5GMKn

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
405
structure length
299
Chain Sequence
FTKSELKRRRKTRKGDGPWGSWSPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTASMPFLNVHPNYFCAQSMDNRIYSFSKYKRHPKKIHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLIPGNKPITQVDWHPSKVICSGAAGKIYVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 36
structure length 299
sequence length 405
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5gmkn00
3RLMD 3SCYA 1PBYB 3I89A 2BCJB 4K3ID 1QNIA 3EI3A 5EMMB 2H9NA 3JROA 4IA9A 5THAA 5GXHA 1JMXB 2CO0A 4D0KA 4O3TB 3I7NA 4GGCA 4PSWB 2H9MA 4X61B 4AEZA 4PBZA 2OVQB 3AL9A 3NVNA 3RSEC 2HESX 1PI6A 4JD2C 5EARA 3SLED 4J86A 3EI3B 3CFSB 3IJ0A 4XEIC 5SXMA 2HXCA 4PC0A 1N6DA 4U7AA 4FAND 1TYQC 2AGLA 2O9KA 1RI6A 2AGWA 1MG2A 2H13A 4J81A 5FKTA 3IIYA 5K1CC 3DWLC 4J8GA 2J57G 4A2LA 1R5MA 4A11A 5CYKA 4PXWA 3PSCB 4J87A 3SBPA 5GMKn 2GNQA 2AH0A 4PSXB 5EMJB 1N6FA 2YNPA 4O3UB 4GQ2P 4E5ZA 5H1MA 5HE2B 2CNXA 1B9YA 3UKRC 3C99A 3U4YA 5HE1B 1XIPA 1A0RB 4BUJC 3J80g 2IAAA 3W15A 5FLXg 4A09A 4CY5A 5CXCA 4GQ1A 4A11B 1GOTB 4A7JA 5CYKB 4J79A 3F3GA 1JJUB 2IURA 3CIKB 3GFCA 2I3SA 4L3GD 4J0XA 3B7FA 1NEXB 3A0FA 4E5ZB 4QQEA 3AH8B 2AQ5A 4ES0A 4LG9A 4J84A 4A0BA 3EMHA 3UVMA 3DXMC 3PXSD 5GXIA 5C2WB 4A09B 3MZLA 5TEEA 4J73A 4J77A 3RFGA 3I7PA 3JZHA 4CI3A 3KRXB 3EI1A 3SBQA 2I3TA 4ZOVA 4GQBB 3JAMg 1N6EA 3V5WB 4QL1A 4BH6A 5AJAA 2GC4A 2Q7QA 4JXMA 4A0BB 3AL8A 4OZUA 3JRPA 3OKYA 4CY1A 3HFQA 2H6QA 4GM9A 1TBGA 3MXXA 4X60B 2H6KA 4X63B 3C75H 4L9OA 3IJ1A 3I2NA 2IWKA 3JZGA 3EG6A 4ESGA 2H14A 3EI1B 2EBSA 5KDOB 2P9NC 4FHLA 3MKSB 4FB1D 2OIZA 4AOWA 4FAVD 2IUVA 2G9AA 3AL8B 4JSXC 5H14A 4G56B 3SN6B 3OKYB 2MTAH 3C9CA 2OJYA 5EAPA 3VH0A 2IWFA 4GZ8A 3DM0A 4D6VA 2B4EA 3P4FA 5EMKB 3OKWA 4CY3A 2TRCB 3MMYA 3FM0A 4R7AB 2XYIA 5AMSA 4A2MA 5IJ7E 3JZNA 2IUQA 4H5JA 2OK6A 2PM9A 4JT6C 2I0SA 1VYHC 5K19A 2YMUA 3PE7A 4GM3A 2HYEA 5FXYA 3V9FA 4J0WA 3PXTD 5TDHB 4A08A 4XYIA 1JMZB 2YBAA 2OVPB 2GC7A 4H5IA 3FGBA 5GSAA 1GXRA 5CXBA 2PM9B 4NSXA 3OW8A 5IC7A 2XL3A 2J56H 3OTTA 4X3EA 3PSLA 4UI9R 5I5JA 3J81g 4GM8A 2HKMA 3OL2A 5EMLB 4U1EI 1K8KC 3SJLD 4A08B 3ZWLB 4LGNA 4K3JB 4E54A 3RRMC 3JB9L 4JT5C 4CZYA 5CXBB 3BWSA 2J55H 3DXKC 4ZN4A 4BL0A 2B5MA 3L4OD 3UVNA 4ZOXA 3DSMA 5IJ8E 2CE8A 3OL2B 5IT9g 1K32A 2CO0C 5HE3B 4CZVA 2H68A 1YFQA 4HDJA 5HE0B 5JWZA 2OVRB 1FWXA 4FA4D 4E54B 2CN2A 4O45A 3IKOA 2BBKH 5H17A 3KRWB 2YB8B 2AH1A 3EI2A 2XU7A 3EI4A 2HJBA 2P9KC 3CFVA 4OWRA 2HKRA 4ZOYA 5I5IA 1MDAH 4Y7RA 2YNOA 4ERYA 4QRJA 4YVDA 2CN3A 3BG1A 2IUPA 3ULEC 4CI8A 3ODTA 2UZXB 1B9XA 3AFCA 2AGXA 4N14A 3PVUB 3SVWD 5IGQA 3EI2B 3EI4B 2XL2A 5A2Qg 4FWWA 4Z8LA 5EALA 3SMRA 4ERQA 3RN1D 3UVOA 5TF2A 4PNKB 3RN0D 1GP2B 1P22A 3UVKA 4GGDA 2PBIB 3K26A 4LG8A 3RFHA 1JOFA 2G99A 2P9LC 2W18A 5FKRA 1NR0A 2I0TA 2I0RA 2P9UC 3C5MA 4J78A 4A0AA 1S4UX 5FKQA 5HYNB 5AFU3 2CE9A 3I7OA 2P9SC 3I8CA 2QXVA 1SQJA 4JSNC 3V7DB 5TEFA 5I5MA 4J8BA 3ORVD 5B4WA 3VGZA 3K27A 2YNNA 3E0CA 3I7HA 2P9IC 2Z2PA 1L0QA 4IMMA 3PXWD 2QC5A 4A0AB 3IIWA 2Z2NA 4JSVC 4J82A 2H9PA 4O1QD 4QT8A 3MZKA 1Q47A 5EM2A 4PBYA 3IJCA 3JPXA 3UR4A 1SQ9A 2PM6B 2P9PC 5FA5B 2OK4A 4CZXA 1MG3A 2PM7B 1PGUA 3VA6A 3EU7A 5EAMA 3BG0A 4O9DA 4KFMB 5IGOA 5C9ZB 2AGYA 4EWRA 1SHYB 3I8EA 1GG2B 3SHFA 5EM2B 4TZ4A 2H6NA 1PEVA 3SXTD 4ZOZA 3L4MD 2B5NA 4CY2A 5HQGA 3F3FA 4L1QD 2UZYB 3NVQA 4CI1A 2H47A 4GMBA 4FA9D 4FA5D 3N0DA 4XYHA 3MKQA 3SBRA 3SFZA 2HJ4A 2H9LA 3PVWB 4I79A 3EWEA 2B5LA 5CXCB 5FQDA 3RMZD 1U2VC 1OLZA 2H3XA 3F3PA 3OKTA 4CC9A 4CI2A 4FA1D 3SWSD 3I7KA 1ERJA 4Y5RD 4MK0B 2Z2OA 1XHMA 1U4CA 3UVLA 4JSPC 3N0EA 3NVXA 4GGAA 3UKUC 3I7LA 3GREA 4L3HD 2AGZA 3FRXA 5C2VB 4ERZA 1XKSA 5FKSA 1OMWB
chains in the Genus database with same CATH superfamily
4AMZA 1GOFA 3RLMD 3SCYA 4G1EA 1PBYB 5E6RA 1E5TA 1UOOA 3I89A 4NC4A 5FFOA 2BCJB 4K3ID 2QR5A 1QNIA 3EI3A 5E6SA 5EMMB 3EQ7A 2H9NA 3JROA 4IA9A 5THAA 1YR2A 5GXHA 4L1MA 2HU5A 1JMXB 2CO0A 3T3MA 4D0KA 3IJEA 4O3TB 3I7NA 4GGCA 3MUOA 2H9MA 4PSWB 4RE5A 4X61B 4DNWA 4AEZA 4BCDA 3O4JA 4PBZA 2OVQB 3AL9A 3NVNA 3RSEC 2XZGA 2HESX 1PI6A 3VI4A 4JD2C 5EARA 3SLED 4J86A 3EI3B 3CFSB 3IJ0A 4XEIC 5SXMA 2HXCA 4PC0A 1N6DA 4U7AA 4FAND 1TYQC 2JKXA 2AGLA 3K71A 2O9KA 1RI6A 1UOPA 2AGWA 4WK4A 3ZE1A 1MG2A 2H13A 2HU8A 4J81A 5FKTA 2VDQA 1C9IA 3IIYA 5K1CC 3DWLC 4J8GA 2J57G 4A2LA 1R5MA 4BP9A 4A11A 5CYKA 4PXWA 3PSCB 4J87A 5M5RA 3SBPA 5GMKn 2GNQA 2AH0A 4PSXB 1UTCA 4O2WA 5EMJB 1N6FA 2YNPA 4O3UB 4GQ2P 1H2XA 4E5ZA 5H1MA 5HE2B 2CNXA 1B9YA 3UKRC 3C99A 3U4YA 5HE1B 1XIPA 4Z7NA 1A0RB 4BUJC 3J80g 2IAAA 3W15A 5FLXg 4A09A 4AMYA 4NAAA 4CY5A 5CXCA 4GQ1A 4A11B 1GOTB 4A7JA 5CYKB 4J79A 1T2XA 3F3GA 1JJUB 4BCBA 5M5SA 2IURA 3CIKB 3GFCA 2I3SA 4L3GD 4J0XA 3B7FA 1NEXB 3A0FA 4E5ZB 4QQEA 3AH8B 2AQ5A 4ES0A 4LG9A 4J84A 3O4GA 4A0BA 5M5VA 1JTDB 3T3PA 2VDPA 3EMHA 3UVMA 3DXMC 3PXSD 2WQ8A 5C2WB 5GXIA 1O6GA 4A09B 3MZLA 5TEEA 4J73A 4J77A 3RFGA 3I7PA 3JZHA 4CI3A 3KRXB 3EI1A 3IUQA 2I3TA 4JHPC 4ZOVA 4GQBB 3SBQA 3JAMg 1N6EA 3V5WB 4QL1A 4BH6A 5AJAA 2GC4A 2Q7QA 4JXMA 4A0BB 3AL8A 4OZUA 4WK0A 3JRPA 3OKYA 4CY1A 3NIDA 3HFQA 3NIGA 2H6QA 4MMZA 4GM9A 1TBGA 3MXXA 1H2YA 4X60B 2H6KA 4X63B 3C75H 4L9OA 1H2WA 3IJ1A 3I2NA 4JHNA 2IWKA 3JZGA 4WK2A 3EG6A 4ESGA 2H14A 3EI1B 2EBSA 5KDOB 2P9NC 4FHLA 3MKSB 4FB1D 2OIZA 4AOWA 4FAVD 2IUVA 1O6FA 1U8CA 2G9AA 3AL8B 4JSXC 5H14A 4G56B 3SN6B 3OKYB 2MTAH 3C9CA 2OJYA 5EAPA 3VH0A 2IWFA 4GZ8A 4UM9A 3V4VA 5E6UA 3DM0A 3EQ9A 4D6VA 2B4EA 3P4FA 5EMKB 1I2MB 3OKWA 4CY3A 2TRCB 3MMYA 3FM0A 4R7AB 2XYIA 5AMSA 4A2MA 5IJ7E 3JZNA 2IUQA 4H5JA 2OK6A 5M5TA 2PM9A 4JT6C 4WJKA 2I0SA 4BCCA 1VYHC 5K19A 3MVDK 2YMUA 1BPOA 3PE7A 4GM3A 4O02A 2HYEA 5FXYA 3V9FA 3ZE0A 3ZDXA 4J0WA 3GD1I 3PXTD 5TDHB 4A08A 4XYIA 1JMZB 4Z7QA 4AN0A 2YBAA 4BP8A 2OVPB 2GC7A 4AN1A 4H5IA 3FGBA 3IUJA 5GSAA 1GXRA 5CXBA 2PM9B 4NSXA 3OW8A 5IC7A 1VZ3A 2XL3A 2J56H 1E8NA 3OTTA 4X3EA 3PSLA 4UI9R 4Z7OA 5I5JA 4DNUA 3J81g 4GM8A 2HKMA 3OL2A 5EMLB 4U1EI 1K8KC 2XDWA 3SJLD 4A08B 3ZWLB 3GC3B 4LGNA 4K3JB 4E54A 3RRMC 3JB9L 4JT5C 3QHYB 4CZYA 5CXBB 3BWSA 2J55H 3DXKC 4MMXA 4ZN4A 4BL0A 2B5MA 3L4OD 3UVNA 4ZOXA 1VE7A 3DSMA 5IJ8E 2CE8A 3OL2B 5IT9g 1K32A 2CO0C 5HE3B 1QFSA 4CZVA 2H68A 1YFQA 3NIFA 4HDJA 5HE0B 5JWZA 2OVRB 2VDNA 3O4IA 1FWXA 3IUMA 4FA4D 4E54B 5FFGA 4G55A 2CN2A 4O45A 3IKOA 3FCUA 2BBKH 5H17A 3KRWB 2YB8B 2AH1A 3EI2A 2XU7A 3EI4A 2HJBA 2P9KC 3CFVA 2VDOA 3IVMA 4OWRA 2HKRA 4ZOYA 5I5IA 1MDAH 4Y7RA 2YNOA 2VZ1A 4DNVA 4ERYA 5C86A 4QRJA 4YVDA 2CN3A 3BG1A 2IUPA 3ULEC 4G1MA 3ODTA 2UZXB 3ZE2A 1B9XA 4CI8A 2VZ3A 1E8MA 3KCIA 3AFCA 2AGXA 4N14A 3PVUB 2VDMA 3EQ8A 2VC2A 5IGQA 3SVWD 3EI2B 4NENA 3EI4B 2XL2A 4QAMA 5A2Qg 4FWWA 4Z8LA 5EALA 3SMRA 4ERQA 3RN1D 1TYEA 3UVOA 5TF2A 4PNKB 3RN0D 5M61A 1GP2B 1P22A 3UVKA 4GGDA 1K3IA 3OF7A 2VDKA 1C9LA 2PBIB 1A12A 2VDLA 3K26A 4LG8A 4MMYA 3RFHA 1JOFA 2G99A 2P9LC 2W18A 5FKRA 1NR0A 2I0TA 2I0RA 2P9UC 3C5MA 4J78A 3V4PA 4A0AA 2EICA 1S4UX 3K72A 5FKQA 5HYNB 5AFU3 2CE9A 3I7OA 2P9SC 3K6SA 3I8CA 2QXVA 1SQJA 4JSNC 3V7DB 5TEFA 5I5MA 3IURA 3FCSA 3ORVD 1JV2A 4J8BA 1M1XA 5B4WA 4UM8A 3O4HA 4AX4A 3VGZA 2BKLA 3K27A 2VDRA 2YNNA 3E0CA 3I7HA 2P9IC 2Z2PA 1L0QA 4IMMA 5C92A 3PXWD 2QC5A 3ZDYA 4A0AB 1GOGA 3IIWA 3VI3A 4NBMA 2Z2NA 4JSVC 2QZPA 4J82A 2H9PA 3MUNA 4O1QD 1GOHA 4QT8A 3MZKA 1Q47A 4D9SA 5EM2A 4PBYA 3IJCA 3JPXA 3UR4A 1SQ9A 2PM6B 2P9PC 5FA5B 2EIBA 2OK4A 4CZXA 1MG3A 2PM7B 4IRZA 1PGUA 3VA6A 3IULA 2XE4A 3EU7A 5EAMA 3BG0A 4O9DA 4KFMB 5IGOA 5C9ZB 2AGYA 5HDBA 4EWRA 3I8EA 1SHYB 1GG2B 3SHFA 5EM2B 4TZ4A 2H6NA 1L5GA 1PEVA 3SXTD 4ZOZA 3L4MD 2B5NA 4CY2A 5HQGA 3F3FA 4L1QD 2UZYB 3NVQA 4CI1A 2H47A 5M5UA 4GMBA 4FA9D 4FA5D 3N0DA 1VE6A 4XYHA 3MKQA 3SBRA 3SFZA 2HJ4A 2H9LA 1VZ2A 2EIDA 2HU7A 3PVWB 3EWEA 4I79A 3QI0A 2B5LA 5CXCB 5FQDA 3RMZD 1U2VC 1OLZA 2H3XA 3F3PA 3OKTA 4CC9A 4CI2A 4FA1D 3SWSD 3I7KA 1ERJA 4Y5RD 4MK0B 2Z2OA 1XHMA 1H2ZA 1U4CA 3UVLA 4JSPC 3N0EA 2EIEA 1UOQA 3NVXA 4GGAA 1QFMA 3UKUC 3I7LA 3GREA 4L3HD 2AGZA 3FRXA 5C2VB 3DDUA 4ERZA 1XKSA 3ZDZA 4RE6A 5FKSA 3IUNA 1OMWB
chains in the Genus database with same CATH topology
3RLMD 3SCYA 1PBYB 3I89A 2BCJB 4K3ID 1QNIA 3EI3A 5EMMB 2H9NA 3JROA 4IA9A 5THAA 5GXHA 1JMXB 2CO0A 4D0KA 4O3TB 3I7NA 4GGCA 4PSWB 2H9MA 4X61B 4AEZA 4PBZA 2OVQB 3AL9A 3NVNA 3RSEC 2HESX 1PI6A 4JD2C 5EARA 3SLED 4J86A 3EI3B 3CFSB 3IJ0A 4XEIC 5SXMA 2HXCA 4PC0A 1N6DA 4U7AA 4FAND 1TYQC 2AGLA 2O9KA 1RI6A 2AGWA 1MG2A 2H13A 4J81A 5FKTA 3IIYA 5K1CC 3DWLC 4J8GA 2J57G 4A2LA 1R5MA 4A11A 5CYKA 4PXWA 3PSCB 4J87A 3SBPA 5GMKn 2GNQA 2AH0A 4PSXB 5EMJB 1N6FA 2YNPA 4O3UB 4GQ2P 4E5ZA 5H1MA 5HE2B 2CNXA 1B9YA 3UKRC 3C99A 3U4YA 5HE1B 1XIPA 1A0RB 4BUJC 3J80g 2IAAA 3W15A 5FLXg 4A09A 4CY5A 5CXCA 4GQ1A 4A11B 1GOTB 4A7JA 5CYKB 4J79A 3F3GA 1JJUB 2IURA 3CIKB 3GFCA 2I3SA 4L3GD 4J0XA 3B7FA 1NEXB 3A0FA 4E5ZB 4QQEA 3AH8B 2AQ5A 4ES0A 4LG9A 4J84A 4A0BA 3EMHA 3UVMA 3DXMC 3PXSD 5GXIA 5C2WB 4A09B 3MZLA 5TEEA 4J73A 4J77A 3RFGA 3I7PA 3JZHA 4CI3A 3KRXB 3EI1A 3SBQA 2I3TA 4ZOVA 4GQBB 3JAMg 1N6EA 3V5WB 4QL1A 4BH6A 5AJAA 2GC4A 2Q7QA 4JXMA 4A0BB 3AL8A 4OZUA 3JRPA 3OKYA 4CY1A 3HFQA 2H6QA 4GM9A 1TBGA 3MXXA 4X60B 2H6KA 4X63B 3C75H 4L9OA 3IJ1A 3I2NA 2IWKA 3JZGA 3EG6A 4ESGA 2H14A 3EI1B 2EBSA 5KDOB 2P9NC 4FHLA 3MKSB 4FB1D 2OIZA 4AOWA 4FAVD 2IUVA 2G9AA 3AL8B 4JSXC 5H14A 4G56B 3SN6B 3OKYB 2MTAH 3C9CA 2OJYA 5EAPA 3VH0A 2IWFA 4GZ8A 3DM0A 4D6VA 2B4EA 3P4FA 5EMKB 3OKWA 4CY3A 2TRCB 3MMYA 3FM0A 4R7AB 2XYIA 5AMSA 4A2MA 5IJ7E 3JZNA 2IUQA 4H5JA 2OK6A 2PM9A 4JT6C 2I0SA 1VYHC 5K19A 2YMUA 3PE7A 4GM3A 2HYEA 5FXYA 3V9FA 4J0WA 3PXTD 5TDHB 4A08A 4XYIA 1JMZB 2YBAA 2OVPB 2GC7A 4H5IA 3FGBA 5GSAA 1GXRA 5CXBA 2PM9B 4NSXA 3OW8A 5IC7A 2XL3A 2J56H 3OTTA 4X3EA 3PSLA 4UI9R 5I5JA 3J81g 4GM8A 2HKMA 3OL2A 5EMLB 4U1EI 1K8KC 3SJLD 4A08B 3ZWLB 4LGNA 4K3JB 4E54A 3RRMC 3JB9L 4JT5C 4CZYA 5CXBB 3BWSA 2J55H 3DXKC 4ZN4A 4BL0A 2B5MA 3L4OD 3UVNA 4ZOXA 3DSMA 5IJ8E 2CE8A 3OL2B 5IT9g 1K32A 2CO0C 5HE3B 4CZVA 2H68A 1YFQA 4HDJA 5HE0B 5JWZA 2OVRB 1FWXA 4FA4D 4E54B 2CN2A 4O45A 3IKOA 2BBKH 5H17A 3KRWB 2YB8B 2AH1A 3EI2A 2XU7A 3EI4A 2HJBA 2P9KC 3CFVA 4OWRA 2HKRA 4ZOYA 5I5IA 1MDAH 4Y7RA 2YNOA 4ERYA 4QRJA 4YVDA 2CN3A 3BG1A 2IUPA 3ULEC 4CI8A 3ODTA 2UZXB 1B9XA 3AFCA 2AGXA 4N14A 3PVUB 3SVWD 5IGQA 3EI2B 3EI4B 2XL2A 5A2Qg 4FWWA 4Z8LA 5EALA 3SMRA 4ERQA 3RN1D 3UVOA 5TF2A 4PNKB 3RN0D 1GP2B 1P22A 3UVKA 4GGDA 2PBIB 3K26A 4LG8A 3RFHA 1JOFA 2G99A 2P9LC 2W18A 5FKRA 1NR0A 2I0TA 2I0RA 2P9UC 3C5MA 4J78A 4A0AA 1S4UX 5FKQA 5HYNB 5AFU3 2CE9A 3I7OA 2P9SC 3I8CA 2QXVA 1SQJA 4JSNC 3V7DB 5TEFA 5I5MA 4J8BA 3ORVD 5B4WA 3VGZA 3K27A 2YNNA 3E0CA 3I7HA 2P9IC 2Z2PA 1L0QA 4IMMA 3PXWD 2QC5A 4A0AB 3IIWA 2Z2NA 4JSVC 4J82A 2H9PA 4O1QD 4QT8A 3MZKA 1Q47A 5EM2A 4PBYA 3IJCA 3JPXA 3UR4A 1SQ9A 2PM6B 2P9PC 5FA5B 2OK4A 4CZXA 1MG3A 2PM7B 1PGUA 3VA6A 3EU7A 5EAMA 3BG0A 4O9DA 4KFMB 5IGOA 5C9ZB 2AGYA 4EWRA 1SHYB 3I8EA 1GG2B 3SHFA 5EM2B 4TZ4A 2H6NA 1PEVA 3SXTD 4ZOZA 3L4MD 2B5NA 4CY2A 5HQGA 3F3FA 4L1QD 2UZYB 3NVQA 4CI1A 2H47A 4GMBA 4FA9D 4FA5D 3N0DA 4XYHA 3MKQA 3SBRA 3SFZA 2HJ4A 2H9LA 3PVWB 4I79A 3EWEA 2B5LA 5CXCB 5FQDA 3RMZD 1U2VC 1OLZA 2H3XA 3F3PA 3OKTA 4CC9A 4CI2A 4FA1D 3SWSD 3I7KA 1ERJA 4Y5RD 4MK0B 2Z2OA 1XHMA 1U4CA 3UVLA 4JSPC 3N0EA 3NVXA 4GGAA 3UKUC 3I7LA 3GREA 4L3HD 2AGZA 3FRXA 5C2VB 4ERZA 1XKSA 5FKSA 1OMWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLM D;  3SCY A;  1PBY B;  3I89 A;  2BCJ B;  4K3I D;  1QNI A;  3EI3 A;  5EMM B;  2H9N A;  3JRO A;  4IA9 A;  5THA A;  5GXH A;  1JMX B;  2CO0 A;  4D0K A;  4O3T B;  3I7N A;  4GGC A;  4PSW B;  2H9M A;  4X61 B;  4AEZ A;  4PBZ A;  2OVQ B;  3AL9 A;  3NVN A;  3RSE C;  2HES X;  1PI6 A;  4JD2 C;  5EAR A;  3SLE D;  4J86 A;  3EI3 B;  3CFS B;  3IJ0 A;  4XEI C;  5SXM A;  2HXC A;  4PC0 A;  1N6D A;  4U7A A;  4FAN D;  1TYQ C;  2AGL A;  2O9K A;  1RI6 A;  2AGW A;  1MG2 A;  2H13 A;  4J81 A;  5FKT A;  3IIY A;  5K1C C;  3DWL C;  4J8G A;  2J57 G;  4A2L A;  1R5M A;  4A11 A;  5CYK A;  4PXW A;  3PSC B;  4J87 A;  3SBP A;  5GMK n;  2GNQ A;  2AH0 A;  4PSX B;  5EMJ B;  1N6F A;  2YNP A;  4O3U B;  4GQ2 P;  4E5Z A;  5H1M A;  5HE2 B;  2CNX A;  1B9Y A;  3UKR C;  3C99 A;  3U4Y A;  5HE1 B;  1XIP A;  1A0R B;  4BUJ C;  3J80 g;  2IAA A;  3W15 A;  5FLX g;  4A09 A;  4CY5 A;  5CXC A;  4GQ1 A;  4A11 B;  1GOT B;  4A7J A;  5CYK B;  4J79 A;  3F3G A;  1JJU B;  2IUR A;  3CIK B;  3GFC A;  2I3S A;  4L3G D;  4J0X A;  3B7F A;  1NEX B;  3A0F A;  4E5Z B;  4QQE A;  3AH8 B;  2AQ5 A;  4ES0 A;  4LG9 A;  4J84 A;  4A0B A;  3EMH A;  3UVM A;  3DXM C;  3PXS D;  5GXI A;  5C2W B;  4A09 B;  3MZL A;  5TEE A;  4J73 A;  4J77 A;  3RFG A;  3I7P A;  3JZH A;  4CI3 A;  3KRX B;  3EI1 A;  3SBQ A;  2I3T A;  4ZOV A;  4GQB B;  3JAM g;  1N6E A;  3V5W B;  4QL1 A;  4BH6 A;  5AJA A;  2GC4 A;  2Q7Q A;  4JXM A;  4A0B B;  3AL8 A;  4OZU A;  3JRP A;  3OKY A;  4CY1 A;  3HFQ A;  2H6Q A;  4GM9 A;  1TBG A;  3MXX A;  4X60 B;  2H6K A;  4X63 B;  3C75 H;  4L9O A;  3IJ1 A;  3I2N A;  2IWK A;  3JZG A;  3EG6 A;  4ESG A;  2H14 A;  3EI1 B;  2EBS A;  5KDO B;  2P9N C;  4FHL A;  3MKS B;  4FB1 D;  2OIZ A;  4AOW A;  4FAV D;  2IUV A;  2G9A A;  3AL8 B;  4JSX C;  5H14 A;  4G56 B;  3SN6 B;  3OKY B;  2MTA H;  3C9C A;  2OJY A;  5EAP A;  3VH0 A;  2IWF A;  4GZ8 A;  3DM0 A;  4D6V A;  2B4E A;  3P4F A;  5EMK B;  3OKW A;  4CY3 A;  2TRC B;  3MMY A;  3FM0 A;  4R7A B;  2XYI A;  5AMS A;  4A2M A;  5IJ7 E;  3JZN A;  2IUQ A;  4H5J A;  2OK6 A;  2PM9 A;  4JT6 C;  2I0S A;  1VYH C;  5K19 A;  2YMU A;  3PE7 A;  4GM3 A;  2HYE A;  5FXY A;  3V9F A;  4J0W A;  3PXT D;  5TDH B;  4A08 A;  4XYI A;  1JMZ B;  2YBA A;  2OVP B;  2GC7 A;  4H5I A;  3FGB A;  5GSA A;  1GXR A;  5CXB A;  2PM9 B;  4NSX A;  3OW8 A;  5IC7 A;  2XL3 A;  2J56 H;  3OTT A;  4X3E A;  3PSL A;  4UI9 R;  5I5J A;  3J81 g;  4GM8 A;  2HKM A;  3OL2 A;  5EML B;  4U1E I;  1K8K C;  3SJL D;  4A08 B;  3ZWL B;  4LGN A;  4K3J B;  4E54 A;  3RRM C;  3JB9 L;  4JT5 C;  4CZY A;  5CXB B;  3BWS A;  2J55 H;  3DXK C;  4ZN4 A;  4BL0 A;  2B5M A;  3L4O D;  3UVN A;  4ZOX A;  3DSM A;  5IJ8 E;  2CE8 A;  3OL2 B;  5IT9 g;  1K32 A;  2CO0 C;  5HE3 B;  4CZV A;  2H68 A;  1YFQ A;  4HDJ A;  5HE0 B;  5JWZ A;  2OVR B;  1FWX A;  4FA4 D;  4E54 B;  2CN2 A;  4O45 A;  3IKO A;  2BBK H;  5H17 A;  3KRW B;  2YB8 B;  2AH1 A;  3EI2 A;  2XU7 A;  3EI4 A;  2HJB A;  2P9K C;  3CFV A;  4OWR A;  2HKR A;  4ZOY A;  5I5I A;  1MDA H;  4Y7R A;  2YNO A;  4ERY A;  4QRJ A;  4YVD A;  2CN3 A;  3BG1 A;  2IUP A;  3ULE C;  4CI8 A;  3ODT A;  2UZX B;  1B9X A;  3AFC A;  2AGX A;  4N14 A;  3PVU B;  3SVW D;  5IGQ A;  3EI2 B;  3EI4 B;  2XL2 A;  5A2Q g;  4FWW A;  4Z8L A;  5EAL A;  3SMR A;  4ERQ A;  3RN1 D;  3UVO A;  5TF2 A;  4PNK B;  3RN0 D;  1GP2 B;  1P22 A;  3UVK A;  4GGD A;  2PBI B;  3K26 A;  4LG8 A;  3RFH A;  1JOF A;  2G99 A;  2P9L C;  2W18 A;  5FKR A;  1NR0 A;  2I0T A;  2I0R A;  2P9U C;  3C5M A;  4J78 A;  4A0A A;  1S4U X;  5FKQ A;  5HYN B;  5AFU 3;  2CE9 A;  3I7O A;  2P9S C;  3I8C A;  2QXV A;  1SQJ A;  4JSN C;  3V7D B;  5TEF A;  5I5M A;  4J8B A;  3ORV D;  5B4W A;  3VGZ A;  3K27 A;  2YNN A;  3E0C A;  3I7H A;  2P9I C;  2Z2P A;  1L0Q A;  4IMM A;  3PXW D;  2QC5 A;  4A0A B;  3IIW A;  2Z2N A;  4JSV C;  4J82 A;  2H9P A;  4O1Q D;  4QT8 A;  3MZK A;  1Q47 A;  5EM2 A;  4PBY A;  3IJC A;  3JPX A;  3UR4 A;  1SQ9 A;  2PM6 B;  2P9P C;  5FA5 B;  2OK4 A;  4CZX A;  1MG3 A;  2PM7 B;  1PGU A;  3VA6 A;  3EU7 A;  5EAM A;  3BG0 A;  4O9D A;  4KFM B;  5IGO A;  5C9Z B;  2AGY A;  4EWR A;  1SHY B;  3I8E A;  1GG2 B;  3SHF A;  5EM2 B;  4TZ4 A;  2H6N A;  1PEV A;  3SXT D;  4ZOZ A;  3L4M D;  2B5N A;  4CY2 A;  5HQG A;  3F3F A;  4L1Q D;  2UZY B;  3NVQ A;  4CI1 A;  2H47 A;  4GMB A;  4FA9 D;  4FA5 D;  3N0D A;  4XYH A;  3MKQ A;  3SBR A;  3SFZ A;  2HJ4 A;  2H9L A;  3PVW B;  4I79 A;  3EWE A;  2B5L A;  5CXC B;  5FQD A;  3RMZ D;  1U2V C;  1OLZ A;  2H3X A;  3F3P A;  3OKT A;  4CC9 A;  4CI2 A;  4FA1 D;  3SWS D;  3I7K A;  1ERJ A;  4Y5R D;  4MK0 B;  2Z2O A;  1XHM A;  1U4C A;  3UVL A;  4JSP C;  3N0E A;  3NVX A;  4GGA A;  3UKU C;  3I7L A;  3GRE A;  4L3H D;  2AGZ A;  3FRX A;  5C2V B;  4ERZ A;  1XKS A;  5FKS A;  1OMW B; 
#chains in the Genus database with same CATH topology
 4AMZ A;  1GOF A;  3RLM D;  3SCY A;  4G1E A;  1PBY B;  5E6R A;  1E5T A;  1UOO A;  3I89 A;  4NC4 A;  5FFO A;  2BCJ B;  4K3I D;  2QR5 A;  1QNI A;  3EI3 A;  5E6S A;  5EMM B;  3EQ7 A;  2H9N A;  3JRO A;  4IA9 A;  5THA A;  1YR2 A;  5GXH A;  4L1M A;  2HU5 A;  1JMX B;  2CO0 A;  3T3M A;  4D0K A;  3IJE A;  4O3T B;  3I7N A;  4GGC A;  3MUO A;  2H9M A;  4PSW B;  4RE5 A;  4X61 B;  4DNW A;  4AEZ A;  4BCD A;  3O4J A;  4PBZ A;  2OVQ B;  3AL9 A;  3NVN A;  3RSE C;  2XZG A;  2HES X;  1PI6 A;  3VI4 A;  4JD2 C;  5EAR A;  3SLE D;  4J86 A;  3EI3 B;  3CFS B;  3IJ0 A;  4XEI C;  5SXM A;  2HXC A;  4PC0 A;  1N6D A;  4U7A A;  4FAN D;  1TYQ C;  2JKX A;  2AGL A;  3K71 A;  2O9K A;  1RI6 A;  1UOP A;  2AGW A;  4WK4 A;  3ZE1 A;  1MG2 A;  2H13 A;  2HU8 A;  4J81 A;  5FKT A;  2VDQ A;  1C9I A;  3IIY A;  5K1C C;  3DWL C;  4J8G A;  2J57 G;  4A2L A;  1R5M A;  4BP9 A;  4A11 A;  5CYK A;  4PXW A;  3PSC B;  4J87 A;  5M5R A;  3SBP A;  5GMK n;  2GNQ A;  2AH0 A;  4PSX B;  1UTC A;  4O2W A;  5EMJ B;  1N6F A;  2YNP A;  4O3U B;  4GQ2 P;  1H2X A;  4E5Z A;  5H1M A;  5HE2 B;  2CNX A;  1B9Y A;  3UKR C;  3C99 A;  3U4Y A;  5HE1 B;  1XIP A;  4Z7N A;  1A0R B;  4BUJ C;  3J80 g;  2IAA A;  3W15 A;  5FLX g;  4A09 A;  4AMY A;  4NAA A;  4CY5 A;  5CXC A;  4GQ1 A;  4A11 B;  1GOT B;  4A7J A;  5CYK B;  4J79 A;  1T2X A;  3F3G A;  1JJU B;  4BCB A;  5M5S A;  2IUR A;  3CIK B;  3GFC A;  2I3S A;  4L3G D;  4J0X A;  3B7F A;  1NEX B;  3A0F A;  4E5Z B;  4QQE A;  3AH8 B;  2AQ5 A;  4ES0 A;  4LG9 A;  4J84 A;  3O4G A;  4A0B A;  5M5V A;  1JTD B;  3T3P A;  2VDP A;  3EMH A;  3UVM A;  3DXM C;  3PXS D;  2WQ8 A;  5C2W B;  5GXI A;  1O6G A;  4A09 B;  3MZL A;  5TEE A;  4J73 A;  4J77 A;  3RFG A;  3I7P A;  3JZH A;  4CI3 A;  3KRX B;  3EI1 A;  3IUQ A;  2I3T A;  4JHP C;  4ZOV A;  4GQB B;  3SBQ A;  3JAM g;  1N6E A;  3V5W B;  4QL1 A;  4BH6 A;  5AJA A;  2GC4 A;  2Q7Q A;  4JXM A;  4A0B B;  3AL8 A;  4OZU A;  4WK0 A;  3JRP A;  3OKY A;  4CY1 A;  3NID A;  3HFQ A;  3NIG A;  2H6Q A;  4MMZ A;  4GM9 A;  1TBG A;  3MXX A;  1H2Y A;  4X60 B;  2H6K A;  4X63 B;  3C75 H;  4L9O A;  1H2W A;  3IJ1 A;  3I2N A;  4JHN A;  2IWK A;  3JZG A;  4WK2 A;  3EG6 A;  4ESG A;  2H14 A;  3EI1 B;  2EBS A;  5KDO B;  2P9N C;  4FHL A;  3MKS B;  4FB1 D;  2OIZ A;  4AOW A;  4FAV D;  2IUV A;  1O6F A;  1U8C A;  2G9A A;  3AL8 B;  4JSX C;  5H14 A;  4G56 B;  3SN6 B;  3OKY B;  2MTA H;  3C9C A;  2OJY A;  5EAP A;  3VH0 A;  2IWF A;  4GZ8 A;  4UM9 A;  3V4V A;  5E6U A;  3DM0 A;  3EQ9 A;  4D6V A;  2B4E A;  3P4F A;  5EMK B;  1I2M B;  3OKW A;  4CY3 A;  2TRC B;  3MMY A;  3FM0 A;  4R7A B;  2XYI A;  5AMS A;  4A2M A;  5IJ7 E;  3JZN A;  2IUQ A;  4H5J A;  2OK6 A;  5M5T A;  2PM9 A;  4JT6 C;  4WJK A;  2I0S A;  4BCC A;  1VYH C;  5K19 A;  3MVD K;  2YMU A;  1BPO A;  3PE7 A;  4GM3 A;  4O02 A;  2HYE A;  5FXY A;  3V9F A;  3ZE0 A;  3ZDX A;  4J0W A;  3GD1 I;  3PXT D;  5TDH B;  4A08 A;  4XYI A;  1JMZ B;  4Z7Q A;  4AN0 A;  2YBA A;  4BP8 A;  2OVP B;  2GC7 A;  4AN1 A;  4H5I A;  3FGB A;  3IUJ A;  5GSA A;  1GXR A;  5CXB A;  2PM9 B;  4NSX A;  3OW8 A;  5IC7 A;  1VZ3 A;  2XL3 A;  2J56 H;  1E8N A;  3OTT A;  4X3E A;  3PSL A;  4UI9 R;  4Z7O A;  5I5J A;  4DNU A;  3J81 g;  4GM8 A;  2HKM A;  3OL2 A;  5EML B;  4U1E I;  1K8K C;  2XDW A;  3SJL D;  4A08 B;  3ZWL B;  3GC3 B;  4LGN A;  4K3J B;  4E54 A;  3RRM C;  3JB9 L;  4JT5 C;  3QHY B;  4CZY A;  5CXB B;  3BWS A;  2J55 H;  3DXK C;  4MMX A;  4ZN4 A;  4BL0 A;  2B5M A;  3L4O D;  3UVN A;  4ZOX A;  1VE7 A;  3DSM A;  5IJ8 E;  2CE8 A;  3OL2 B;  5IT9 g;  1K32 A;  2CO0 C;  5HE3 B;  1QFS A;  4CZV A;  2H68 A;  1YFQ A;  3NIF A;  4HDJ A;  5HE0 B;  5JWZ A;  2OVR B;  2VDN A;  3O4I A;  1FWX A;  3IUM A;  4FA4 D;  4E54 B;  5FFG A;  4G55 A;  2CN2 A;  4O45 A;  3IKO A;  3FCU A;  2BBK H;  5H17 A;  3KRW B;  2YB8 B;  2AH1 A;  3EI2 A;  2XU7 A;  3EI4 A;  2HJB A;  2P9K C;  3CFV A;  2VDO A;  3IVM A;  4OWR A;  2HKR A;  4ZOY A;  5I5I A;  1MDA H;  4Y7R A;  2YNO A;  2VZ1 A;  4DNV A;  4ERY A;  5C86 A;  4QRJ A;  4YVD A;  2CN3 A;  3BG1 A;  2IUP A;  3ULE C;  4G1M A;  3ODT A;  2UZX B;  3ZE2 A;  1B9X A;  4CI8 A;  2VZ3 A;  1E8M A;  3KCI A;  3AFC A;  2AGX A;  4N14 A;  3PVU B;  2VDM A;  3EQ8 A;  2VC2 A;  5IGQ A;  3SVW D;  3EI2 B;  4NEN A;  3EI4 B;  2XL2 A;  4QAM A;  5A2Q g;  4FWW A;  4Z8L A;  5EAL A;  3SMR A;  4ERQ A;  3RN1 D;  1TYE A;  3UVO A;  5TF2 A;  4PNK B;  3RN0 D;  5M61 A;  1GP2 B;  1P22 A;  3UVK A;  4GGD A;  1K3I A;  3OF7 A;  2VDK A;  1C9L A;  2PBI B;  1A12 A;  2VDL A;  3K26 A;  4LG8 A;  4MMY A;  3RFH A;  1JOF A;  2G99 A;  2P9L C;  2W18 A;  5FKR A;  1NR0 A;  2I0T A;  2I0R A;  2P9U C;  3C5M A;  4J78 A;  3V4P A;  4A0A A;  2EIC A;  1S4U X;  3K72 A;  5FKQ A;  5HYN B;  5AFU 3;  2CE9 A;  3I7O A;  2P9S C;  3K6S A;  3I8C A;  2QXV A;  1SQJ A;  4JSN C;  3V7D B;  5TEF A;  5I5M A;  3IUR A;  3FCS A;  3ORV D;  1JV2 A;  4J8B A;  1M1X A;  5B4W A;  4UM8 A;  3O4H A;  4AX4 A;  3VGZ A;  2BKL A;  3K27 A;  2VDR A;  2YNN A;  3E0C A;  3I7H A;  2P9I C;  2Z2P A;  1L0Q A;  4IMM A;  5C92 A;  3PXW D;  2QC5 A;  3ZDY A;  4A0A B;  1GOG A;  3IIW A;  3VI3 A;  4NBM A;  2Z2N A;  4JSV C;  2QZP A;  4J82 A;  2H9P A;  3MUN A;  4O1Q D;  1GOH A;  4QT8 A;  3MZK A;  1Q47 A;  4D9S A;  5EM2 A;  4PBY A;  3IJC A;  3JPX A;  3UR4 A;  1SQ9 A;  2PM6 B;  2P9P C;  5FA5 B;  2EIB A;  2OK4 A;  4CZX A;  1MG3 A;  2PM7 B;  4IRZ A;  1PGU A;  3VA6 A;  3IUL A;  2XE4 A;  3EU7 A;  5EAM A;  3BG0 A;  4O9D A;  4KFM B;  5IGO A;  5C9Z B;  2AGY A;  5HDB A;  4EWR A;  3I8E A;  1SHY B;  1GG2 B;  3SHF A;  5EM2 B;  4TZ4 A;  2H6N A;  1L5G A;  1PEV A;  3SXT D;  4ZOZ A;  3L4M D;  2B5N A;  4CY2 A;  5HQG A;  3F3F A;  4L1Q D;  2UZY B;  3NVQ A;  4CI1 A;  2H47 A;  5M5U A;  4GMB A;  4FA9 D;  4FA5 D;  3N0D A;  1VE6 A;  4XYH A;  3MKQ A;  3SBR A;  3SFZ A;  2HJ4 A;  2H9L A;  1VZ2 A;  2EID A;  2HU7 A;  3PVW B;  3EWE A;  4I79 A;  3QI0 A;  2B5L A;  5CXC B;  5FQD A;  3RMZ D;  1U2V C;  1OLZ A;  2H3X A;  3F3P A;  3OKT A;  4CC9 A;  4CI2 A;  4FA1 D;  3SWS D;  3I7K A;  1ERJ A;  4Y5R D;  4MK0 B;  2Z2O A;  1XHM A;  1H2Z A;  1U4C A;  3UVL A;  4JSP C;  3N0E A;  2EIE A;  1UOQ A;  3NVX A;  4GGA A;  1QFM A;  3UKU C;  3I7L A;  3GRE A;  4L3H D;  2AGZ A;  3FRX A;  5C2V B;  3DDU A;  4ERZ A;  1XKS A;  3ZDZ A;  4RE6 A;  5FKS A;  3IUN A;  1OMW B; 
#chains in the Genus database with same CATH homology
 3RLM D;  3SCY A;  1PBY B;  3I89 A;  2BCJ B;  4K3I D;  1QNI A;  3EI3 A;  5EMM B;  2H9N A;  3JRO A;  4IA9 A;  5THA A;  5GXH A;  1JMX B;  2CO0 A;  4D0K A;  4O3T B;  3I7N A;  4GGC A;  4PSW B;  2H9M A;  4X61 B;  4AEZ A;  4PBZ A;  2OVQ B;  3AL9 A;  3NVN A;  3RSE C;  2HES X;  1PI6 A;  4JD2 C;  5EAR A;  3SLE D;  4J86 A;  3EI3 B;  3CFS B;  3IJ0 A;  4XEI C;  5SXM A;  2HXC A;  4PC0 A;  1N6D A;  4U7A A;  4FAN D;  1TYQ C;  2AGL A;  2O9K A;  1RI6 A;  2AGW A;  1MG2 A;  2H13 A;  4J81 A;  5FKT A;  3IIY A;  5K1C C;  3DWL C;  4J8G A;  2J57 G;  4A2L A;  1R5M A;  4A11 A;  5CYK A;  4PXW A;  3PSC B;  4J87 A;  3SBP A;  5GMK n;  2GNQ A;  2AH0 A;  4PSX B;  5EMJ B;  1N6F A;  2YNP A;  4O3U B;  4GQ2 P;  4E5Z A;  5H1M A;  5HE2 B;  2CNX A;  1B9Y A;  3UKR C;  3C99 A;  3U4Y A;  5HE1 B;  1XIP A;  1A0R B;  4BUJ C;  3J80 g;  2IAA A;  3W15 A;  5FLX g;  4A09 A;  4CY5 A;  5CXC A;  4GQ1 A;  4A11 B;  1GOT B;  4A7J A;  5CYK B;  4J79 A;  3F3G A;  1JJU B;  2IUR A;  3CIK B;  3GFC A;  2I3S A;  4L3G D;  4J0X A;  3B7F A;  1NEX B;  3A0F A;  4E5Z B;  4QQE A;  3AH8 B;  2AQ5 A;  4ES0 A;  4LG9 A;  4J84 A;  4A0B A;  3EMH A;  3UVM A;  3DXM C;  3PXS D;  5GXI A;  5C2W B;  4A09 B;  3MZL A;  5TEE A;  4J73 A;  4J77 A;  3RFG A;  3I7P A;  3JZH A;  4CI3 A;  3KRX B;  3EI1 A;  3SBQ A;  2I3T A;  4ZOV A;  4GQB B;  3JAM g;  1N6E A;  3V5W B;  4QL1 A;  4BH6 A;  5AJA A;  2GC4 A;  2Q7Q A;  4JXM A;  4A0B B;  3AL8 A;  4OZU A;  3JRP A;  3OKY A;  4CY1 A;  3HFQ A;  2H6Q A;  4GM9 A;  1TBG A;  3MXX A;  4X60 B;  2H6K A;  4X63 B;  3C75 H;  4L9O A;  3IJ1 A;  3I2N A;  2IWK A;  3JZG A;  3EG6 A;  4ESG A;  2H14 A;  3EI1 B;  2EBS A;  5KDO B;  2P9N C;  4FHL A;  3MKS B;  4FB1 D;  2OIZ A;  4AOW A;  4FAV D;  2IUV A;  2G9A A;  3AL8 B;  4JSX C;  5H14 A;  4G56 B;  3SN6 B;  3OKY B;  2MTA H;  3C9C A;  2OJY A;  5EAP A;  3VH0 A;  2IWF A;  4GZ8 A;  3DM0 A;  4D6V A;  2B4E A;  3P4F A;  5EMK B;  3OKW A;  4CY3 A;  2TRC B;  3MMY A;  3FM0 A;  4R7A B;  2XYI A;  5AMS A;  4A2M A;  5IJ7 E;  3JZN A;  2IUQ A;  4H5J A;  2OK6 A;  2PM9 A;  4JT6 C;  2I0S A;  1VYH C;  5K19 A;  2YMU A;  3PE7 A;  4GM3 A;  2HYE A;  5FXY A;  3V9F A;  4J0W A;  3PXT D;  5TDH B;  4A08 A;  4XYI A;  1JMZ B;  2YBA A;  2OVP B;  2GC7 A;  4H5I A;  3FGB A;  5GSA A;  1GXR A;  5CXB A;  2PM9 B;  4NSX A;  3OW8 A;  5IC7 A;  2XL3 A;  2J56 H;  3OTT A;  4X3E A;  3PSL A;  4UI9 R;  5I5J A;  3J81 g;  4GM8 A;  2HKM A;  3OL2 A;  5EML B;  4U1E I;  1K8K C;  3SJL D;  4A08 B;  3ZWL B;  4LGN A;  4K3J B;  4E54 A;  3RRM C;  3JB9 L;  4JT5 C;  4CZY A;  5CXB B;  3BWS A;  2J55 H;  3DXK C;  4ZN4 A;  4BL0 A;  2B5M A;  3L4O D;  3UVN A;  4ZOX A;  3DSM A;  5IJ8 E;  2CE8 A;  3OL2 B;  5IT9 g;  1K32 A;  2CO0 C;  5HE3 B;  4CZV A;  2H68 A;  1YFQ A;  4HDJ A;  5HE0 B;  5JWZ A;  2OVR B;  1FWX A;  4FA4 D;  4E54 B;  2CN2 A;  4O45 A;  3IKO A;  2BBK H;  5H17 A;  3KRW B;  2YB8 B;  2AH1 A;  3EI2 A;  2XU7 A;  3EI4 A;  2HJB A;  2P9K C;  3CFV A;  4OWR A;  2HKR A;  4ZOY A;  5I5I A;  1MDA H;  4Y7R A;  2YNO A;  4ERY A;  4QRJ A;  4YVD A;  2CN3 A;  3BG1 A;  2IUP A;  3ULE C;  4CI8 A;  3ODT A;  2UZX B;  1B9X A;  3AFC A;  2AGX A;  4N14 A;  3PVU B;  3SVW D;  5IGQ A;  3EI2 B;  3EI4 B;  2XL2 A;  5A2Q g;  4FWW A;  4Z8L A;  5EAL A;  3SMR A;  4ERQ A;  3RN1 D;  3UVO A;  5TF2 A;  4PNK B;  3RN0 D;  1GP2 B;  1P22 A;  3UVK A;  4GGD A;  2PBI B;  3K26 A;  4LG8 A;  3RFH A;  1JOF A;  2G99 A;  2P9L C;  2W18 A;  5FKR A;  1NR0 A;  2I0T A;  2I0R A;  2P9U C;  3C5M A;  4J78 A;  4A0A A;  1S4U X;  5FKQ A;  5HYN B;  5AFU 3;  2CE9 A;  3I7O A;  2P9S C;  3I8C A;  2QXV A;  1SQJ A;  4JSN C;  3V7D B;  5TEF A;  5I5M A;  4J8B A;  3ORV D;  5B4W A;  3VGZ A;  3K27 A;  2YNN A;  3E0C A;  3I7H A;  2P9I C;  2Z2P A;  1L0Q A;  4IMM A;  3PXW D;  2QC5 A;  4A0A B;  3IIW A;  2Z2N A;  4JSV C;  4J82 A;  2H9P A;  4O1Q D;  4QT8 A;  3MZK A;  1Q47 A;  5EM2 A;  4PBY A;  3IJC A;  3JPX A;  3UR4 A;  1SQ9 A;  2PM6 B;  2P9P C;  5FA5 B;  2OK4 A;  4CZX A;  1MG3 A;  2PM7 B;  1PGU A;  3VA6 A;  3EU7 A;  5EAM A;  3BG0 A;  4O9D A;  4KFM B;  5IGO A;  5C9Z B;  2AGY A;  4EWR A;  1SHY B;  3I8E A;  1GG2 B;  3SHF A;  5EM2 B;  4TZ4 A;  2H6N A;  1PEV A;  3SXT D;  4ZOZ A;  3L4M D;  2B5N A;  4CY2 A;  5HQG A;  3F3F A;  4L1Q D;  2UZY B;  3NVQ A;  4CI1 A;  2H47 A;  4GMB A;  4FA9 D;  4FA5 D;  3N0D A;  4XYH A;  3MKQ A;  3SBR A;  3SFZ A;  2HJ4 A;  2H9L A;  3PVW B;  4I79 A;  3EWE A;  2B5L A;  5CXC B;  5FQD A;  3RMZ D;  1U2V C;  1OLZ A;  2H3X A;  3F3P A;  3OKT A;  4CC9 A;  4CI2 A;  4FA1 D;  3SWS D;  3I7K A;  1ERJ A;  4Y5R D;  4MK0 B;  2Z2O A;  1XHM A;  1U4C A;  3UVL A;  4JSP C;  3N0E A;  3NVX A;  4GGA A;  3UKU C;  3I7L A;  3GRE A;  4L3H D;  2AGZ A;  3FRX A;  5C2V B;  4ERZ A;  1XKS A;  5FKS A;  1OMW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...