3ZDXA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
457
structure length
457
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 457
sequence length 457
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdxA00
2VDMA 3ZE0A 3NIGA 4G1MA 4G1EA 3V4VA 5E6UA 3T3MA 4Z7OA 4UM8A 2VDOA 3NIFA 2VC2A 4MMZA 3ZDYA 3V4PA 3ZE1A 2VDLA 3FCUA 3FCSA 4WJKA 4Z7NA 3K6SA 2VDRA 1U8CA 3VI4A 4MMXA 5FFGA 3ZDZA 3IJEA 4Z7QA 1M1XA 3VI3A 5FFOA 3NIDA 3K71A 4WK0A 2VDQA 3K72A 1JV2A 3ZDXA 2VDKA 4UM9A 3T3PA 2VDPA 4NENA 4WK4A 5E6SA 3ZE2A 4O02A 4WK2A 5E6RA 1L5GA 2VDNA 4MMYA 5HDBA 1TYEA 4IRZA
chains in the Genus database with same CATH superfamily
3SFZA 2H13A 2OVQB 4A0BB 5I5MA 2VDOA 3K26A 4NSXA 3FCUA 4ZN4A 1PI6A 3SBQA 2P9PC 1U8CA 2YNPA 3C99A 1XHMA 2B5NA 2H47A 3OKYB 3RLMD 4LG8A 3B7FA 3O4JA 5EARA 3K71A 3NVQA 4G55A 1MG2A 1XIPA 5HE1B 4DNUA 3GREA 1L0QA 2VZ3A 5FXYA 4U7AA 2HKRA 3EQ8A 4YVDA 3F3GA 3RRMC 1ERJA 3EI1A 4A0AB 2G9AA 3V7DB 2Z2NA 4Z7OA 2GNQA 5GXIA 3RMZD 2OVRB 3AH8B 4QAMA 3J81g 1NR0A 2HXCA 2IAAA 3FM0A 2IUPA 3EI4A 5FFGA 2I3SA 3VGZA 2XYIA 5FFOA 5THAA 4AN0A 4PBYA 1QFMA 5CXBA 3DM0A 4Y5RD 4J79A 2EIBA 4MK0B 4WK4A 4WK2A 3SLED 4CI2A 2I0RA 1A12A 5JWZA 4G1EA 4X60B 2XE4A 2P9LC 3N0DA 3DDUA 1YFQA 4I79A 4NBMA 3JAMg 3NVXA 2O9KA 3ZDZA 3IJCA 3UKRC 5FQDA 4A09B 4A08B 4CI8A 5GSAA 5TEFA 3RFHA 3RN1D 1K32A 3F3PA 2VDPA 2P9SC 3PXWD 3JROA 3A0FA 2P9KC 4O3UB 5EAPA 3CIKB 2Z2OA 3SHFA 3ZE1A 3UVOA 3C75H 1NEXB 2CE9A 2Z2PA 3IUNA 1RI6A 2TRCB 4E54B 2AGYA 5EMMB 1H2WA 2IUQA 4FWWA 4CZVA 4LGNA 4JSNC 4Z8LA 3AL8A 1VZ2A 2B5LA 2J56H 2P9IC 2GC7A 3OKWA 3I7OA 4AX4A 2OK6A 1H2ZA 5E6RA 5IC7A 2YNOA 2YNNA 1TYEA 2HYEA 1UOOA 3MVDK 4GM3A 3ZDYA 3E0CA 2BCJB 3I7NA 1UOQA 2P9UC 5H1MA 4Z7NA 5HQGA 5AMSA 1A0RB 2AGZA 3PXSD 4K3JB 3UVKA 5AFU3 4E5ZA 1GOTB 2WQ8A 4BCCA 3N0EA 4CI3A 4BH6A 3ODTA 4O3TB 2QZPA 4BCDA 1GOFA 4ERZA 1B9YA 5HDBA 5HYNB 5C86A 3EI3B 2JKXA 2I0TA 3ZE0A 2H9MA 4E54A 3AFCA 4FA9D 2H9NA 2YMUA 5C92A 2HJ4A 4DNVA 3QHYB 5FA5B 1YR2A 1C9IA 4J82A 1M1XA 3U4YA 3PVUB 2IWKA 4PNKB 1B9XA 1P22A 3ZDXA 1JOFA 1PGUA 4NENA 4X61B 4GGDA 4LG9A 2VDNA 1S4UX 2HU8A 1SQ9A 3NIGA 4G1MA 5M5UA 2AGLA 4JSXC 5FKTA 4AEZA 2PM7B 1N6EA 2XZGA 4JT5C 1C9LA 2GC4A 4JT6C 5CXCB 4A11B 4ZOXA 5H14A 3SVWD 5K19A 3DXMC 2B4EA 4G56B 4O9DA 3OL2A 3JZHA 4J78A 4X3EA 3L4MD 4GGAA 5EMJB 3SN6B 3ZE2A 1E8MA 3JPXA 4JHPC 4A0BA 4CZXA 3K27A 5TDHB 2HJBA 4QQEA 4ZOZA 5HE0B 1N6FA 4IRZA 4BCBA 3V4VA 4BUJC 3SBRA 2VC2A 4ERYA 3V4PA 4O2WA 4O1QD 3OKYA 5FKQA 1MG3A 2I3TA 4CY1A 3IJEA 1PEVA 4FHLA 2XL2A 4TZ4A 1TBGA 3RSEC 4D6VA 1JMZB 4CC9A 5GMKn 1JJUB 3OKTA 3EI2B 2I0SA 3EU7A 2HESX 3HFQA 4H5IA 4O02A 1T2XA 2CO0A 3UVLA 4A0AA 4HDJA 4MMYA 3JB9L 4DNWA 1OMWB 3QI0A 2IWFA 3GFCA 1OLZA 1VE6A 2AGWA 2HU5A 3JZNA 4A11A 4MMZA 2BBKH 3SMRA 2QC5A 4J86A 2OIZA 4J8GA 3NVNA 5HE3B 3IULA 3DWLC 1SHYB 3MUOA 3MKSB 4L3GD 4X63B 1TYQC 3SJLD 2B5MA 3ZWLB 2CNXA 3I89A 3ORVD 4RE6A 2VDQA 4OWRA 4D0KA 4FAND 5IJ8E 3MXXA 5IT9g 1H2YA 4K3ID 1L5GA 4R7AB 3PSCB 3DXKC 4GQ2P 1QNIA 5TEEA 3RFGA 3FCSA 2EICA 4L9OA 1R5MA 2VDRA 1O6GA 4PSXB 3CFVA 4QL1A 4FAVD 5K1CC 3EI2A 4A08A 4A09A 5EM2B 4QRJA 5CYKB 2UZXB 2AH1A 3SBPA 4O45A 4CY5A 2EIDA 3GD1I 4ZOYA 5C2WB 5FKSA 3I7KA 2HU7A 2CN2A 3PE7A 3V5WB 4FB1D 4XEIC 4PSWB 4JXMA 3ULEC 5GXHA 3C5MA 3T3MA 1K3IA 2J57G 4L1QD 4H5JA 3IUJA 3EI1B 1U2VC 3FGBA 2H14A 5AJAA 3AL9A 1XKSA 4IA9A 2H9PA 2OVPB 4XYHA 5KDOB 2H6NA 3UVNA 4AN1A 5C9ZB 4AOWA 3V9FA 4N14A 4L1MA 3GC3B 4JHNA 3FRXA 3OTTA 1GG2B 4AMZA 1GXRA 3T3PA 4GGCA 5CXBB 2H6QA 3PVWB 4PXWA 4GM8A 4U1EI 4PBZA 3J80g 2XDWA 3O4GA 4NAAA 3OF7A 5EM2A 4J81A 2VDLA 5CYKA 4KFMB 3W15A 4WJKA 1VYHC 3KRWB 3IUQA 4MMXA 4BP9A 4ESGA 4L3HD 4J0XA 3SCYA 5IJ7E 5FKRA 2YBAA 2AGXA 4J87A 2CE8A 3L4OD 2OJYA 2BKLA 2XL3A 3NIDA 2H68A 4PC0A 5EAMA 2H9LA 3UKUC 2MTAH 3SWSD 3K72A 2Q7QA 3EI3A 3EWEA 3O4HA 1GOGA 3BG1A 3EG6A 4ERQA 4GZ8A 4FA4D 2PM6B 2UZYB 2IURA 2VZ1A 5IGQA 3BG0A 2EIEA 5A2Qg 1E5TA 1UOPA 1MDAH 4D9SA 5I5JA 2G99A 3K6SA 1GOHA 4RE5A 4A2LA 5C2VB 1VZ3A 2AQ5A 3IUMA 5M5SA 2VDKA 5EMKB 4A7JA 4J73A 3AL8B 1Q47A 3O4IA 5EALA 1E8NA 3IKOA 1O6FA 3OW8A 4GMBA 2W18A 4UM8A 5CXCA 4AMYA 4QT8A 4IMMA 1GP2B 5HE2B 4GQBB 1PBYB 3KCIA 5TF2A 1SQJA 1N6DA 1QFSA 2H3XA 3DSMA 3IIYA 4ZOVA 3SXTD 5M5VA 2OK4A 5M5RA 4E5ZB 3IVMA 4CZYA 1JV2A 3VA6A 3I7LA 1BPOA 2PM9B 2AH0A 4UM9A 3MMYA 5E6SA 4JD2C 3I2NA 5EMLB 4ES0A 3EQ7A 2VDMA 2XU7A 5E6UA 4OZUA 3EQ9A 3IURA 3JRPA 4J0WA 4UI9R 2CO0C 3I8EA 3UVMA 3KRXB 2YB8B 3UR4A 3VH0A 2PBIB 5IGOA 4BL0A 1K8KC 3I7HA 3PXTD 5I5IA 3IIWA 3EMHA 2P9NC 4CY3A 2H6KA 4XYIA 3IJ0A 3IJ1A 4WK0A 3JZGA 4GM9A 4J77A 4J8BA 1JMXB 2IUVA 4BP8A 5FLXg 2HKMA 4J84A 2J55H 3CFSB 3PSLA 3I7PA 4CY2A 1FWXA 1JTDB 4JSPC 5SXMA 1UTCA 3NIFA 4GQ1A 2CN3A 1U4CA 4A2MA 5M61A 3I8CA 3MZKA 3MUNA 3MZLA 3VI4A 3F3FA 4JSVC 3C9CA 1I2MB 1VE7A 2EBSA 3MKQA 4FA5D 3RN0D 4Z7QA 2PM9A 5H17A 3VI3A 2QXVA 3P4FA 1H2XA 3EI4B 4FA1D 4CI1A 3BWSA 2QR5A 5B4WA 3OL2B 4Y7RA 5M5TA 4NC4A 4EWRA
chains in the Genus database with same CATH topology
2VDMA 3ZE0A 3NIGA 4G1MA 4G1EA 3V4VA 5E6UA 3T3MA 4Z7OA 4UM8A 2VDOA 3NIFA 2VC2A 4MMZA 3ZDYA 3V4PA 3ZE1A 2VDLA 3FCUA 3FCSA 4WJKA 4Z7NA 3K6SA 2VDRA 1U8CA 3VI4A 4MMXA 5FFGA 3ZDZA 3IJEA 4Z7QA 1M1XA 3VI3A 5FFOA 3NIDA 3K71A 4WK0A 2VDQA 3K72A 1JV2A 3ZDXA 2VDKA 4UM9A 3T3PA 2VDPA 4NENA 4WK4A 5E6SA 3ZE2A 4O02A 4WK2A 5E6RA 1L5GA 2VDNA 4MMYA 5HDBA 1TYEA 4IRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDM A;  3ZE0 A;  3NIG A;  4G1M A;  4G1E A;  3V4V A;  5E6U A;  3T3M A;  4Z7O A;  4UM8 A;  2VDO A;  3NIF A;  2VC2 A;  4MMZ A;  3ZDY A;  3V4P A;  3ZE1 A;  2VDL A;  3FCU A;  3FCS A;  4WJK A;  4Z7N A;  3K6S A;  2VDR A;  1U8C A;  3VI4 A;  4MMX A;  5FFG A;  3ZDZ A;  3IJE A;  4Z7Q A;  1M1X A;  3VI3 A;  5FFO A;  3NID A;  3K71 A;  4WK0 A;  2VDQ A;  3K72 A;  1JV2 A;  3ZDX A;  2VDK A;  4UM9 A;  3T3P A;  2VDP A;  4NEN A;  4WK4 A;  5E6S A;  3ZE2 A;  4O02 A;  4WK2 A;  5E6R A;  1L5G A;  2VDN A;  4MMY A;  5HDB A;  1TYE A;  4IRZ A; 
#chains in the Genus database with same CATH topology
 3SFZ A;  2H13 A;  2OVQ B;  4A0B B;  5I5M A;  2VDO A;  3K26 A;  4NSX A;  3FCU A;  4ZN4 A;  1PI6 A;  3SBQ A;  2P9P C;  1U8C A;  2YNP A;  3C99 A;  1XHM A;  2B5N A;  2H47 A;  3OKY B;  3RLM D;  4LG8 A;  3B7F A;  3O4J A;  5EAR A;  3K71 A;  3NVQ A;  4G55 A;  1MG2 A;  1XIP A;  5HE1 B;  4DNU A;  3GRE A;  1L0Q A;  2VZ3 A;  5FXY A;  4U7A A;  2HKR A;  3EQ8 A;  4YVD A;  3F3G A;  3RRM C;  1ERJ A;  3EI1 A;  4A0A B;  2G9A A;  3V7D B;  2Z2N A;  4Z7O A;  2GNQ A;  5GXI A;  3RMZ D;  2OVR B;  3AH8 B;  4QAM A;  3J81 g;  1NR0 A;  2HXC A;  2IAA A;  3FM0 A;  2IUP A;  3EI4 A;  5FFG A;  2I3S A;  3VGZ A;  2XYI A;  5FFO A;  5THA A;  4AN0 A;  4PBY A;  1QFM A;  5CXB A;  3DM0 A;  4Y5R D;  4J79 A;  2EIB A;  4MK0 B;  4WK4 A;  4WK2 A;  3SLE D;  4CI2 A;  2I0R A;  1A12 A;  5JWZ A;  4G1E A;  4X60 B;  2XE4 A;  2P9L C;  3N0D A;  3DDU A;  1YFQ A;  4I79 A;  4NBM A;  3JAM g;  3NVX A;  2O9K A;  3ZDZ A;  3IJC A;  3UKR C;  5FQD A;  4A09 B;  4A08 B;  4CI8 A;  5GSA A;  5TEF A;  3RFH A;  3RN1 D;  1K32 A;  3F3P A;  2VDP A;  2P9S C;  3PXW D;  3JRO A;  3A0F A;  2P9K C;  4O3U B;  5EAP A;  3CIK B;  2Z2O A;  3SHF A;  3ZE1 A;  3UVO A;  3C75 H;  1NEX B;  2CE9 A;  2Z2P A;  3IUN A;  1RI6 A;  2TRC B;  4E54 B;  2AGY A;  5EMM B;  1H2W A;  2IUQ A;  4FWW A;  4CZV A;  4LGN A;  4JSN C;  4Z8L A;  3AL8 A;  1VZ2 A;  2B5L A;  2J56 H;  2P9I C;  2GC7 A;  3OKW A;  3I7O A;  4AX4 A;  2OK6 A;  1H2Z A;  5E6R A;  5IC7 A;  2YNO A;  2YNN A;  1TYE A;  2HYE A;  1UOO A;  3MVD K;  4GM3 A;  3ZDY A;  3E0C A;  2BCJ B;  3I7N A;  1UOQ A;  2P9U C;  5H1M A;  4Z7N A;  5HQG A;  5AMS A;  1A0R B;  2AGZ A;  3PXS D;  4K3J B;  3UVK A;  5AFU 3;  4E5Z A;  1GOT B;  2WQ8 A;  4BCC A;  3N0E A;  4CI3 A;  4BH6 A;  3ODT A;  4O3T B;  2QZP A;  4BCD A;  1GOF A;  4ERZ A;  1B9Y A;  5HDB A;  5HYN B;  5C86 A;  3EI3 B;  2JKX A;  2I0T A;  3ZE0 A;  2H9M A;  4E54 A;  3AFC A;  4FA9 D;  2H9N A;  2YMU A;  5C92 A;  2HJ4 A;  4DNV A;  3QHY B;  5FA5 B;  1YR2 A;  1C9I A;  4J82 A;  1M1X A;  3U4Y A;  3PVU B;  2IWK A;  4PNK B;  1B9X A;  1P22 A;  3ZDX A;  1JOF A;  1PGU A;  4NEN A;  4X61 B;  4GGD A;  4LG9 A;  2VDN A;  1S4U X;  2HU8 A;  1SQ9 A;  3NIG A;  4G1M A;  5M5U A;  2AGL A;  4JSX C;  5FKT A;  4AEZ A;  2PM7 B;  1N6E A;  2XZG A;  4JT5 C;  1C9L A;  2GC4 A;  4JT6 C;  5CXC B;  4A11 B;  4ZOX A;  5H14 A;  3SVW D;  5K19 A;  3DXM C;  2B4E A;  4G56 B;  4O9D A;  3OL2 A;  3JZH A;  4J78 A;  4X3E A;  3L4M D;  4GGA A;  5EMJ B;  3SN6 B;  3ZE2 A;  1E8M A;  3JPX A;  4JHP C;  4A0B A;  4CZX A;  3K27 A;  5TDH B;  2HJB A;  4QQE A;  4ZOZ A;  5HE0 B;  1N6F A;  4IRZ A;  4BCB A;  3V4V A;  4BUJ C;  3SBR A;  2VC2 A;  4ERY A;  3V4P A;  4O2W A;  4O1Q D;  3OKY A;  5FKQ A;  1MG3 A;  2I3T A;  4CY1 A;  3IJE A;  1PEV A;  4FHL A;  2XL2 A;  4TZ4 A;  1TBG A;  3RSE C;  4D6V A;  1JMZ B;  4CC9 A;  5GMK n;  1JJU B;  3OKT A;  3EI2 B;  2I0S A;  3EU7 A;  2HES X;  3HFQ A;  4H5I A;  4O02 A;  1T2X A;  2CO0 A;  3UVL A;  4A0A A;  4HDJ A;  4MMY A;  3JB9 L;  4DNW A;  1OMW B;  3QI0 A;  2IWF A;  3GFC A;  1OLZ A;  1VE6 A;  2AGW A;  2HU5 A;  3JZN A;  4A11 A;  4MMZ A;  2BBK H;  3SMR A;  2QC5 A;  4J86 A;  2OIZ A;  4J8G A;  3NVN A;  5HE3 B;  3IUL A;  3DWL C;  1SHY B;  3MUO A;  3MKS B;  4L3G D;  4X63 B;  1TYQ C;  3SJL D;  2B5M A;  3ZWL B;  2CNX A;  3I89 A;  3ORV D;  4RE6 A;  2VDQ A;  4OWR A;  4D0K A;  4FAN D;  5IJ8 E;  3MXX A;  5IT9 g;  1H2Y A;  4K3I D;  1L5G A;  4R7A B;  3PSC B;  3DXK C;  4GQ2 P;  1QNI A;  5TEE A;  3RFG A;  3FCS A;  2EIC A;  4L9O A;  1R5M A;  2VDR A;  1O6G A;  4PSX B;  3CFV A;  4QL1 A;  4FAV D;  5K1C C;  3EI2 A;  4A08 A;  4A09 A;  5EM2 B;  4QRJ A;  5CYK B;  2UZX B;  2AH1 A;  3SBP A;  4O45 A;  4CY5 A;  2EID A;  3GD1 I;  4ZOY A;  5C2W B;  5FKS A;  3I7K A;  2HU7 A;  2CN2 A;  3PE7 A;  3V5W B;  4FB1 D;  4XEI C;  4PSW B;  4JXM A;  3ULE C;  5GXH A;  3C5M A;  3T3M A;  1K3I A;  2J57 G;  4L1Q D;  4H5J A;  3IUJ A;  3EI1 B;  1U2V C;  3FGB A;  2H14 A;  5AJA A;  3AL9 A;  1XKS A;  4IA9 A;  2H9P A;  2OVP B;  4XYH A;  5KDO B;  2H6N A;  3UVN A;  4AN1 A;  5C9Z B;  4AOW A;  3V9F A;  4N14 A;  4L1M A;  3GC3 B;  4JHN A;  3FRX A;  3OTT A;  1GG2 B;  4AMZ A;  1GXR A;  3T3P A;  4GGC A;  5CXB B;  2H6Q A;  3PVW B;  4PXW A;  4GM8 A;  4U1E I;  4PBZ A;  3J80 g;  2XDW A;  3O4G A;  4NAA A;  3OF7 A;  5EM2 A;  4J81 A;  2VDL A;  5CYK A;  4KFM B;  3W15 A;  4WJK A;  1VYH C;  3KRW B;  3IUQ A;  4MMX A;  4BP9 A;  4ESG A;  4L3H D;  4J0X A;  3SCY A;  5IJ7 E;  5FKR A;  2YBA A;  2AGX A;  4J87 A;  2CE8 A;  3L4O D;  2OJY A;  2BKL A;  2XL3 A;  3NID A;  2H68 A;  4PC0 A;  5EAM A;  2H9L A;  3UKU C;  2MTA H;  3SWS D;  3K72 A;  2Q7Q A;  3EI3 A;  3EWE A;  3O4H A;  1GOG A;  3BG1 A;  3EG6 A;  4ERQ A;  4GZ8 A;  4FA4 D;  2PM6 B;  2UZY B;  2IUR A;  2VZ1 A;  5IGQ A;  3BG0 A;  2EIE A;  5A2Q g;  1E5T A;  1UOP A;  1MDA H;  4D9S A;  5I5J A;  2G99 A;  3K6S A;  1GOH A;  4RE5 A;  4A2L A;  5C2V B;  1VZ3 A;  2AQ5 A;  3IUM A;  5M5S A;  2VDK A;  5EMK B;  4A7J A;  4J73 A;  3AL8 B;  1Q47 A;  3O4I A;  5EAL A;  1E8N A;  3IKO A;  1O6F A;  3OW8 A;  4GMB A;  2W18 A;  4UM8 A;  5CXC A;  4AMY A;  4QT8 A;  4IMM A;  1GP2 B;  5HE2 B;  4GQB B;  1PBY B;  3KCI A;  5TF2 A;  1SQJ A;  1N6D A;  1QFS A;  2H3X A;  3DSM A;  3IIY A;  4ZOV A;  3SXT D;  5M5V A;  2OK4 A;  5M5R A;  4E5Z B;  3IVM A;  4CZY A;  1JV2 A;  3VA6 A;  3I7L A;  1BPO A;  2PM9 B;  2AH0 A;  4UM9 A;  3MMY A;  5E6S A;  4JD2 C;  3I2N A;  5EML B;  4ES0 A;  3EQ7 A;  2VDM A;  2XU7 A;  5E6U A;  4OZU A;  3EQ9 A;  3IUR A;  3JRP A;  4J0W A;  4UI9 R;  2CO0 C;  3I8E A;  3UVM A;  3KRX B;  2YB8 B;  3UR4 A;  3VH0 A;  2PBI B;  5IGO A;  4BL0 A;  1K8K C;  3I7H A;  3PXT D;  5I5I A;  3IIW A;  3EMH A;  2P9N C;  4CY3 A;  2H6K A;  4XYI A;  3IJ0 A;  3IJ1 A;  4WK0 A;  3JZG A;  4GM9 A;  4J77 A;  4J8B A;  1JMX B;  2IUV A;  4BP8 A;  5FLX g;  2HKM A;  4J84 A;  2J55 H;  3CFS B;  3PSL A;  3I7P A;  4CY2 A;  1FWX A;  1JTD B;  4JSP C;  5SXM A;  1UTC A;  3NIF A;  4GQ1 A;  2CN3 A;  1U4C A;  4A2M A;  5M61 A;  3I8C A;  3MZK A;  3MUN A;  3MZL A;  3VI4 A;  3F3F A;  4JSV C;  3C9C A;  1I2M B;  1VE7 A;  2EBS A;  3MKQ A;  4FA5 D;  3RN0 D;  4Z7Q A;  2PM9 A;  5H17 A;  3VI3 A;  2QXV A;  3P4F A;  1H2X A;  3EI4 B;  4FA1 D;  4CI1 A;  3BWS A;  2QR5 A;  5B4W A;  3OL2 B;  4Y7R A;  5M5T A;  4NC4 A;  4EWR A; 
#chains in the Genus database with same CATH homology
 2VDM A;  3ZE0 A;  3NIG A;  4G1M A;  4G1E A;  3V4V A;  5E6U A;  3T3M A;  4Z7O A;  4UM8 A;  2VDO A;  3NIF A;  2VC2 A;  4MMZ A;  3ZDY A;  3V4P A;  3ZE1 A;  2VDL A;  3FCU A;  3FCS A;  4WJK A;  4Z7N A;  3K6S A;  2VDR A;  1U8C A;  3VI4 A;  4MMX A;  5FFG A;  3ZDZ A;  3IJE A;  4Z7Q A;  1M1X A;  3VI3 A;  5FFO A;  3NID A;  3K71 A;  4WK0 A;  2VDQ A;  3K72 A;  1JV2 A;  3ZDX A;  2VDK A;  4UM9 A;  3T3P A;  2VDP A;  4NEN A;  4WK4 A;  5E6S A;  3ZE2 A;  4O02 A;  4WK2 A;  5E6R A;  1L5G A;  2VDN A;  4MMY A;  5HDB A;  1TYE A;  4IRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...