5IGQA

Wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2) bound to peptide from trib1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
341
structure length
324
Chain Sequence
EFQECLSKFTRYNSVRPLATLSYALYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/peptide
molecule keywords E3 ubiquitin-protein ligase RFWD2
publication title Structural Basis for Substrate Selectivity of the E3 Ligase COP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 324
sequence length 341
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5igqA00
1YFQA 1JMZB 3CFVA 4CY5A 3I7OA 4FAVD 2Z2NA 2CE8A 2GC4A 2H6NA 4IA9A 3C5MA 4LG9A 3JB9L 2P9IC 3UVNA 3F3FA 4CI3A 1R5MA 5EMMB 5C9ZB 4J87A 4PC0A 3OW8A 2IUQA 1FWXA 5FA5B 2OK6A 3V5WB 3UVOA 4ZOZA 4U1EI 2P9LC 4U7AA 3PSCB 3PXWD 3CFSB 5IGOA 2PBIB 3E0CA 4X61B 2UZYB 5B4WA 2I0SA 3J81g 3I8EA 2XYIA 5CXBB 5TEFA 4YVDA 4CY1A 4Y7RA 1PI6A 2UZXB 5HE0B 4JXMA 4ES0A 5GXHA 3SCYA 2CO0A 1VYHC 4AEZA 3OKTA 4GGAA 3RN0D 3ZWLB 2AGZA 4CY2A 5JWZA 3SBPA 3DWLC 3UR4A 1XIPA 4FA1D 4A0BB 3BG1A 4I79A 5SXMA 1GP2B 2H9MA 3OTTA 3SWSD 3AH8B 3RSEC 2J55H 3VA6A 4GZ8A 1B9YA 3IIYA 3I7LA 3K26A 4J86A 1JJUB 5TEEA 1OLZA 4GMBA 5CXBA 1B9XA 2PM6B 4K3ID 3OKWA 5HE2B 4X63B 5HYNB 3OL2B 3RMZD 5C2VB 4CI2A 4BUJC 4JSVC 3SHFA 2BCJB 4FHLA 3HFQA 3JRPA 1U4CA 2AGLA 3JZGA 4O45A 5FQDA 4A0BA 3UKUC 5FKTA 3IKOA 4ZN4A 2HXCA 3L4OD 4QQEA 4PSWB 3DM0A 2OVQB 4EWRA 3OKYB 2HJBA 2YNOA 3DXMC 4J77A 2IUPA 2B4EA 4BL0A 3I7NA 3SBRA 4A08A 2EBSA 3OL2A 3PXTD 4UI9R 3EI1B 2QC5A 3F3PA 1TBGA 3AFCA 5GXIA 3W15A 4KFMB 4JSPC 4PNKB 5H17A 3PVUB 1K8KC 4A09B 4Z8LA 2HYEA 3SMRA 1QNIA 4FAND 4L1QD 3AL9A 4A11B 3L4MD 4BH6A 1Q47A 3OKYA 4LGNA 4CY3A 3PSLA 4QRJA 3UVLA 3SJLD 1MG3A 4J8GA 3I7HA 5C2WB 3GFCA 3UVKA 4ZOYA 1NEXB 3J80g 1GOTB 2IWKA 5EAPA 3EI1A 2J56H 4XYHA 4XYIA 5AJAA 3I2NA 4GQBB 4D0KA 4GQ1A 3MXXA 2PM7B 2CNXA 3K27A 4A09A 2P9NC 2HJ4A 5IJ7E 4GGDA 5FKRA 4G56B 4K3JB 3RLMD 1K32A 3ULEC 5EALA 3JPXA 5EMKB 3FRXA 2AGYA 2I0TA 4E54B 2TRCB 3DSMA 3I8CA 4CC9A 4GM8A 2AH1A 4PXWA 5CXCB 2G9AA 3SLED 1NR0A 4X60B 5H1MA 4ZOXA 4GGCA 4H5JA 2OK4A 1JMXB 5TF2A 2OVRB 3EG6A 2H14A 4JSXC 2OIZA 4E54A 4MK0B 2AH0A 2P9UC 4J84A 3V7DB 3EI2B 3CIKB 1PEVA 5CXCA 4O1QD 5FKQA 1L0QA 4A2MA 5FKSA 4ERYA 4ERQA 2GNQA 2J57G 4FWWA 2YNNA 3RRMC 4JD2C 5K19A 3NVXA 2B5LA 4PBYA 1N6FA 4ESGA 3IJ1A 5AFU3 3PE7A 3MKSB 1MG2A 1SQJA 2BBKH 4O9DA 3KRWB 5THAA 3SBQA 4CZVA 4J0WA 3AL8B 3JROA 4L3GD 1SHYB 3IIWA 3FGBA 4FB1D 3EI2A 5FLXg 2W18A 4J78A 3SFZA 3VGZA 4FA5D 3EI4B 2IAAA 5I5MA 2XL3A 4Y5RD 2HESX 4CZXA 3N0EA 1JOFA 5EAMA 1PBYB 3VH0A 4R7AB 3U4YA 4XEIC 3C75H 2OVPB 2HKMA 4CI1A 3DXKC 3I7KA 2IWFA 1XHMA 5A2Qg 3RN1D 4N14A 4GM3A 3GREA 4GQ2P 3AL8A 1PGUA 1N6DA 3UVMA 2OJYA 2H9NA 3EI4A 4O3UB 1S4UX 3NVQA 3UKRC 2CO0C 2MTAH 5HE3B 2QXVA 3MZKA 3EWEA 4FA9D 4L3HD 2AGWA 3C99A 4OZUA 4ZOVA 2H9LA 4A11A 2H13A 5IT9g 2YNPA 4X3EA 3JZNA 4H5IA 3BG0A 3I89A 2XU7A 2CE9A 2H47A 2IUVA 2H9PA 5EM2B 4GM9A 2Q7QA 4PBZA 4JT6C 2HKRA 5HE1B 3F3GA 2O9KA 2PM9B 2XL2A 5IC7A 2I3SA 2YB8B 1XKSA 2P9PC 5IGQA 4CZYA 5CYKB 4ERZA 2YMUA 4CI8A 3SXTD 3C9CA 4L9OA 5FXYA 3RFGA 4E5ZB 2H3XA 4J8BA 1U2VC 1MDAH 3EU7A 3EMHA 1SQ9A 5EM2A 3MZLA 5EMJB 4LG8A 3SVWD 3PXSD 5GSAA 3BWSA 2PM9A 5H14A 1GG2B 5EARA 5I5IA 5CYKA 4PSXB 1N6EA 3FM0A 3IJ0A 3P4FA 2P9SC 4A2LA 2GC7A 1TYQC 2YBAA 4A08B 4QT8A 3KRXB 4E5ZA 4A0AB 1ERJA 1OMWB 5IJ8E 2Z2PA 4JSNC 5HQGA 4TZ4A 4J73A 3JAMg 3A0FA 2I3TA 5I5JA 3SN6B 3N0DA 4HDJA 3RFHA 4J82A 2IURA 3I7PA 3JZHA 4J79A 2I0RA 3EI3B 2G99A 2B5MA 3NVNA 4A7JA 3MKQA 3V9FA 2AGXA 3ODTA 1GXRA 3B7FA 2Z2OA 3ORVD 4J0XA 4O3TB 5AMSA 4JT5C 1RI6A 4NSXA 4A0AA 4QL1A 2CN3A 2H6QA 3MMYA 4FA4D 2B5NA 4IMMA 2H68A 5KDOB 2AQ5A 5TDHB 1A0RB 2CN2A 4D6VA 2P9KC 2H6KA 5K1CC 5GMKn 3EI3A 5EMLB 4OWRA 3PVWB 4J81A 3IJCA 4AOWA 1P22A
chains in the Genus database with same CATH superfamily
1YFQA 5E6SA 1JMZB 2VZ3A 4O2WA 1E8NA 3CFVA 3MVDK 4CY5A 3I7OA 4FAVD 2Z2NA 2CE8A 2GC4A 2H6NA 3T3PA 4IA9A 3C5MA 4LG9A 3JB9L 2P9IC 3UVNA 4WJKA 3F3FA 4CI3A 1R5MA 5EMMB 5C9ZB 4J87A 4PC0A 3OW8A 2IUQA 1FWXA 3IJCA 5FA5B 2OK6A 3V5WB 3UVOA 3IVMA 4ZOZA 4U1EI 2P9LC 4U7AA 3PSCB 3PXWD 3CFSB 5M61A 5IGOA 2PBIB 3E0CA 2VDPA 5M5SA 4X61B 4AN0A 2UZYB 5M5UA 5B4WA 1I2MB 2I0SA 1TYEA 3J81g 3I8EA 2XYIA 5CXBB 5TEFA 4YVDA 4CY1A 4Y7RA 1PI6A 1C9LA 2UZXB 4RE6A 4JXMA 5HE0B 4ES0A 5GXHA 3SCYA 2CO0A 1VYHC 4AEZA 3OF7A 4D9SA 3OKTA 4GGAA 3RN0D 3ZWLB 2AGZA 4CY2A 4Z7QA 5JWZA 3SBPA 3DWLC 3GC3B 3UR4A 1XIPA 4FA1D 4A0BB 1VE6A 3BG1A 4I79A 5SXMA 1GP2B 2H9MA 3OTTA 3SWSD 3AH8B 3RSEC 2J55H 3VA6A 4GZ8A 1UOPA 1B9YA 3IIYA 3I7LA 3K26A 4J86A 1JJUB 5TEEA 1UTCA 1OLZA 4GMBA 5CXBA 1B9XA 2PM6B 4K3ID 3OKWA 5HE2B 5M5RA 4X63B 3ZDYA 4AN1A 5HYNB 2EIBA 3OL2B 3RMZD 4BCDA 5C2VB 4CI2A 4BUJC 2VDOA 4JSVC 3SHFA 4Z7OA 2BCJB 4FHLA 3HFQA 3JRPA 1QFSA 1U4CA 2AGLA 4Z7NA 3JZGA 4O45A 5FQDA 4A0BA 3UKUC 1K3IA 5FKTA 3IKOA 4ZN4A 2HXCA 3L4OD 4QQEA 4PSWB 3DM0A 4NENA 2OVQB 4EWRA 3OKYB 2HJBA 2YNOA 3DXMC 4J77A 1UOQA 5C92A 2IUPA 2B4EA 1QFMA 5E6RA 4BL0A 3I7NA 5E6UA 4G55A 3SBRA 4A08A 2EBSA 3OL2A 3VI4A 4JHNA 3PXTD 4QAMA 2HU8A 4UI9R 2QC5A 3EI1B 3F3PA 1TBGA 3AFCA 3O4HA 5GXIA 1VZ2A 3W15A 2VZ1A 4KFMB 4JSPC 4PNKB 5H17A 3PVUB 1K8KC 4A09B 4Z8LA 2HYEA 4AMZA 3SMRA 1QNIA 4FAND 4L1QD 3AL9A 4A11B 3L4MD 4BCCA 1M1XA 4BH6A 1Q47A 3OKYA 4LGNA 4CY3A 2VDQA 3PSLA 4QRJA 3UVLA 3MUOA 3SJLD 1MG3A 4J8GA 3I7HA 5C2WB 3GFCA 3UVKA 2EIDA 4ZOYA 1NEXB 3J80g 4UM8A 1GOTB 2IWKA 2VDKA 5EAPA 1O6GA 3EI1A 2J56H 4XYHA 4XYIA 5AJAA 3DDUA 3I2NA 1C9IA 4GQBB 1A12A 4D0KA 4GQ1A 3MXXA 5FFGA 2PM7B 2CNXA 3K27A 4A09A 1H2YA 2P9NC 2HJ4A 2XZGA 5IJ7E 4GGDA 5FKRA 3IUMA 4G56B 4K3JB 3RLMD 1K32A 3ULEC 5EALA 2HU7A 2EIEA 3JPXA 5EMKB 3FRXA 2AGYA 2I0TA 4E54B 2TRCB 3DSMA 2VC2A 3I8CA 4CC9A 4GM8A 2AH1A 2VDMA 4PXWA 1H2XA 5CXCB 5FFOA 4NAAA 2G9AA 3SLED 1NR0A 4X60B 1U8CA 3QI0A 5H1MA 4NC4A 4ZOXA 4GGCA 4H5JA 5M5TA 1BPOA 2OK4A 1JMXB 5TF2A 3NIFA 1JTDB 3IUJA 3VI3A 2OVRB 4BP8A 3EG6A 2H14A 4JSXC 2OIZA 2QR5A 5C86A 4E54A 1H2ZA 4MK0B 2AH0A 2P9UC 1GOFA 4J84A 3V7DB 3EI2B 3CIKB 4WK2A 1PEVA 5CXCA 2XDWA 4O1QD 5FKQA 1L0QA 4A2MA 5FKSA 4ERYA 4ERQA 2GNQA 2J57G 4FWWA 2YNNA 3RRMC 4JD2C 5K19A 3NVXA 2B5LA 2BKLA 4AX4A 3IJEA 4PBYA 1N6FA 4ESGA 2QZPA 3IJ1A 5AFU3 3PE7A 3MKSB 4RE5A 1MG2A 1SQJA 4JHPC 2BBKH 4O9DA 3KRWB 5THAA 3SBQA 4IRZA 4WK0A 2HU5A 3ZE2A 4CZVA 3QHYB 3NIGA 4J0WA 3AL8B 3JROA 4L3GD 1SHYB 3IIWA 3FGBA 4FB1D 3EI2A 1E8MA 5FLXg 4O02A 2W18A 4J78A 3SFZA 3IULA 3VGZA 3EI4B 4FA5D 2IAAA 5I5MA 2XL3A 4Y5RD 1VE7A 2HESX 4CZXA 4NBMA 3IUQA 3N0EA 1JOFA 5EAMA 1PBYB 3VH0A 4R7AB 3U4YA 4XEIC 3C75H 2OVPB 2HKMA 4CI1A 3DXKC 3I7KA 2IWFA 4UM9A 1XHMA 5A2Qg 3RN1D 4N14A 4GM3A 3GREA 3FCSA 2JKXA 4GQ2P 3AL8A 1PGUA 1N6DA 3UVMA 2OJYA 2H9NA 3EQ9A 3EI4A 4O3UB 1S4UX 3NVQA 4WK4A 3T3MA 3UKRC 2CO0C 3ZDXA 2MTAH 5HE3B 1O6FA 2QXVA 3MZKA 3EWEA 4FA9D 4L3HD 2AGWA 3C99A 5M5VA 4OZUA 4ZOVA 2H9LA 4A11A 2H13A 3ZE1A 4G1EA 4DNUA 5IT9g 2YNPA 3K71A 4X3EA 3JZNA 4H5IA 3BG0A 3I89A 2XU7A 2CE9A 2H47A 4AMYA 2IUVA 1VZ3A 2H9PA 5EM2B 4BP9A 4GM9A 1GOGA 2Q7QA 4PBZA 4JT6C 2VDLA 2HKRA 5HE1B 3F3GA 2O9KA 2PM9B 2XL2A 5IC7A 2I3SA 3ZDZA 2YB8B 1XKSA 2P9PC 5IGQA 4CZYA 5CYKB 3O4JA 4ERZA 2YMUA 4CI8A 3SXTD 3C9CA 4L9OA 4G1MA 5FXYA 3RFGA 4E5ZB 2H3XA 3O4IA 4J8BA 2VDRA 1U2VC 1MDAH 2EICA 3EU7A 3V4PA 3EMHA 1SQ9A 5EM2A 3MZLA 5EMJB 1JV2A 4DNWA 1YR2A 4LG8A 2VDNA 3FCUA 1UOOA 3PXSD 3SVWD 5GSAA 3BWSA 2PM9A 5H14A 1GG2B 4MMZA 5EARA 5I5IA 4L1MA 5CYKA 4PSXB 1N6EA 3FM0A 3IJ0A 3P4FA 2P9SC 4A2LA 2GC7A 1TYQC 3V4VA 2YBAA 4A08B 4QT8A 3KRXB 4E5ZA 4A0AB 1ERJA 1OMWB 5IJ8E 2Z2PA 4JSNC 3KCIA 5HQGA 4TZ4A 4J73A 3JAMg 3A0FA 2I3TA 5I5JA 3SN6B 3N0DA 4HDJA 3RFHA 2IURA 4J82A 3I7PA 3JZHA 4J79A 3ZE0A 4DNVA 2I0RA 3EI3B 3EQ7A 2G99A 2B5MA 1GOHA 3NVNA 4A7JA 3MKQA 3NIDA 3V9FA 2AGXA 3ODTA 1GXRA 3B7FA 2Z2OA 4MMYA 4MMXA 3MUNA 3GD1I 3ORVD 4J0XA 4O3TB 1H2WA 5AMSA 3EQ8A 4JT5C 1E5TA 1RI6A 4NSXA 4A0AA 2WQ8A 3IURA 2CN3A 2XE4A 4QL1A 3K6SA 2H6QA 3MMYA 4FA4D 1L5GA 2B5NA 4IMMA 2H68A 1T2XA 5KDOB 2AQ5A 5TDHB 1A0RB 2CN2A 4D6VA 2P9KC 3IUNA 2H6KA 5K1CC 3O4GA 4BCBA 5GMKn 3EI3A 5EMLB 4OWRA 3PVWB 4J81A 3K72A 4AOWA 5HDBA 1P22A
chains in the Genus database with same CATH topology
1YFQA 1JMZB 3CFVA 4CY5A 3I7OA 4FAVD 2Z2NA 2CE8A 2GC4A 2H6NA 4IA9A 3C5MA 4LG9A 3JB9L 2P9IC 3UVNA 3F3FA 4CI3A 1R5MA 5EMMB 5C9ZB 4J87A 4PC0A 3OW8A 2IUQA 1FWXA 5FA5B 2OK6A 3V5WB 3UVOA 4ZOZA 4U1EI 2P9LC 4U7AA 3PSCB 3PXWD 3CFSB 5IGOA 2PBIB 3E0CA 4X61B 2UZYB 5B4WA 2I0SA 3J81g 3I8EA 2XYIA 5CXBB 5TEFA 4YVDA 4CY1A 4Y7RA 1PI6A 2UZXB 5HE0B 4JXMA 4ES0A 5GXHA 3SCYA 2CO0A 1VYHC 4AEZA 3OKTA 4GGAA 3RN0D 3ZWLB 2AGZA 4CY2A 5JWZA 3SBPA 3DWLC 3UR4A 1XIPA 4FA1D 4A0BB 3BG1A 4I79A 5SXMA 1GP2B 2H9MA 3OTTA 3SWSD 3AH8B 3RSEC 2J55H 3VA6A 4GZ8A 1B9YA 3IIYA 3I7LA 3K26A 4J86A 1JJUB 5TEEA 1OLZA 4GMBA 5CXBA 1B9XA 2PM6B 4K3ID 3OKWA 5HE2B 4X63B 5HYNB 3OL2B 3RMZD 5C2VB 4CI2A 4BUJC 4JSVC 3SHFA 2BCJB 4FHLA 3HFQA 3JRPA 1U4CA 2AGLA 3JZGA 4O45A 5FQDA 4A0BA 3UKUC 5FKTA 3IKOA 4ZN4A 2HXCA 3L4OD 4QQEA 4PSWB 3DM0A 2OVQB 4EWRA 3OKYB 2HJBA 2YNOA 3DXMC 4J77A 2IUPA 2B4EA 4BL0A 3I7NA 3SBRA 4A08A 2EBSA 3OL2A 3PXTD 4UI9R 3EI1B 2QC5A 3F3PA 1TBGA 3AFCA 5GXIA 3W15A 4KFMB 4JSPC 4PNKB 5H17A 3PVUB 1K8KC 4A09B 4Z8LA 2HYEA 3SMRA 1QNIA 4FAND 4L1QD 3AL9A 4A11B 3L4MD 4BH6A 1Q47A 3OKYA 4LGNA 4CY3A 3PSLA 4QRJA 3UVLA 3SJLD 1MG3A 4J8GA 3I7HA 5C2WB 3GFCA 3UVKA 4ZOYA 1NEXB 3J80g 1GOTB 2IWKA 5EAPA 3EI1A 2J56H 4XYHA 4XYIA 5AJAA 3I2NA 4GQBB 4D0KA 4GQ1A 3MXXA 2PM7B 2CNXA 3K27A 4A09A 2P9NC 2HJ4A 5IJ7E 4GGDA 5FKRA 4G56B 4K3JB 3RLMD 1K32A 3ULEC 5EALA 3JPXA 5EMKB 3FRXA 2AGYA 2I0TA 4E54B 2TRCB 3DSMA 3I8CA 4CC9A 4GM8A 2AH1A 4PXWA 5CXCB 2G9AA 3SLED 1NR0A 4X60B 5H1MA 4ZOXA 4GGCA 4H5JA 2OK4A 1JMXB 5TF2A 2OVRB 3EG6A 2H14A 4JSXC 2OIZA 4E54A 4MK0B 2AH0A 2P9UC 4J84A 3V7DB 3EI2B 3CIKB 1PEVA 5CXCA 4O1QD 5FKQA 1L0QA 4A2MA 5FKSA 4ERYA 4ERQA 2GNQA 2J57G 4FWWA 2YNNA 3RRMC 4JD2C 5K19A 3NVXA 2B5LA 4PBYA 1N6FA 4ESGA 3IJ1A 5AFU3 3PE7A 3MKSB 1MG2A 1SQJA 2BBKH 4O9DA 3KRWB 5THAA 3SBQA 4CZVA 4J0WA 3AL8B 3JROA 4L3GD 1SHYB 3IIWA 3FGBA 4FB1D 3EI2A 5FLXg 2W18A 4J78A 3SFZA 3VGZA 4FA5D 3EI4B 2IAAA 5I5MA 2XL3A 4Y5RD 2HESX 4CZXA 3N0EA 1JOFA 5EAMA 1PBYB 3VH0A 4R7AB 3U4YA 4XEIC 3C75H 2OVPB 2HKMA 4CI1A 3DXKC 3I7KA 2IWFA 1XHMA 5A2Qg 3RN1D 4N14A 4GM3A 3GREA 4GQ2P 3AL8A 1PGUA 1N6DA 3UVMA 2OJYA 2H9NA 3EI4A 4O3UB 1S4UX 3NVQA 3UKRC 2CO0C 2MTAH 5HE3B 2QXVA 3MZKA 3EWEA 4FA9D 4L3HD 2AGWA 3C99A 4OZUA 4ZOVA 2H9LA 4A11A 2H13A 5IT9g 2YNPA 4X3EA 3JZNA 4H5IA 3BG0A 3I89A 2XU7A 2CE9A 2H47A 2IUVA 2H9PA 5EM2B 4GM9A 2Q7QA 4PBZA 4JT6C 2HKRA 5HE1B 3F3GA 2O9KA 2PM9B 2XL2A 5IC7A 2I3SA 2YB8B 1XKSA 2P9PC 5IGQA 4CZYA 5CYKB 4ERZA 2YMUA 4CI8A 3SXTD 3C9CA 4L9OA 5FXYA 3RFGA 4E5ZB 2H3XA 4J8BA 1U2VC 1MDAH 3EU7A 3EMHA 1SQ9A 5EM2A 3MZLA 5EMJB 4LG8A 3SVWD 3PXSD 5GSAA 3BWSA 2PM9A 5H14A 1GG2B 5EARA 5I5IA 5CYKA 4PSXB 1N6EA 3FM0A 3IJ0A 3P4FA 2P9SC 4A2LA 2GC7A 1TYQC 2YBAA 4A08B 4QT8A 3KRXB 4E5ZA 4A0AB 1ERJA 1OMWB 5IJ8E 2Z2PA 4JSNC 5HQGA 4TZ4A 4J73A 3JAMg 3A0FA 2I3TA 5I5JA 3SN6B 3N0DA 4HDJA 3RFHA 4J82A 2IURA 3I7PA 3JZHA 4J79A 2I0RA 3EI3B 2G99A 2B5MA 3NVNA 4A7JA 3MKQA 3V9FA 2AGXA 3ODTA 1GXRA 3B7FA 2Z2OA 3ORVD 4J0XA 4O3TB 5AMSA 4JT5C 1RI6A 4NSXA 4A0AA 4QL1A 2CN3A 2H6QA 3MMYA 4FA4D 2B5NA 4IMMA 2H68A 5KDOB 2AQ5A 5TDHB 1A0RB 2CN2A 4D6VA 2P9KC 2H6KA 5K1CC 5GMKn 3EI3A 5EMLB 4OWRA 3PVWB 4J81A 3IJCA 4AOWA 1P22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFQ A;  1JMZ B;  3CFV A;  4CY5 A;  3I7O A;  4FAV D;  2Z2N A;  2CE8 A;  2GC4 A;  2H6N A;  4IA9 A;  3C5M A;  4LG9 A;  3JB9 L;  2P9I C;  3UVN A;  3F3F A;  4CI3 A;  1R5M A;  5EMM B;  5C9Z B;  4J87 A;  4PC0 A;  3OW8 A;  2IUQ A;  1FWX A;  5FA5 B;  2OK6 A;  3V5W B;  3UVO A;  4ZOZ A;  4U1E I;  2P9L C;  4U7A A;  3PSC B;  3PXW D;  3CFS B;  5IGO A;  2PBI B;  3E0C A;  4X61 B;  2UZY B;  5B4W A;  2I0S A;  3J81 g;  3I8E A;  2XYI A;  5CXB B;  5TEF A;  4YVD A;  4CY1 A;  4Y7R A;  1PI6 A;  2UZX B;  5HE0 B;  4JXM A;  4ES0 A;  5GXH A;  3SCY A;  2CO0 A;  1VYH C;  4AEZ A;  3OKT A;  4GGA A;  3RN0 D;  3ZWL B;  2AGZ A;  4CY2 A;  5JWZ A;  3SBP A;  3DWL C;  3UR4 A;  1XIP A;  4FA1 D;  4A0B B;  3BG1 A;  4I79 A;  5SXM A;  1GP2 B;  2H9M A;  3OTT A;  3SWS D;  3AH8 B;  3RSE C;  2J55 H;  3VA6 A;  4GZ8 A;  1B9Y A;  3IIY A;  3I7L A;  3K26 A;  4J86 A;  1JJU B;  5TEE A;  1OLZ A;  4GMB A;  5CXB A;  1B9X A;  2PM6 B;  4K3I D;  3OKW A;  5HE2 B;  4X63 B;  5HYN B;  3OL2 B;  3RMZ D;  5C2V B;  4CI2 A;  4BUJ C;  4JSV C;  3SHF A;  2BCJ B;  4FHL A;  3HFQ A;  3JRP A;  1U4C A;  2AGL A;  3JZG A;  4O45 A;  5FQD A;  4A0B A;  3UKU C;  5FKT A;  3IKO A;  4ZN4 A;  2HXC A;  3L4O D;  4QQE A;  4PSW B;  3DM0 A;  2OVQ B;  4EWR A;  3OKY B;  2HJB A;  2YNO A;  3DXM C;  4J77 A;  2IUP A;  2B4E A;  4BL0 A;  3I7N A;  3SBR A;  4A08 A;  2EBS A;  3OL2 A;  3PXT D;  4UI9 R;  3EI1 B;  2QC5 A;  3F3P A;  1TBG A;  3AFC A;  5GXI A;  3W15 A;  4KFM B;  4JSP C;  4PNK B;  5H17 A;  3PVU B;  1K8K C;  4A09 B;  4Z8L A;  2HYE A;  3SMR A;  1QNI A;  4FAN D;  4L1Q D;  3AL9 A;  4A11 B;  3L4M D;  4BH6 A;  1Q47 A;  3OKY A;  4LGN A;  4CY3 A;  3PSL A;  4QRJ A;  3UVL A;  3SJL D;  1MG3 A;  4J8G A;  3I7H A;  5C2W B;  3GFC A;  3UVK A;  4ZOY A;  1NEX B;  3J80 g;  1GOT B;  2IWK A;  5EAP A;  3EI1 A;  2J56 H;  4XYH A;  4XYI A;  5AJA A;  3I2N A;  4GQB B;  4D0K A;  4GQ1 A;  3MXX A;  2PM7 B;  2CNX A;  3K27 A;  4A09 A;  2P9N C;  2HJ4 A;  5IJ7 E;  4GGD A;  5FKR A;  4G56 B;  4K3J B;  3RLM D;  1K32 A;  3ULE C;  5EAL A;  3JPX A;  5EMK B;  3FRX A;  2AGY A;  2I0T A;  4E54 B;  2TRC B;  3DSM A;  3I8C A;  4CC9 A;  4GM8 A;  2AH1 A;  4PXW A;  5CXC B;  2G9A A;  3SLE D;  1NR0 A;  4X60 B;  5H1M A;  4ZOX A;  4GGC A;  4H5J A;  2OK4 A;  1JMX B;  5TF2 A;  2OVR B;  3EG6 A;  2H14 A;  4JSX C;  2OIZ A;  4E54 A;  4MK0 B;  2AH0 A;  2P9U C;  4J84 A;  3V7D B;  3EI2 B;  3CIK B;  1PEV A;  5CXC A;  4O1Q D;  5FKQ A;  1L0Q A;  4A2M A;  5FKS A;  4ERY A;  4ERQ A;  2GNQ A;  2J57 G;  4FWW A;  2YNN A;  3RRM C;  4JD2 C;  5K19 A;  3NVX A;  2B5L A;  4PBY A;  1N6F A;  4ESG A;  3IJ1 A;  5AFU 3;  3PE7 A;  3MKS B;  1MG2 A;  1SQJ A;  2BBK H;  4O9D A;  3KRW B;  5THA A;  3SBQ A;  4CZV A;  4J0W A;  3AL8 B;  3JRO A;  4L3G D;  1SHY B;  3IIW A;  3FGB A;  4FB1 D;  3EI2 A;  5FLX g;  2W18 A;  4J78 A;  3SFZ A;  3VGZ A;  4FA5 D;  3EI4 B;  2IAA A;  5I5M A;  2XL3 A;  4Y5R D;  2HES X;  4CZX A;  3N0E A;  1JOF A;  5EAM A;  1PBY B;  3VH0 A;  4R7A B;  3U4Y A;  4XEI C;  3C75 H;  2OVP B;  2HKM A;  4CI1 A;  3DXK C;  3I7K A;  2IWF A;  1XHM A;  5A2Q g;  3RN1 D;  4N14 A;  4GM3 A;  3GRE A;  4GQ2 P;  3AL8 A;  1PGU A;  1N6D A;  3UVM A;  2OJY A;  2H9N A;  3EI4 A;  4O3U B;  1S4U X;  3NVQ A;  3UKR C;  2CO0 C;  2MTA H;  5HE3 B;  2QXV A;  3MZK A;  3EWE A;  4FA9 D;  4L3H D;  2AGW A;  3C99 A;  4OZU A;  4ZOV A;  2H9L A;  4A11 A;  2H13 A;  5IT9 g;  2YNP A;  4X3E A;  3JZN A;  4H5I A;  3BG0 A;  3I89 A;  2XU7 A;  2CE9 A;  2H47 A;  2IUV A;  2H9P A;  5EM2 B;  4GM9 A;  2Q7Q A;  4PBZ A;  4JT6 C;  2HKR A;  5HE1 B;  3F3G A;  2O9K A;  2PM9 B;  2XL2 A;  5IC7 A;  2I3S A;  2YB8 B;  1XKS A;  2P9P C;  5IGQ A;  4CZY A;  5CYK B;  4ERZ A;  2YMU A;  4CI8 A;  3SXT D;  3C9C A;  4L9O A;  5FXY A;  3RFG A;  4E5Z B;  2H3X A;  4J8B A;  1U2V C;  1MDA H;  3EU7 A;  3EMH A;  1SQ9 A;  5EM2 A;  3MZL A;  5EMJ B;  4LG8 A;  3SVW D;  3PXS D;  5GSA A;  3BWS A;  2PM9 A;  5H14 A;  1GG2 B;  5EAR A;  5I5I A;  5CYK A;  4PSX B;  1N6E A;  3FM0 A;  3IJ0 A;  3P4F A;  2P9S C;  4A2L A;  2GC7 A;  1TYQ C;  2YBA A;  4A08 B;  4QT8 A;  3KRX B;  4E5Z A;  4A0A B;  1ERJ A;  1OMW B;  5IJ8 E;  2Z2P A;  4JSN C;  5HQG A;  4TZ4 A;  4J73 A;  3JAM g;  3A0F A;  2I3T A;  5I5J A;  3SN6 B;  3N0D A;  4HDJ A;  3RFH A;  4J82 A;  2IUR A;  3I7P A;  3JZH A;  4J79 A;  2I0R A;  3EI3 B;  2G99 A;  2B5M A;  3NVN A;  4A7J A;  3MKQ A;  3V9F A;  2AGX A;  3ODT A;  1GXR A;  3B7F A;  2Z2O A;  3ORV D;  4J0X A;  4O3T B;  5AMS A;  4JT5 C;  1RI6 A;  4NSX A;  4A0A A;  4QL1 A;  2CN3 A;  2H6Q A;  3MMY A;  4FA4 D;  2B5N A;  4IMM A;  2H68 A;  5KDO B;  2AQ5 A;  5TDH B;  1A0R B;  2CN2 A;  4D6V A;  2P9K C;  2H6K A;  5K1C C;  5GMK n;  3EI3 A;  5EML B;  4OWR A;  3PVW B;  4J81 A;  3IJC A;  4AOW A;  1P22 A; 
#chains in the Genus database with same CATH topology
 1YFQ A;  5E6S A;  1JMZ B;  2VZ3 A;  4O2W A;  1E8N A;  3CFV A;  3MVD K;  4CY5 A;  3I7O A;  4FAV D;  2Z2N A;  2CE8 A;  2GC4 A;  2H6N A;  3T3P A;  4IA9 A;  3C5M A;  4LG9 A;  3JB9 L;  2P9I C;  3UVN A;  4WJK A;  3F3F A;  4CI3 A;  1R5M A;  5EMM B;  5C9Z B;  4J87 A;  4PC0 A;  3OW8 A;  2IUQ A;  1FWX A;  3IJC A;  5FA5 B;  2OK6 A;  3V5W B;  3UVO A;  3IVM A;  4ZOZ A;  4U1E I;  2P9L C;  4U7A A;  3PSC B;  3PXW D;  3CFS B;  5M61 A;  5IGO A;  2PBI B;  3E0C A;  2VDP A;  5M5S A;  4X61 B;  4AN0 A;  2UZY B;  5M5U A;  5B4W A;  1I2M B;  2I0S A;  1TYE A;  3J81 g;  3I8E A;  2XYI A;  5CXB B;  5TEF A;  4YVD A;  4CY1 A;  4Y7R A;  1PI6 A;  1C9L A;  2UZX B;  4RE6 A;  4JXM A;  5HE0 B;  4ES0 A;  5GXH A;  3SCY A;  2CO0 A;  1VYH C;  4AEZ A;  3OF7 A;  4D9S A;  3OKT A;  4GGA A;  3RN0 D;  3ZWL B;  2AGZ A;  4CY2 A;  4Z7Q A;  5JWZ A;  3SBP A;  3DWL C;  3GC3 B;  3UR4 A;  1XIP A;  4FA1 D;  4A0B B;  1VE6 A;  3BG1 A;  4I79 A;  5SXM A;  1GP2 B;  2H9M A;  3OTT A;  3SWS D;  3AH8 B;  3RSE C;  2J55 H;  3VA6 A;  4GZ8 A;  1UOP A;  1B9Y A;  3IIY A;  3I7L A;  3K26 A;  4J86 A;  1JJU B;  5TEE A;  1UTC A;  1OLZ A;  4GMB A;  5CXB A;  1B9X A;  2PM6 B;  4K3I D;  3OKW A;  5HE2 B;  5M5R A;  4X63 B;  3ZDY A;  4AN1 A;  5HYN B;  2EIB A;  3OL2 B;  3RMZ D;  4BCD A;  5C2V B;  4CI2 A;  4BUJ C;  2VDO A;  4JSV C;  3SHF A;  4Z7O A;  2BCJ B;  4FHL A;  3HFQ A;  3JRP A;  1QFS A;  1U4C A;  2AGL A;  4Z7N A;  3JZG A;  4O45 A;  5FQD A;  4A0B A;  3UKU C;  1K3I A;  5FKT A;  3IKO A;  4ZN4 A;  2HXC A;  3L4O D;  4QQE A;  4PSW B;  3DM0 A;  4NEN A;  2OVQ B;  4EWR A;  3OKY B;  2HJB A;  2YNO A;  3DXM C;  4J77 A;  1UOQ A;  5C92 A;  2IUP A;  2B4E A;  1QFM A;  5E6R A;  4BL0 A;  3I7N A;  5E6U A;  4G55 A;  3SBR A;  4A08 A;  2EBS A;  3OL2 A;  3VI4 A;  4JHN A;  3PXT D;  4QAM A;  2HU8 A;  4UI9 R;  2QC5 A;  3EI1 B;  3F3P A;  1TBG A;  3AFC A;  3O4H A;  5GXI A;  1VZ2 A;  3W15 A;  2VZ1 A;  4KFM B;  4JSP C;  4PNK B;  5H17 A;  3PVU B;  1K8K C;  4A09 B;  4Z8L A;  2HYE A;  4AMZ A;  3SMR A;  1QNI A;  4FAN D;  4L1Q D;  3AL9 A;  4A11 B;  3L4M D;  4BCC A;  1M1X A;  4BH6 A;  1Q47 A;  3OKY A;  4LGN A;  4CY3 A;  2VDQ A;  3PSL A;  4QRJ A;  3UVL A;  3MUO A;  3SJL D;  1MG3 A;  4J8G A;  3I7H A;  5C2W B;  3GFC A;  3UVK A;  2EID A;  4ZOY A;  1NEX B;  3J80 g;  4UM8 A;  1GOT B;  2IWK A;  2VDK A;  5EAP A;  1O6G A;  3EI1 A;  2J56 H;  4XYH A;  4XYI A;  5AJA A;  3DDU A;  3I2N A;  1C9I A;  4GQB B;  1A12 A;  4D0K A;  4GQ1 A;  3MXX A;  5FFG A;  2PM7 B;  2CNX A;  3K27 A;  4A09 A;  1H2Y A;  2P9N C;  2HJ4 A;  2XZG A;  5IJ7 E;  4GGD A;  5FKR A;  3IUM A;  4G56 B;  4K3J B;  3RLM D;  1K32 A;  3ULE C;  5EAL A;  2HU7 A;  2EIE A;  3JPX A;  5EMK B;  3FRX A;  2AGY A;  2I0T A;  4E54 B;  2TRC B;  3DSM A;  2VC2 A;  3I8C A;  4CC9 A;  4GM8 A;  2AH1 A;  2VDM A;  4PXW A;  1H2X A;  5CXC B;  5FFO A;  4NAA A;  2G9A A;  3SLE D;  1NR0 A;  4X60 B;  1U8C A;  3QI0 A;  5H1M A;  4NC4 A;  4ZOX A;  4GGC A;  4H5J A;  5M5T A;  1BPO A;  2OK4 A;  1JMX B;  5TF2 A;  3NIF A;  1JTD B;  3IUJ A;  3VI3 A;  2OVR B;  4BP8 A;  3EG6 A;  2H14 A;  4JSX C;  2OIZ A;  2QR5 A;  5C86 A;  4E54 A;  1H2Z A;  4MK0 B;  2AH0 A;  2P9U C;  1GOF A;  4J84 A;  3V7D B;  3EI2 B;  3CIK B;  4WK2 A;  1PEV A;  5CXC A;  2XDW A;  4O1Q D;  5FKQ A;  1L0Q A;  4A2M A;  5FKS A;  4ERY A;  4ERQ A;  2GNQ A;  2J57 G;  4FWW A;  2YNN A;  3RRM C;  4JD2 C;  5K19 A;  3NVX A;  2B5L A;  2BKL A;  4AX4 A;  3IJE A;  4PBY A;  1N6F A;  4ESG A;  2QZP A;  3IJ1 A;  5AFU 3;  3PE7 A;  3MKS B;  4RE5 A;  1MG2 A;  1SQJ A;  4JHP C;  2BBK H;  4O9D A;  3KRW B;  5THA A;  3SBQ A;  4IRZ A;  4WK0 A;  2HU5 A;  3ZE2 A;  4CZV A;  3QHY B;  3NIG A;  4J0W A;  3AL8 B;  3JRO A;  4L3G D;  1SHY B;  3IIW A;  3FGB A;  4FB1 D;  3EI2 A;  1E8M A;  5FLX g;  4O02 A;  2W18 A;  4J78 A;  3SFZ A;  3IUL A;  3VGZ A;  3EI4 B;  4FA5 D;  2IAA A;  5I5M A;  2XL3 A;  4Y5R D;  1VE7 A;  2HES X;  4CZX A;  4NBM A;  3IUQ A;  3N0E A;  1JOF A;  5EAM A;  1PBY B;  3VH0 A;  4R7A B;  3U4Y A;  4XEI C;  3C75 H;  2OVP B;  2HKM A;  4CI1 A;  3DXK C;  3I7K A;  2IWF A;  4UM9 A;  1XHM A;  5A2Q g;  3RN1 D;  4N14 A;  4GM3 A;  3GRE A;  3FCS A;  2JKX A;  4GQ2 P;  3AL8 A;  1PGU A;  1N6D A;  3UVM A;  2OJY A;  2H9N A;  3EQ9 A;  3EI4 A;  4O3U B;  1S4U X;  3NVQ A;  4WK4 A;  3T3M A;  3UKR C;  2CO0 C;  3ZDX A;  2MTA H;  5HE3 B;  1O6F A;  2QXV A;  3MZK A;  3EWE A;  4FA9 D;  4L3H D;  2AGW A;  3C99 A;  5M5V A;  4OZU A;  4ZOV A;  2H9L A;  4A11 A;  2H13 A;  3ZE1 A;  4G1E A;  4DNU A;  5IT9 g;  2YNP A;  3K71 A;  4X3E A;  3JZN A;  4H5I A;  3BG0 A;  3I89 A;  2XU7 A;  2CE9 A;  2H47 A;  4AMY A;  2IUV A;  1VZ3 A;  2H9P A;  5EM2 B;  4BP9 A;  4GM9 A;  1GOG A;  2Q7Q A;  4PBZ A;  4JT6 C;  2VDL A;  2HKR A;  5HE1 B;  3F3G A;  2O9K A;  2PM9 B;  2XL2 A;  5IC7 A;  2I3S A;  3ZDZ A;  2YB8 B;  1XKS A;  2P9P C;  5IGQ A;  4CZY A;  5CYK B;  3O4J A;  4ERZ A;  2YMU A;  4CI8 A;  3SXT D;  3C9C A;  4L9O A;  4G1M A;  5FXY A;  3RFG A;  4E5Z B;  2H3X A;  3O4I A;  4J8B A;  2VDR A;  1U2V C;  1MDA H;  2EIC A;  3EU7 A;  3V4P A;  3EMH A;  1SQ9 A;  5EM2 A;  3MZL A;  5EMJ B;  1JV2 A;  4DNW A;  1YR2 A;  4LG8 A;  2VDN A;  3FCU A;  1UOO A;  3PXS D;  3SVW D;  5GSA A;  3BWS A;  2PM9 A;  5H14 A;  1GG2 B;  4MMZ A;  5EAR A;  5I5I A;  4L1M A;  5CYK A;  4PSX B;  1N6E A;  3FM0 A;  3IJ0 A;  3P4F A;  2P9S C;  4A2L A;  2GC7 A;  1TYQ C;  3V4V A;  2YBA A;  4A08 B;  4QT8 A;  3KRX B;  4E5Z A;  4A0A B;  1ERJ A;  1OMW B;  5IJ8 E;  2Z2P A;  4JSN C;  3KCI A;  5HQG A;  4TZ4 A;  4J73 A;  3JAM g;  3A0F A;  2I3T A;  5I5J A;  3SN6 B;  3N0D A;  4HDJ A;  3RFH A;  2IUR A;  4J82 A;  3I7P A;  3JZH A;  4J79 A;  3ZE0 A;  4DNV A;  2I0R A;  3EI3 B;  3EQ7 A;  2G99 A;  2B5M A;  1GOH A;  3NVN A;  4A7J A;  3MKQ A;  3NID A;  3V9F A;  2AGX A;  3ODT A;  1GXR A;  3B7F A;  2Z2O A;  4MMY A;  4MMX A;  3MUN A;  3GD1 I;  3ORV D;  4J0X A;  4O3T B;  1H2W A;  5AMS A;  3EQ8 A;  4JT5 C;  1E5T A;  1RI6 A;  4NSX A;  4A0A A;  2WQ8 A;  3IUR A;  2CN3 A;  2XE4 A;  4QL1 A;  3K6S A;  2H6Q A;  3MMY A;  4FA4 D;  1L5G A;  2B5N A;  4IMM A;  2H68 A;  1T2X A;  5KDO B;  2AQ5 A;  5TDH B;  1A0R B;  2CN2 A;  4D6V A;  2P9K C;  3IUN A;  2H6K A;  5K1C C;  3O4G A;  4BCB A;  5GMK n;  3EI3 A;  5EML B;  4OWR A;  3PVW B;  4J81 A;  3K72 A;  4AOW A;  5HDB A;  1P22 A; 
#chains in the Genus database with same CATH homology
 1YFQ A;  1JMZ B;  3CFV A;  4CY5 A;  3I7O A;  4FAV D;  2Z2N A;  2CE8 A;  2GC4 A;  2H6N A;  4IA9 A;  3C5M A;  4LG9 A;  3JB9 L;  2P9I C;  3UVN A;  3F3F A;  4CI3 A;  1R5M A;  5EMM B;  5C9Z B;  4J87 A;  4PC0 A;  3OW8 A;  2IUQ A;  1FWX A;  5FA5 B;  2OK6 A;  3V5W B;  3UVO A;  4ZOZ A;  4U1E I;  2P9L C;  4U7A A;  3PSC B;  3PXW D;  3CFS B;  5IGO A;  2PBI B;  3E0C A;  4X61 B;  2UZY B;  5B4W A;  2I0S A;  3J81 g;  3I8E A;  2XYI A;  5CXB B;  5TEF A;  4YVD A;  4CY1 A;  4Y7R A;  1PI6 A;  2UZX B;  5HE0 B;  4JXM A;  4ES0 A;  5GXH A;  3SCY A;  2CO0 A;  1VYH C;  4AEZ A;  3OKT A;  4GGA A;  3RN0 D;  3ZWL B;  2AGZ A;  4CY2 A;  5JWZ A;  3SBP A;  3DWL C;  3UR4 A;  1XIP A;  4FA1 D;  4A0B B;  3BG1 A;  4I79 A;  5SXM A;  1GP2 B;  2H9M A;  3OTT A;  3SWS D;  3AH8 B;  3RSE C;  2J55 H;  3VA6 A;  4GZ8 A;  1B9Y A;  3IIY A;  3I7L A;  3K26 A;  4J86 A;  1JJU B;  5TEE A;  1OLZ A;  4GMB A;  5CXB A;  1B9X A;  2PM6 B;  4K3I D;  3OKW A;  5HE2 B;  4X63 B;  5HYN B;  3OL2 B;  3RMZ D;  5C2V B;  4CI2 A;  4BUJ C;  4JSV C;  3SHF A;  2BCJ B;  4FHL A;  3HFQ A;  3JRP A;  1U4C A;  2AGL A;  3JZG A;  4O45 A;  5FQD A;  4A0B A;  3UKU C;  5FKT A;  3IKO A;  4ZN4 A;  2HXC A;  3L4O D;  4QQE A;  4PSW B;  3DM0 A;  2OVQ B;  4EWR A;  3OKY B;  2HJB A;  2YNO A;  3DXM C;  4J77 A;  2IUP A;  2B4E A;  4BL0 A;  3I7N A;  3SBR A;  4A08 A;  2EBS A;  3OL2 A;  3PXT D;  4UI9 R;  3EI1 B;  2QC5 A;  3F3P A;  1TBG A;  3AFC A;  5GXI A;  3W15 A;  4KFM B;  4JSP C;  4PNK B;  5H17 A;  3PVU B;  1K8K C;  4A09 B;  4Z8L A;  2HYE A;  3SMR A;  1QNI A;  4FAN D;  4L1Q D;  3AL9 A;  4A11 B;  3L4M D;  4BH6 A;  1Q47 A;  3OKY A;  4LGN A;  4CY3 A;  3PSL A;  4QRJ A;  3UVL A;  3SJL D;  1MG3 A;  4J8G A;  3I7H A;  5C2W B;  3GFC A;  3UVK A;  4ZOY A;  1NEX B;  3J80 g;  1GOT B;  2IWK A;  5EAP A;  3EI1 A;  2J56 H;  4XYH A;  4XYI A;  5AJA A;  3I2N A;  4GQB B;  4D0K A;  4GQ1 A;  3MXX A;  2PM7 B;  2CNX A;  3K27 A;  4A09 A;  2P9N C;  2HJ4 A;  5IJ7 E;  4GGD A;  5FKR A;  4G56 B;  4K3J B;  3RLM D;  1K32 A;  3ULE C;  5EAL A;  3JPX A;  5EMK B;  3FRX A;  2AGY A;  2I0T A;  4E54 B;  2TRC B;  3DSM A;  3I8C A;  4CC9 A;  4GM8 A;  2AH1 A;  4PXW A;  5CXC B;  2G9A A;  3SLE D;  1NR0 A;  4X60 B;  5H1M A;  4ZOX A;  4GGC A;  4H5J A;  2OK4 A;  1JMX B;  5TF2 A;  2OVR B;  3EG6 A;  2H14 A;  4JSX C;  2OIZ A;  4E54 A;  4MK0 B;  2AH0 A;  2P9U C;  4J84 A;  3V7D B;  3EI2 B;  3CIK B;  1PEV A;  5CXC A;  4O1Q D;  5FKQ A;  1L0Q A;  4A2M A;  5FKS A;  4ERY A;  4ERQ A;  2GNQ A;  2J57 G;  4FWW A;  2YNN A;  3RRM C;  4JD2 C;  5K19 A;  3NVX A;  2B5L A;  4PBY A;  1N6F A;  4ESG A;  3IJ1 A;  5AFU 3;  3PE7 A;  3MKS B;  1MG2 A;  1SQJ A;  2BBK H;  4O9D A;  3KRW B;  5THA A;  3SBQ A;  4CZV A;  4J0W A;  3AL8 B;  3JRO A;  4L3G D;  1SHY B;  3IIW A;  3FGB A;  4FB1 D;  3EI2 A;  5FLX g;  2W18 A;  4J78 A;  3SFZ A;  3VGZ A;  4FA5 D;  3EI4 B;  2IAA A;  5I5M A;  2XL3 A;  4Y5R D;  2HES X;  4CZX A;  3N0E A;  1JOF A;  5EAM A;  1PBY B;  3VH0 A;  4R7A B;  3U4Y A;  4XEI C;  3C75 H;  2OVP B;  2HKM A;  4CI1 A;  3DXK C;  3I7K A;  2IWF A;  1XHM A;  5A2Q g;  3RN1 D;  4N14 A;  4GM3 A;  3GRE A;  4GQ2 P;  3AL8 A;  1PGU A;  1N6D A;  3UVM A;  2OJY A;  2H9N A;  3EI4 A;  4O3U B;  1S4U X;  3NVQ A;  3UKR C;  2CO0 C;  2MTA H;  5HE3 B;  2QXV A;  3MZK A;  3EWE A;  4FA9 D;  4L3H D;  2AGW A;  3C99 A;  4OZU A;  4ZOV A;  2H9L A;  4A11 A;  2H13 A;  5IT9 g;  2YNP A;  4X3E A;  3JZN A;  4H5I A;  3BG0 A;  3I89 A;  2XU7 A;  2CE9 A;  2H47 A;  2IUV A;  2H9P A;  5EM2 B;  4GM9 A;  2Q7Q A;  4PBZ A;  4JT6 C;  2HKR A;  5HE1 B;  3F3G A;  2O9K A;  2PM9 B;  2XL2 A;  5IC7 A;  2I3S A;  2YB8 B;  1XKS A;  2P9P C;  5IGQ A;  4CZY A;  5CYK B;  4ERZ A;  2YMU A;  4CI8 A;  3SXT D;  3C9C A;  4L9O A;  5FXY A;  3RFG A;  4E5Z B;  2H3X A;  4J8B A;  1U2V C;  1MDA H;  3EU7 A;  3EMH A;  1SQ9 A;  5EM2 A;  3MZL A;  5EMJ B;  4LG8 A;  3SVW D;  3PXS D;  5GSA A;  3BWS A;  2PM9 A;  5H14 A;  1GG2 B;  5EAR A;  5I5I A;  5CYK A;  4PSX B;  1N6E A;  3FM0 A;  3IJ0 A;  3P4F A;  2P9S C;  4A2L A;  2GC7 A;  1TYQ C;  2YBA A;  4A08 B;  4QT8 A;  3KRX B;  4E5Z A;  4A0A B;  1ERJ A;  1OMW B;  5IJ8 E;  2Z2P A;  4JSN C;  5HQG A;  4TZ4 A;  4J73 A;  3JAM g;  3A0F A;  2I3T A;  5I5J A;  3SN6 B;  3N0D A;  4HDJ A;  3RFH A;  4J82 A;  2IUR A;  3I7P A;  3JZH A;  4J79 A;  2I0R A;  3EI3 B;  2G99 A;  2B5M A;  3NVN A;  4A7J A;  3MKQ A;  3V9F A;  2AGX A;  3ODT A;  1GXR A;  3B7F A;  2Z2O A;  3ORV D;  4J0X A;  4O3T B;  5AMS A;  4JT5 C;  1RI6 A;  4NSX A;  4A0A A;  4QL1 A;  2CN3 A;  2H6Q A;  3MMY A;  4FA4 D;  2B5N A;  4IMM A;  2H68 A;  5KDO B;  2AQ5 A;  5TDH B;  1A0R B;  2CN2 A;  4D6V A;  2P9K C;  2H6K A;  5K1C C;  5GMK n;  3EI3 A;  5EML B;  4OWR A;  3PVW B;  4J81 A;  3IJC A;  4AOW A;  1P22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...