 5EMKB 4U1EI 4BP9A 5CXBA 4CI3A 4WK2A 4RE5A 4A0AB 2AH0A 2I3TA 5FFGA 2VDOA 1NR0A
chains in the Genus database with same CATH topology
4TZ4A 1ERJA 5EMLB 3RRMC 3ODTA 5EAMA 4GGAA 3AFCA 2P9LC 4O3UB 4BL0A 2Q7QA 5B4WA 3V9FA 4ZN4A 1Q47A 5EALA 2H6NA 2PM7B 3SXTD 3SLED 3I8EA 3DWLC 3U4YA 1MG2A 5TDHB 3AL9A 3MKQA 4K3JB 1S4UX 3F3PA 4JSXC 4OZUA 3P4FA 3CFVA 1SQ9A 4FA9D 2QC5A 4I79A 3I2NA 4A7JA 5FKSA 4JSNC 3OTTA 1QNIA 2HJBA 3N0DA 5THAA 3AL8B 4R7AB 5K19A 5H17A 4A0AA 3A0FA 3F3GA 4E5ZB 3DSMA 4ES0A 3C9CA 4ERZA 4E54A 4PBZA 2Z2OA 2HKRA 2Z2PA 5EMJB 4FA4D 4GMBA 1OMWB 4O9DA 4HDJA 4CY5A 4GGDA 3V5WB 5EARA 4G56B 3MMYA 3VGZA 2CNXA 4FHLA 3KRWB 3PVWB 4GQ2P 3GFCA 1PI6A 2H6KA 4CY1A 4CZXA 4ZOZA 4ZOYA 2I3SA 3HFQA 4LGNA 2J57G 3SBRA 4AEZA 5H14A 3PXSD 2IURA 4QRJA 2H9NA 5GXHA 1TBGA 2YNNA 5K1CC 1PEVA 2H9LA 2W18A 1OLZA 4A11A 3SN6B 4CZVA 3JB9L 3DM0A 3CIKB 2GC4A 2H9MA 3EU7A 1PGUA 4CI8A 5GXIA 3SBPA 3JPXA 1FWXA 3MZKA 5HYNB 3F3FA 4AOWA 3PE7A 3E0CA 3SJLD 4FAVD 2BBKH 3EI1B 3L4MD 4JSVC 2CN3A 2OVPB 2J56H 3EMHA 3B7FA 2MTAH 4J82A 5IJ7E 2YB8B 4IA9A 2PM9B 2OK4A 5GMKn 3KRXB 3SWSD 2P9SC 4GZ8A 3J80g 5EM2B 1SQJA 4ZOXA 5FKTA 4CI2A 4E54B 4IMMA 2AH1A 2YNOA 1JJUB 5AJAA 4QQEA 4X61B 3JZHA 2G99A 2PM6B 2YNPA 3CFSB 4JT6C 3VH0A 2B4EA 3OKWA 4CC9A 2G9AA 5AMSA 5HE0B 1PBYB 2H13A 4ERQA 3EI1A 3IJCA 5FXYA 2OJYA 2H3XA 5CYKB 4A2MA 2P9NC 3K26A 4MK0B 2H6QA 4D6VA 5HE1B 2PM9A 3I8CA 5FLXg 4Y7RA 4Z8LA 1MDAH 4A11B 4H5JA 4U7AA 5EM2A 1GXRA 2XYIA 4GQ1A 4GM3A 5TF2A 3EI3B 4CY3A 3FRXA 4J86A 2OK6A 3IJ1A 4PC0A 3UVOA 5IGOA 3AH8B 4XYHA 3L4OD 3FM0A 4J8BA 2B5NA 4N14A 1L0QA 4ERYA 4CZYA 4O45A 5TEEA 3VA6A 5EMMB 2I0SA 4L3HD 2UZXB 5CYKA 3C75H 3ZWLB 3OKYA 3ORVD 4J0WA 3JROA 3ULEC 4A08B 4PSXB 2OIZA 3I7PA 4L3GD 2XL3A 4LG9A 2YMUA 3N0EA 5KDOB 4J73A 5FKQA 2AGZA 3UR4A 4H5IA 5A2Qg 4A09A 1GP2B 3PVUB 3SVWD 4K3ID 5GSAA 3EI3A 3IIWA 3NVXA 4ESGA 2AQ5A 1N6EA 2J55H 2CO0A 1JOFA 5I5IA 4J87A 5C9ZB 2GC7A 3I7NA 3RLMD 3C99A 3UVMA 2H9PA 1RI6A 3FGBA 4JSPC 5TEFA 3JZGA 4L1QD 4A0BB 2IUVA 3MXXA 4BH6A 4CI1A 3RN0D 4FB1D 1N6FA 3SHFA 1B9YA 5C2VB 3SBQA 2O9KA 1K8KC 4A08A 4X3EA 4FA1D 4LG8A 4YVDA 4NSXA 3MKSB 4CY2A 5I5JA 1GOTB 4PBYA 5SXMA 3BG1A 4A2LA 4D0KA 4GQBB 2IWKA 3BG0A 3RN1D 3EI2A 2I0RA 4GM8A 4J0XA 4GM9A 3UKUC 4GGCA 4O3TB 2XU7A 3BWSA 3RSEC 4FA5D 1NEXB 4J81A 4EWRA 5CXCB 1GG2B 5IJ8E 5HQGA 2YBAA 3UKRC 5I5MA 4O1QD 4J84A 3OL2A 2P9KC 1VYHC 3C5MA 3OKYB 5H1MA 2HYEA 3PXWD 1TYQC 2HESX 3W15A 3EWEA 1JMZB 4A0BA 2AGXA 2XL2A 2HXCA 2OVRB 3UVKA 3DXMC 2IUPA 4A09B 3SCYA 5FA5B 3IJ0A 1JMXB 4J77A 1A0RB 2H68A 3PXTD 3EI4A 3JZNA 5EAPA 3OKTA 4X60B 3K27A 4X63B 4FAND 2B5MA 1P22A 3I7OA 4J78A 4J8GA 2P9UC 4XEIC 5CXCA 5IT9g 5AFU3 2IAAA 4Y5RD 3I89A 2P9PC 2AGLA 3MZLA 3RFGA 4UI9R 4QL1A 2BCJB 2TRCB 4XYIA 4L9OA 2CE9A 2B5LA 1MG3A 2IWFA 3JRPA 1XHMA 3I7LA 1SHYB 3NVQA 4FWWA 5C2WB 1B9XA 3EG6A 1XKSA 2P9IC 4PXWA 3V7DB 1K32A 2Z2NA 1U2VC 5CXBB 5JWZA 3J81g 1YFQA 3EI2B 2PBIB 3OW8A 3SMRA 4BUJC 2CE8A 3UVNA 4QT8A 5HE2B 2H14A 2IUQA 2H47A 3GREA 3AL8A 4JD2C 4OWRA 3SFZA 3UVLA 4JT5C 4E5ZA 3RMZD 2GNQA 3IKOA 3OL2B 5IGQA 2HJ4A 5HE3B 4JXMA 1XIPA 3I7HA 3DXKC 4ZOVA 4KFMB 1R5MA 4J79A 3RFHA 2EBSA 3IIYA 2HKMA 4PSWB 2UZYB 5IC7A 2QXVA 2AGWA 3JAMg 4PNKB 3PSLA 2CO0C 2I0TA 3PSCB 1U4CA 5FQDA 5FKRA 2CN2A 3I7KA 1N6DA 3NVNA 3EI4B 2OVQB 2AGYA 5EMKB 4U1EI 4CI3A 5CXBA 4A0AB 2AH0A 2I3TA 1NR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZ4 A;  1ERJ A;  5EML B;  3RRM C;  3ODT A;  5EAM A;  4GGA A;  3AFC A;  2P9L C;  4O3U B;  4BL0 A;  2Q7Q A;  5B4W A;  3V9F A;  4ZN4 A;  1Q47 A;  5EAL A;  2H6N A;  2PM7 B;  3SXT D;  3SLE D;  3I8E A;  3DWL C;  3U4Y A;  1MG2 A;  5TDH B;  3AL9 A;  3MKQ A;  4K3J B;  1S4U X;  3F3P A;  4JSX C;  4OZU A;  3P4F A;  3CFV A;  1SQ9 A;  4FA9 D;  2QC5 A;  4I79 A;  3I2N A;  4A7J A;  5FKS A;  4JSN C;  3OTT A;  1QNI A;  2HJB A;  3N0D A;  5THA A;  3AL8 B;  4R7A B;  5K19 A;  5H17 A;  4A0A A;  3A0F A;  3F3G A;  4E5Z B;  3DSM A;  4ES0 A;  3C9C A;  4ERZ A;  4E54 A;  4PBZ A;  2Z2O A;  2HKR A;  2Z2P A;  5EMJ B;  4FA4 D;  4GMB A;  1OMW B;  4O9D A;  4HDJ A;  4CY5 A;  4GGD A;  3V5W B;  5EAR A;  4G56 B;  3MMY A;  3VGZ A;  2CNX A;  4FHL A;  3KRW B;  3PVW B;  4GQ2 P;  3GFC A;  1PI6 A;  2H6K A;  4CY1 A;  4CZX A;  4ZOZ A;  4ZOY A;  2I3S A;  3HFQ A;  4LGN A;  2J57 G;  3SBR A;  4AEZ A;  5H14 A;  3PXS D;  2IUR A;  4QRJ A;  2H9N A;  5GXH A;  1TBG A;  2YNN A;  5K1C C;  1PEV A;  2H9L A;  2W18 A;  1OLZ A;  4A11 A;  3SN6 B;  4CZV A;  3JB9 L;  3DM0 A;  3CIK B;  2GC4 A;  2H9M A;  3EU7 A;  1PGU A;  4CI8 A;  5GXI A;  3SBP A;  3JPX A;  1FWX A;  3MZK A;  5HYN B;  3F3F A;  4AOW A;  3PE7 A;  3E0C A;  3SJL D;  4FAV D;  2BBK H;  3EI1 B;  3L4M D;  4JSV C;  2CN3 A;  2OVP B;  2J56 H;  3EMH A;  3B7F A;  2MTA H;  4J82 A;  5IJ7 E;  2YB8 B;  4IA9 A;  2PM9 B;  2OK4 A;  5GMK n;  3KRX B;  3SWS D;  2P9S C;  4GZ8 A;  3J80 g;  5EM2 B;  1SQJ A;  4ZOX A;  5FKT A;  4CI2 A;  4E54 B;  4IMM A;  2AH1 A;  2YNO A;  1JJU B;  5AJA A;  4QQE A;  4X61 B;  3JZH A;  2G99 A;  2PM6 B;  2YNP A;  3CFS B;  4JT6 C;  3VH0 A;  2B4E A;  3OKW A;  4CC9 A;  2G9A A;  5AMS A;  5HE0 B;  1PBY B;  2H13 A;  4ERQ A;  3EI1 A;  3IJC A;  5FXY A;  2OJY A;  2H3X A;  5CYK B;  4A2M A;  2P9N C;  3K26 A;  4MK0 B;  2H6Q A;  4D6V A;  5HE1 B;  2PM9 A;  3I8C A;  5FLX g;  4Y7R A;  4Z8L A;  1MDA H;  4A11 B;  4H5J A;  4U7A A;  5EM2 A;  1GXR A;  2XYI A;  4GQ1 A;  4GM3 A;  5TF2 A;  3EI3 B;  4CY3 A;  3FRX A;  4J86 A;  2OK6 A;  3IJ1 A;  4PC0 A;  3UVO A;  5IGO A;  3AH8 B;  4XYH A;  3L4O D;  3FM0 A;  4J8B A;  2B5N A;  4N14 A;  1L0Q A;  4ERY A;  4CZY A;  4O45 A;  5TEE A;  3VA6 A;  5EMM B;  2I0S A;  4L3H D;  2UZX B;  5CYK A;  3C75 H;  3ZWL B;  3OKY A;  3ORV D;  4J0W A;  3JRO A;  3ULE C;  4A08 B;  4PSX B;  2OIZ A;  3I7P A;  4L3G D;  2XL3 A;  4LG9 A;  2YMU A;  3N0E A;  5KDO B;  4J73 A;  5FKQ A;  2AGZ A;  3UR4 A;  4H5I A;  5A2Q g;  4A09 A;  1GP2 B;  3PVU B;  3SVW D;  4K3I D;  5GSA A;  3EI3 A;  3IIW A;  3NVX A;  4ESG A;  2AQ5 A;  1N6E A;  2J55 H;  2CO0 A;  1JOF A;  5I5I A;  4J87 A;  5C9Z B;  2GC7 A;  3I7N A;  3RLM D;  3C99 A;  3UVM A;  2H9P A;  1RI6 A;  3FGB A;  4JSP C;  5TEF A;  3JZG A;  4L1Q D;  4A0B B;  2IUV A;  3MXX A;  4BH6 A;  4CI1 A;  3RN0 D;  4FB1 D;  1N6F A;  3SHF A;  1B9Y A;  5C2V B;  3SBQ A;  2O9K A;  1K8K C;  4A08 A;  4X3E A;  4FA1 D;  4LG8 A;  4YVD A;  4NSX A;  3MKS B;  4CY2 A;  5I5J A;  1GOT B;  4PBY A;  5SXM A;  3BG1 A;  4A2L A;  4D0K A;  4GQB B;  2IWK A;  3BG0 A;  3RN1 D;  3EI2 A;  2I0R A;  4GM8 A;  4J0X A;  4GM9 A;  3UKU C;  4GGC A;  4O3T B;  2XU7 A;  3BWS A;  3RSE C;  4FA5 D;  1NEX B;  4J81 A;  4EWR A;  5CXC B;  1GG2 B;  5IJ8 E;  5HQG A;  2YBA A;  3UKR C;  5I5M A;  4O1Q D;  4J84 A;  3OL2 A;  2P9K C;  1VYH C;  3C5M A;  3OKY B;  5H1M A;  2HYE A;  3PXW D;  1TYQ C;  2HES X;  3W15 A;  3EWE A;  1JMZ B;  4A0B A;  2AGX A;  2XL2 A;  2HXC A;  2OVR B;  3UVK A;  3DXM C;  2IUP A;  4A09 B;  3SCY A;  5FA5 B;  3IJ0 A;  1JMX B;  4J77 A;  1A0R B;  2H68 A;  3PXT D;  3EI4 A;  3JZN A;  5EAP A;  3OKT A;  4X60 B;  3K27 A;  4X63 B;  4FAN D;  2B5M A;  1P22 A;  3I7O A;  4J78 A;  4J8G A;  2P9U C;  4XEI C;  5CXC A;  5IT9 g;  5AFU 3;  2IAA A;  4Y5R D;  3I89 A;  2P9P C;  2AGL A;  3MZL A;  3RFG A;  4UI9 R;  4QL1 A;  2BCJ B;  2TRC B;  4XYI A;  4L9O A;  2CE9 A;  2B5L A;  1MG3 A;  2IWF A;  3JRP A;  1XHM A;  3I7L A;  1SHY B;  3NVQ A;  4FWW A;  5C2W B;  1B9X A;  3EG6 A;  1XKS A;  2P9I C;  4PXW A;  3V7D B;  1K32 A;  2Z2N A;  1U2V C;  5CXB B;  5JWZ A;  3J81 g;  1YFQ A;  3EI2 B;  2PBI B;  3OW8 A;  3SMR A;  4BUJ C;  2CE8 A;  3UVN A;  4QT8 A;  5HE2 B;  2H14 A;  2IUQ A;  2H47 A;  3GRE A;  3AL8 A;  4JD2 C;  4OWR A;  3SFZ A;  3UVL A;  4JT5 C;  4E5Z A;  3RMZ D;  2GNQ A;  3IKO A;  3OL2 B;  5IGQ A;  2HJ4 A;  5HE3 B;  4JXM A;  1XIP A;  3I7H A;  3DXK C;  4ZOV A;  4KFM B;  1R5M A;  4J79 A;  3RFH A;  2EBS A;  3IIY A;  2HKM A;  4PSW B;  2UZY B;  5IC7 A;  2QXV A;  2AGW A;  3JAM g;  4PNK B;  3PSL A;  2CO0 C;  2I0T A;  3PSC B;  1U4C A;  5FQD A;  5FKR A;  2CN2 A;  3I7K A;  1N6D A;  3NVN A;  3EI4 B;  2OVQ B;  2AGY A;  5EMK B;  4U1E I;  4CI3 A;  5CXB A;  4A0A B;  2AH0 A;  2I3T A;  1NR0 A; 
#chains in the Genus database with same CATH topology
 1QFM A;  3EQ9 A;  4TZ4 A;  1ERJ A;  5EML B;  3RRM C;  3ODT A;  1VZ3 A;  5EAM A;  2QZP A;  4GGA A;  3AFC A;  2P9L C;  4O3U B;  4BL0 A;  2Q7Q A;  1C9I A;  5B4W A;  3V9F A;  4ZN4 A;  1Q47 A;  5EAL A;  2H6N A;  2PM7 B;  3SXT D;  3SLE D;  5M5U A;  3I8E A;  1E8M A;  3DWL C;  3U4Y A;  1MG2 A;  5TDH B;  3AL9 A;  2HU5 A;  3MKQ A;  1H2Z A;  1T2X A;  4K3J B;  1S4U X;  3F3P A;  4JSX C;  4OZU A;  3P4F A;  3KCI A;  3CFV A;  1SQ9 A;  4FA9 D;  2QC5 A;  4I79 A;  3I2N A;  4A7J A;  4AX4 A;  5FKS A;  2WQ8 A;  4JSN C;  5M5T A;  2VDM A;  3OTT A;  4Z7Q A;  1QNI A;  2HJB A;  3N0D A;  5THA A;  3AL8 B;  4R7A B;  5K19 A;  5H17 A;  4A0A A;  3A0F A;  3F3G A;  3VI3 A;  4E5Z B;  3DSM A;  3IJE A;  1UOP A;  4ES0 A;  3C9C A;  3O4G A;  5M5S A;  4ERZ A;  2VDK A;  3MVD K;  1GOH A;  4E54 A;  4PBZ A;  2Z2O A;  2HKR A;  4JHN A;  2Z2P A;  5EMJ B;  4FA4 D;  3MUO A;  4GMB A;  4O2W A;  1OMW B;  4O9D A;  4D9S A;  4HDJ A;  4CY5 A;  4GGD A;  3V5W B;  1JV2 A;  1QFS A;  5EAR A;  4G56 B;  3MMY A;  3VGZ A;  2CNX A;  4FHL A;  1H2X A;  3KRW B;  3PVW B;  4GQ2 P;  3GFC A;  1PI6 A;  2H6K A;  4CY1 A;  1H2W A;  4CZX A;  4ZOZ A;  4ZOY A;  1I2M B;  1JTD B;  2JKX A;  4DNV A;  2I3S A;  3HFQ A;  4LGN A;  2J57 G;  3SBR A;  4AEZ A;  5H14 A;  3PXS D;  3V4V A;  2IUR A;  1L5G A;  4QRJ A;  2H9N A;  5GXH A;  4WJK A;  1TBG A;  2YNN A;  5K1C C;  1PEV A;  2BKL A;  3IUM A;  1BPO A;  2H9L A;  2W18 A;  1OLZ A;  4A11 A;  3SN6 B;  4CZV A;  3MUN A;  2EIE A;  3DM0 A;  3JB9 L;  3QI0 A;  1M1X A;  3CIK B;  2GC4 A;  2H9M A;  3EU7 A;  1PGU A;  4CI8 A;  5GXI A;  3SBP A;  3JPX A;  1FWX A;  4Z7O A;  3MZK A;  4AMY A;  5HYN B;  4NBM A;  3F3F A;  4G1M A;  4AOW A;  3PE7 A;  3E0C A;  3SJL D;  4FAV D;  2BBK H;  3EI1 B;  3L4M D;  3O4J A;  4JSV C;  2CN3 A;  2OVP B;  2J56 H;  3EMH A;  3B7F A;  2MTA H;  4J82 A;  5IJ7 E;  3NIG A;  2YB8 B;  1VE7 A;  4IA9 A;  2PM9 B;  2OK4 A;  5GMK n;  3KRX B;  3SWS D;  2VDN A;  2P9S C;  4GZ8 A;  4MMX A;  3J80 g;  5EM2 B;  1SQJ A;  5C92 A;  4ZOX A;  5FKT A;  4CI2 A;  4E54 B;  4IMM A;  2AH1 A;  2YNO A;  1JJU B;  5AJA A;  4AN0 A;  4QQE A;  4X61 B;  3JZH A;  2G99 A;  2PM6 B;  2YNP A;  3CFS B;  4JT6 C;  3VH0 A;  1O6F A;  2B4E A;  3OKW A;  4WK0 A;  4CC9 A;  2G9A A;  5FFO A;  4NEN A;  1UOQ A;  5AMS A;  5E6U A;  5HE0 B;  1PBY B;  2H13 A;  4ERQ A;  3EI1 A;  3IJC A;  5FXY A;  2OJY A;  2H3X A;  2VZ1 A;  5CYK B;  4A2M A;  2P9N C;  2EID A;  3K26 A;  4MK0 B;  3K71 A;  1E5T A;  2H6Q A;  4D6V A;  5HE1 B;  2PM9 A;  3I8C A;  2HU8 A;  3ZDX A;  5FLX g;  4WK4 A;  3FCU A;  4DNU A;  4Y7R A;  1O6G A;  4Z8L A;  3T3P A;  1MDA H;  4A11 B;  4H5J A;  4U7A A;  5EM2 A;  1GXR A;  2XYI A;  4O02 A;  4GQ1 A;  4GM3 A;  2VC2 A;  5TF2 A;  3EI3 B;  3ZDZ A;  4CY3 A;  3FRX A;  4J86 A;  2OK6 A;  3IJ1 A;  4PC0 A;  3UVO A;  5IGO A;  5M5V A;  3AH8 B;  4XYH A;  3IVM A;  3L4O D;  3FM0 A;  4J8B A;  3ZDY A;  3ZE2 A;  2B5N A;  3OF7 A;  4N14 A;  4NAA A;  1L0Q A;  4ERY A;  4CZY A;  5M61 A;  4O45 A;  5TEE A;  3VA6 A;  5EMM B;  2I0S A;  4L3H D;  2UZX B;  5CYK A;  3C75 H;  3ZWL B;  3OKY A;  3ORV D;  4J0W A;  3JRO A;  3ULE C;  4A08 B;  1U8C A;  2OIZ A;  3IUJ A;  3I7P A;  4PSX B;  4L3G D;  2XL3 A;  4LG9 A;  1UOO A;  1H2Y A;  2YMU A;  3N0E A;  5KDO B;  4J73 A;  5FKQ A;  2AGZ A;  3UR4 A;  4H5I A;  4AN1 A;  5A2Q g;  3FCS A;  4G1E A;  4A09 A;  1GP2 B;  3PVU B;  3NIF A;  3SVW D;  4K3I D;  5GSA A;  3EI3 A;  3IIW A;  2VDL A;  3NVX A;  1GOF A;  4ESG A;  2AQ5 A;  1N6E A;  2J55 H;  2CO0 A;  1JOF A;  1A12 A;  5I5I A;  4J87 A;  5C9Z B;  2GC7 A;  4AMZ A;  3I7N A;  3RLM D;  3EQ7 A;  3C99 A;  3UVM A;  3O4I A;  2H9P A;  1RI6 A;  3FGB A;  4JSP C;  5TEF A;  3O4H A;  3JZG A;  4L1Q D;  4A0B B;  2IUV A;  3MXX A;  4BH6 A;  3IUQ A;  4CI1 A;  3RN0 D;  4FB1 D;  1N6F A;  3SHF A;  1B9Y A;  5C2V B;  3DDU A;  3SBQ A;  2O9K A;  1K8K C;  4A08 A;  3T3M A;  4X3E A;  1E8N A;  4FA1 D;  3QHY B;  5C86 A;  4LG8 A;  4YVD A;  4NSX A;  3MKS B;  4CY2 A;  5I5J A;  1GOT B;  4PBY A;  5SXM A;  3BG1 A;  4A2L A;  4D0K A;  4GQB B;  2IWK A;  3BG0 A;  3RN1 D;  3EI2 A;  2I0R A;  4GM8 A;  5HDB A;  4J0X A;  3NID A;  4GM9 A;  3UKU C;  4GGC A;  4O3T B;  4UM8 A;  4BCC A;  2XU7 A;  3BWS A;  3RSE C;  1K3I A;  4FA5 D;  1NEX B;  4J81 A;  4UM9 A;  4EWR A;  5CXC B;  1GG2 B;  5IJ8 E;  5HQG A;  2YBA A;  3UKR C;  5I5M A;  3K6S A;  4O1Q D;  4J84 A;  3OL2 A;  2P9K C;  2XE4 A;  1VYH C;  3C5M A;  3OKY B;  5E6R A;  5H1M A;  2HYE A;  3IUN A;  2QR5 A;  3GC3 B;  3PXW D;  1TYQ C;  2HES X;  3W15 A;  3EWE A;  1JMZ B;  4A0B A;  2AGX A;  2XL2 A;  2HXC A;  3IUR A;  2OVR B;  5E6S A;  3UVK A;  3K72 A;  3ZE1 A;  3DXM C;  2IUP A;  4A09 B;  5M5R A;  3SCY A;  5FA5 B;  3IJ0 A;  1JMX B;  4J77 A;  1A0R B;  2H68 A;  4BCD A;  3EQ8 A;  3PXT D;  3EI4 A;  3JZN A;  4IRZ A;  4MMZ A;  5EAP A;  4G55 A;  3OKT A;  2VDP A;  4L1M A;  4X60 B;  3K27 A;  4X63 B;  4FAN D;  2B5M A;  1P22 A;  3I7O A;  4J78 A;  4J8G A;  2P9U C;  4XEI C;  5CXC A;  5IT9 g;  5AFU 3;  2IAA A;  4Y5R D;  3I89 A;  2P9P C;  2AGL A;  3MZL A;  3RFG A;  4UI9 R;  4QL1 A;  2BCJ B;  2TRC B;  4XYI A;  4L9O A;  2CE9 A;  2VZ3 A;  2B5L A;  2EIC A;  1MG3 A;  2IWF A;  1TYE A;  3JRP A;  1XHM A;  3I7L A;  1SHY B;  4MMY A;  3ZE0 A;  3NVQ A;  4FWW A;  4NC4 A;  5C2W B;  1B9X A;  3EG6 A;  4RE6 A;  1XKS A;  4DNW A;  2P9I C;  4PXW A;  3V7D B;  1YR2 A;  1K32 A;  2Z2N A;  1U2V C;  5CXB B;  5JWZ A;  3J81 g;  1YFQ A;  3EI2 B;  2PBI B;  3OW8 A;  3SMR A;  2XZG A;  2CE8 A;  3UVN A;  4BUJ C;  4QT8 A;  5HE2 B;  2H14 A;  2VDR A;  3V4P A;  1VE6 A;  2VDQ A;  2IUQ A;  2H47 A;  3GRE A;  1C9L A;  3AL8 A;  4JD2 C;  4OWR A;  3SFZ A;  3UVL A;  4JT5 C;  1VZ2 A;  4E5Z A;  2HU7 A;  3RMZ D;  2GNQ A;  3IKO A;  3OL2 B;  5IGQ A;  2HJ4 A;  5HE3 B;  4JXM A;  4JHP C;  4Z7N A;  1XIP A;  3GD1 I;  3I7H A;  3DXK C;  4ZOV A;  1GOG A;  4KFM B;  1R5M A;  4J79 A;  4QAM A;  2EIB A;  2EBS A;  3RFH A;  3IIY A;  1UTC A;  2HKM A;  4PSW B;  2UZY B;  5IC7 A;  3VI4 A;  2QXV A;  2AGW A;  3JAM g;  4BP8 A;  4PNK B;  2XDW A;  3PSL A;  2CO0 C;  2I0T A;  3IUL A;  3PSC B;  1U4C A;  5FQD A;  5FKR A;  2CN2 A;  3I7K A;  1N6D A;  3NVN A;  3EI4 B;  2OVQ B;  2AGY A;  4BCB A;  5EMK B;  4U1E I;  4BP9 A;  5CXB A;  4CI3 A;  4WK2 A;  4RE5 A;  4A0A B;  2AH0 A;  2I3T A;  5FFG A;  2VDO A;  1NR0 A; 
#chains in the Genus database with same CATH homology
 4TZ4 A;  1ERJ A;  5EML B;  3RRM C;  3ODT A;  5EAM A;  4GGA A;  3AFC A;  2P9L C;  4O3U B;  4BL0 A;  2Q7Q A;  5B4W A;  3V9F A;  4ZN4 A;  1Q47 A;  5EAL A;  2H6N A;  2PM7 B;  3SXT D;  3SLE D;  3I8E A;  3DWL C;  3U4Y A;  1MG2 A;  5TDH B;  3AL9 A;  3MKQ A;  4K3J B;  1S4U X;  3F3P A;  4JSX C;  4OZU A;  3P4F A;  3CFV A;  1SQ9 A;  4FA9 D;  2QC5 A;  4I79 A;  3I2N A;  4A7J A;  5FKS A;  4JSN C;  3OTT A;  1QNI A;  2HJB A;  3N0D A;  5THA A;  3AL8 B;  4R7A B;  5K19 A;  5H17 A;  4A0A A;  3A0F A;  3F3G A;  4E5Z B;  3DSM A;  4ES0 A;  3C9C A;  4ERZ A;  4E54 A;  4PBZ A;  2Z2O A;  2HKR A;  2Z2P A;  5EMJ B;  4FA4 D;  4GMB A;  1OMW B;  4O9D A;  4HDJ A;  4CY5 A;  4GGD A;  3V5W B;  5EAR A;  4G56 B;  3MMY A;  3VGZ A;  2CNX A;  4FHL A;  3KRW B;  3PVW B;  4GQ2 P;  3GFC A;  1PI6 A;  2H6K A;  4CY1 A;  4CZX A;  4ZOZ A;  4ZOY A;  2I3S A;  3HFQ A;  4LGN A;  2J57 G;  3SBR A;  4AEZ A;  5H14 A;  3PXS D;  2IUR A;  4QRJ A;  2H9N A;  5GXH A;  1TBG A;  2YNN A;  5K1C C;  1PEV A;  2H9L A;  2W18 A;  1OLZ A;  4A11 A;  3SN6 B;  4CZV A;  3JB9 L;  3DM0 A;  3CIK B;  2GC4 A;  2H9M A;  3EU7 A;  1PGU A;  4CI8 A;  5GXI A;  3SBP A;  3JPX A;  1FWX A;  3MZK A;  5HYN B;  3F3F A;  4AOW A;  3PE7 A;  3E0C A;  3SJL D;  4FAV D;  2BBK H;  3EI1 B;  3L4M D;  4JSV C;  2CN3 A;  2OVP B;  2J56 H;  3EMH A;  3B7F A;  2MTA H;  4J82 A;  5IJ7 E;  2YB8 B;  4IA9 A;  2PM9 B;  2OK4 A;  5GMK n;  3KRX B;  3SWS D;  2P9S C;  4GZ8 A;  3J80 g;  5EM2 B;  1SQJ A;  4ZOX A;  5FKT A;  4CI2 A;  4E54 B;  4IMM A;  2AH1 A;  2YNO A;  1JJU B;  5AJA A;  4QQE A;  4X61 B;  3JZH A;  2G99 A;  2PM6 B;  2YNP A;  3CFS B;  4JT6 C;  3VH0 A;  2B4E A;  3OKW A;  4CC9 A;  2G9A A;  5AMS A;  5HE0 B;  1PBY B;  2H13 A;  4ERQ A;  3EI1 A;  3IJC A;  5FXY A;  2OJY A;  2H3X A;  5CYK B;  4A2M A;  2P9N C;  3K26 A;  4MK0 B;  2H6Q A;  4D6V A;  5HE1 B;  2PM9 A;  3I8C A;  5FLX g;  4Y7R A;  4Z8L A;  1MDA H;  4A11 B;  4H5J A;  4U7A A;  5EM2 A;  1GXR A;  2XYI A;  4GQ1 A;  4GM3 A;  5TF2 A;  3EI3 B;  4CY3 A;  3FRX A;  4J86 A;  2OK6 A;  3IJ1 A;  4PC0 A;  3UVO A;  5IGO A;  3AH8 B;  4XYH A;  3L4O D;  3FM0 A;  4J8B A;  2B5N A;  4N14 A;  1L0Q A;  4ERY A;  4CZY A;  4O45 A;  5TEE A;  3VA6 A;  5EMM B;  2I0S A;  4L3H D;  2UZX B;  5CYK A;  3C75 H;  3ZWL B;  3OKY A;  3ORV D;  4J0W A;  3JRO A;  3ULE C;  4A08 B;  4PSX B;  2OIZ A;  3I7P A;  4L3G D;  2XL3 A;  4LG9 A;  2YMU A;  3N0E A;  5KDO B;  4J73 A;  5FKQ A;  2AGZ A;  3UR4 A;  4H5I A;  5A2Q g;  4A09 A;  1GP2 B;  3PVU B;  3SVW D;  4K3I D;  5GSA A;  3EI3 A;  3IIW A;  3NVX A;  4ESG A;  2AQ5 A;  1N6E A;  2J55 H;  2CO0 A;  1JOF A;  5I5I A;  4J87 A;  5C9Z B;  2GC7 A;  3I7N A;  3RLM D;  3C99 A;  3UVM A;  2H9P A;  1RI6 A;  3FGB A;  4JSP C;  5TEF A;  3JZG A;  4L1Q D;  4A0B B;  2IUV A;  3MXX A;  4BH6 A;  4CI1 A;  3RN0 D;  4FB1 D;  1N6F A;  3SHF A;  1B9Y A;  5C2V B;  3SBQ A;  2O9K A;  1K8K C;  4A08 A;  4X3E A;  4FA1 D;  4LG8 A;  4YVD A;  4NSX A;  3MKS B;  4CY2 A;  5I5J A;  1GOT B;  4PBY A;  5SXM A;  3BG1 A;  4A2L A;  4D0K A;  4GQB B;  2IWK A;  3BG0 A;  3RN1 D;  3EI2 A;  2I0R A;  4GM8 A;  4J0X A;  4GM9 A;  3UKU C;  4GGC A;  4O3T B;  2XU7 A;  3BWS A;  3RSE C;  4FA5 D;  1NEX B;  4J81 A;  4EWR A;  5CXC B;  1GG2 B;  5IJ8 E;  5HQG A;  2YBA A;  3UKR C;  5I5M A;  4O1Q D;  4J84 A;  3OL2 A;  2P9K C;  1VYH C;  3C5M A;  3OKY B;  5H1M A;  2HYE A;  3PXW D;  1TYQ C;  2HES X;  3W15 A;  3EWE A;  1JMZ B;  4A0B A;  2AGX A;  2XL2 A;  2HXC A;  2OVR B;  3UVK A;  3DXM C;  2IUP A;  4A09 B;  3SCY A;  5FA5 B;  3IJ0 A;  1JMX B;  4J77 A;  1A0R B;  2H68 A;  3PXT D;  3EI4 A;  3JZN A;  5EAP A;  3OKT A;  4X60 B;  3K27 A;  4X63 B;  4FAN D;  2B5M A;  1P22 A;  3I7O A;  4J78 A;  4J8G A;  2P9U C;  4XEI C;  5CXC A;  5IT9 g;  5AFU 3;  2IAA A;  4Y5R D;  3I89 A;  2P9P C;  2AGL A;  3MZL A;  3RFG A;  4UI9 R;  4QL1 A;  2BCJ B;  2TRC B;  4XYI A;  4L9O A;  2CE9 A;  2B5L A;  1MG3 A;  2IWF A;  3JRP A;  1XHM A;  3I7L A;  1SHY B;  3NVQ A;  4FWW A;  5C2W B;  1B9X A;  3EG6 A;  1XKS A;  2P9I C;  4PXW A;  3V7D B;  1K32 A;  2Z2N A;  1U2V C;  5CXB B;  5JWZ A;  3J81 g;  1YFQ A;  3EI2 B;  2PBI B;  3OW8 A;  3SMR A;  4BUJ C;  2CE8 A;  3UVN A;  4QT8 A;  5HE2 B;  2H14 A;  2IUQ A;  2H47 A;  3GRE A;  3AL8 A;  4JD2 C;  4OWR A;  3SFZ A;  3UVL A;  4JT5 C;  4E5Z A;  3RMZ D;  2GNQ A;  3IKO A;  3OL2 B;  5IGQ A;  2HJ4 A;  5HE3 B;  4JXM A;  1XIP A;  3I7H A;  3DXK C;  4ZOV A;  4KFM B;  1R5M A;  4J79 A;  3RFH A;  2EBS A;  3IIY A;  2HKM A;  4PSW B;  2UZY B;  5IC7 A;  2QXV A;  2AGW A;  3JAM g;  4PNK B;  3PSL A;  2CO0 C;  2I0T A;  3PSC B;  1U4C A;  5FQD A;  5FKR A;  2CN2 A;  3I7K A;  1N6D A;  3NVN A;  3EI4 B;  2OVQ B;  2AGY A;  5EMK B;  4U1E I;  4CI3 A;  5CXB A;  4A0A B;  2AH0 A;  2I3T A;  1NR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...