5K19A

Crystal structure of wd repeat-containing protein 20
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
553
structure length
376
Chain Sequence
NEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSSNPVRVSFVNLNSGNGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTGGEDDLVTVWSFVDCRVIARGHGHKSWVSVVAFDPYTTSVEEGDVTYRFGSVGQDTQLCLWDLTEDILFPVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGRPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords WD repeat-containing protein 20
publication title Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 376
sequence length 553
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5k19A00
3KRXB 4A0BB 4A11B 3NVXA 5CXBB 5THAA 4JSNC 4FAVD 4QT8A 3UKUC 3PE7A 3J81g 3DWLC 3EI4B 2YNPA 2CN2A 4J77A 2HKRA 3IIWA 1YFQA 3I7OA 3RMZD 4YVDA 3BWSA 3MZKA 5GXHA 3JZNA 4A08B 4E5ZB 3CFVA 4HDJA 1SQJA 2IWKA 3C5MA 4Y7RA 2J55H 1ERJA 3EWEA 4FHLA 2O9KA 1A0RB 4A0BA 3AH8B 5CXBA 4Z8LA 3V9FA 1PI6A 4GGCA 5EM2A 1RI6A 3L4MD 3JROA 2Z2OA 4FWWA 2OIZA 4IA9A 2P9PC 4GGAA 2H9LA 5EMJB 4CY1A 4ZN4A 4A08A 3MKQA 4CY3A 4A0AA 3AFCA 4LG8A 1VYHC 3OKYA 4E54B 4GZ8A 4D0KA 3PSLA 3I8CA 1JOFA 3OKWA 1JJUB 1SHYB 3F3FA 3JZGA 4KFMB 1L0QA 3UVMA 3PVUB 4ZOVA 2HESX 4ES0A 2IUQA 4OWRA 3GREA 5SXMA 4J73A 1NEXB 4A09B 2H14A 4J8BA 4PBYA 2OJYA 2Q7QA 3AL8A 2P9SC 4ZOXA 1N6EA 3OL2B 2GC4A 2H47A 4PXWA 5CXCB 3I2NA 2YMUA 4J81A 2QXVA 2IUPA 2CN3A 1QNIA 3EI3B 4PC0A 4CY5A 1FWXA 3V7DB 5HYNB 3K26A 2H9PA 3MXXA 3P4FA 2J57G 4X63B 1JMZB 2AGLA 4CI8A 3PXTD 4X60B 5KDOB 3IJ0A 3PXSD 5FA5B 3I7LA 4U7AA 1Q47A 3F3PA 5EAPA 3ZWLB 2EBSA 1P22A 2YNOA 5GMKn 5FLXg 5AMSA 2H6KA 3OKTA 3SN6B 2I3SA 4JSVC 5A2Qg 1U2VC 4A2LA 2PBIB 3CFSB 3A0FA 3KRWB 1JMXB 2YNNA 3EI3A 3C99A 4L1QD 2H6QA 4TZ4A 4GQ1A 1PBYB 4BL0A 1NR0A 4JXMA 2HJBA 2I3TA 5EAMA 5IT9g 2UZYB 3I7KA 5H17A 4H5IA 4CI1A 2CO0C 3MMYA 5GXIA 3UVOA 3RN0D 4O3UB 3EG6A 4FAND 2B5MA 3JPXA 1MG2A 2PM9B 4Y5RD 3SBRA 4AEZA 4ZOZA 5GSAA 4CI2A 2I0RA 5TF2A 3ODTA 2P9UC 4PBZA 3UVNA 3IJ1A 4NSXA 4L3GD 3E0CA 3V5WB 4A11A 4GM9A 4BUJC 3OW8A 1XHMA 2B4EA 4GM8A 4U1EI 1OLZA 2H13A 2YBAA 3MKSB 2PM6B 3EI4A 4N14A 4A2MA 2HJ4A 2Z2NA 3UVKA 2PM9A 3DSMA 4GQ2P 5TEEA 3JAMg 4XYHA 4J0WA 3RFGA 3GFCA 4E5ZA 4FB1D 4JSXC 4O45A 4J78A 3F3GA 2AGXA 2GNQA 3FGBA 1OMWB 4J86A 4ESGA 1N6FA 4QQEA 3FRXA 3ORVD 4XYIA 4QRJA 2P9KC 5FXYA 2OK4A 4GQBB 3SWSD 3SLED 3EMHA 3UVLA 3SHFA 3RRMC 3DXMC 4J84A 5FKTA 5FKRA 3SMRA 1MG3A 1SQ9A 3I7NA 3PXWD 2CO0A 2B5NA 2MTAH 4J8GA 2HYEA 3JB9L 2OVRB 5FKSA 4GGDA 4E54A 3HFQA 2IURA 5TEFA 4JT6C 3K27A 4JD2C 4GMBA 3I7PA 4XEIC 4MK0B 3C9CA 5C9ZB 3CIKB 3NVQA 2XL3A 1K8KC 2H9MA 3DM0A 1MDAH 3SBQA 4A09A 2XU7A 5IC7A 4J87A 2AGZA 3RFHA 4FA9D 3RN1D 5HE0B 1XKSA 3OL2A 2AGYA 5K19A 5I5JA 2P9NC 5CXCA 2BBKH 1PEVA 4I79A 2HKMA 4O3TB 5K1CC 3SJLD 5IJ8E 2GC7A 3RLMD 4J0XA 2CE8A 4CC9A 4CZYA 2AQ5A 1GOTB 5EARA 5EMKB 3I89A 2OVQB 4K3JB 4O1QD 3JZHA 5HE1B 4CI3A 2J56H 4CZVA 3B7FA 3AL9A 3EI1B 2W18A 1N6DA 3OTTA 3SXTD 4ERYA 4QL1A 3IKOA 4PSXB 3UR4A 2B5LA 4H5JA 5EMLB 4ERQA 3C75H 5EM2B 3EI2B 4X3EA 3FM0A 3SFZA 1TBGA 5JWZA 3DXKC 3IIYA 2BCJB 4FA1D 4J82A 2P9LC 4ERZA 2QC5A 3I7HA 3EI1A 1GG2B 4ZOYA 5FKQA 5CYKB 2PM7B 3MZLA 4A0AB 3OKYB 5TDHB 5B4WA 5EALA 1GXRA 5HQGA 3SCYA 4FA5D 4JSPC 4L9OA 5AFU3 4EWRA 3EI2A 1B9XA 3ULEC 4A7JA 3N0DA 4AOWA 3SBPA 5IGOA 3J80g 5HE2B 4CZXA 1S4UX 5H1MA 3AL8B 3IJCA 4PNKB 3PVWB 3U4YA 5EMMB 5CYKA 4L3HD 5H14A 3SVWD 3BG0A 2AH0A 4JT5C 3I8EA 1U4CA 1B9YA 5I5IA 3VH0A 1PGUA 4LGNA 5AJAA 2OK6A 4J79A 1GP2B 2HXCA 2CNXA 2XYIA 4G56B 2CE9A 2AH1A 2XL2A 5C2VB 2YB8B 4IMMA 1R5MA 3RSEC 2TRCB 3VA6A 4LG9A 4UI9R 1K32A 3EU7A 2G9AA 1TYQC 4CY2A 4BH6A 3NVNA 4OZUA 5FQDA 2H68A 1XIPA 4FA4D 4D6VA 5IJ7E 5C2WB 4PSWB 2Z2PA 3JRPA 2IAAA 4K3ID 3BG1A 4X61B 4GM3A 2H9NA 3VGZA 2I0SA 4R7AB 5I5MA 3N0EA 3PSCB 2OVPB 2H3XA 3L4OD 2H6NA 2UZXB 2IWFA 3W15A 2P9IC 4O9DA 2G99A 5IGQA 2AGWA 3UKRC 2IUVA 5HE3B 2I0TA
chains in the Genus database with same CATH superfamily
3IUNA 3KRXB 2VDQA 1T2XA 4NC4A 4A0BB 4A11B 3NVXA 5CXBB 5THAA 3ZDXA 4JSNC 4FAVD 4QT8A 3UKUC 3PE7A 3J81g 3DWLC 3EI4B 4RE5A 2YNPA 1O6GA 4Z7QA 2CN2A 3KCIA 4J77A 2HKRA 3IIWA 1YFQA 3I7OA 3RMZD 4YVDA 3BWSA 3MZKA 5GXHA 3JZNA 4A08B 4E5ZB 2VDNA 3CFVA 4G55A 4HDJA 1SQJA 2IWKA 3C5MA 4Y7RA 3VI4A 2J55H 1ERJA 3EWEA 4FHLA 2O9KA 1A0RB 4BP9A 4A0BA 3AH8B 5CXBA 4Z8LA 3V9FA 1PI6A 3ZE0A 4GGCA 5EM2A 1RI6A 3L4MD 3JROA 2Z2OA 4FWWA 1QFMA 2OIZA 4IA9A 2P9PC 1UOQA 4GGAA 4O02A 2H9LA 5EMJB 2HU7A 3MUNA 4CY1A 4ZN4A 1O6FA 1UOOA 4A08A 3MKQA 4CY3A 4A0AA 3AFCA 4LG8A 1VYHC 3OKYA 4E54B 4GZ8A 4D0KA 3PSLA 3I8CA 4AMYA 2EIBA 1JOFA 3EQ9A 3OKWA 1JJUB 1H2YA 1SHYB 4O2WA 3F3FA 3JZGA 4KFMB 1L0QA 3UVMA 3PVUB 4ZOVA 2HESX 4ES0A 3NIDA 2IUQA 4OWRA 3GREA 2EIDA 5SXMA 4J73A 4DNUA 1NEXB 4A09B 3EQ7A 4DNWA 2H14A 4BCDA 4J8BA 4PBYA 3AL8A 2OJYA 1E8MA 2Q7QA 2P9SC 4ZOXA 1N6EA 3OL2B 2GC4A 2H47A 4JHNA 4PXWA 1GOHA 5CXCB 3I2NA 2YMUA 4J81A 2QXVA 2IUPA 3MUOA 2CN3A 1QNIA 1TYEA 5M5TA 2VDRA 3EI3B 4PC0A 1FWXA 1C9IA 4CY5A 3ZE1A 3V7DB 5HYNB 3K26A 2H9PA 3MXXA 1H2ZA 3NIFA 2J57G 3P4FA 4X63B 1JMZB 1UTCA 2AGLA 4CI8A 3PXTD 4X60B 5KDOB 5FFGA 3V4PA 3IJ0A 4WK0A 3PXSD 5FA5B 3DDUA 3I7LA 4U7AA 1Q47A 3F3PA 5EAPA 3ZWLB 4G1MA 2EBSA 1P22A 2YNOA 3T3MA 5GMKn 3IUJA 4UM8A 5FLXg 4NAAA 5AMSA 2H6KA 3OKTA 3SN6B 2I3SA 4JSVC 5A2Qg 1U2VC 4A2LA 1JV2A 4QAMA 2PBIB 3CFSB 3A0FA 3KRWB 1JMXB 3GD1I 2YNNA 3EI3A 3C99A 4L1QD 1VE7A 2H6QA 4TZ4A 4GQ1A 1PBYB 4BL0A 1NR0A 4JXMA 3EQ8A 2HJBA 2I3TA 5EAMA 5IT9g 1U8CA 1H2XA 3ZDYA 2UZYB 3I7KA 5H17A 4MMXA 1GOFA 4H5IA 1C9LA 2XE4A 4CI1A 2CO0C 3MMYA 4BCCA 5GXIA 3UVOA 2JKXA 3RN0D 4O3UB 3QHYB 3EG6A 1BPOA 4FAND 2B5MA 3JPXA 4Z7OA 1MG2A 2PM9B 4Y5RD 3SBRA 4AEZA 4ZOZA 3O4JA 4CI2A 2I0RA 5TF2A 5GSAA 3ODTA 2P9UC 4PBZA 4BCBA 3UVNA 3IJ1A 4NSXA 4L3GD 3E0CA 3V5WB 4A11A 4BP8A 4GM9A 4BUJC 3OW8A 1XHMA 5E6SA 2B4EA 4GM8A 4U1EI 1OLZA 2H13A 2YBAA 4D9SA 2VDKA 3MKSB 2PM6B 3EI4A 4N14A 4A2MA 2HJ4A 5M5RA 2Z2NA 3UVKA 2PM9A 3DSMA 4GQ2P 5TEEA 3JAMg 1VZ2A 4XYHA 4J0WA 2WQ8A 3GFCA 1M1XA 3RFGA 4E5ZA 4FB1D 4JSXC 4O45A 4J78A 3F3GA 4Z7NA 2AGXA 2GNQA 3FGBA 1OMWB 3O4HA 4J86A 5M5VA 4ESGA 1N6FA 4QQEA 3FRXA 4WK4A 3ORVD 4JHPC 4XYIA 4QRJA 2P9KC 5FXYA 2OK4A 4GQBB 3SWSD 3SLED 3EMHA 3UVLA 3SHFA 3RRMC 3DXMC 4J84A 5FKTA 1VE6A 5FKRA 3SMRA 1MG3A 1SQ9A 3I7NA 3PXWD 2CO0A 3QI0A 2B5NA 2MTAH 4J8GA 2HYEA 3JB9L 2OVRB 5FKSA 4GGDA 3O4GA 3HFQA 4E54A 2VDLA 2IURA 5TEFA 3IJEA 4JT6C 3ZDZA 3K27A 4JD2C 4GMBA 2VZ3A 3K72A 4WJKA 2VDOA 3I7PA 1A12A 4XEIC 4MK0B 5C86A 3C9CA 5C9ZB 3CIKB 3NVQA 4MMZA 2BKLA 2XL3A 1K8KC 2H9MA 3DM0A 4MMYA 1MDAH 3SBQA 4A09A 2XU7A 5IC7A 4J87A 2AGZA 3RFHA 4FA9D 3RN1D 2XZGA 1XKSA 5HE0B 3OL2A 2AGYA 5K19A 5I5JA 2P9NC 5CXCA 2BBKH 1PEVA 4I79A 2HKMA 4O3TB 5K1CC 5HDBA 3SJLD 3T3PA 5IJ8E 2GC7A 3RLMD 4J0XA 2CE8A 4CC9A 2XDWA 4CZYA 2AQ5A 1GOTB 5EARA 5EMKB 3I89A 2OVQB 4K3JB 4O1QD 3JZHA 5HE1B 5E6RA 4CI3A 2J56H 4CZVA 3B7FA 3AL9A 3EI1B 2W18A 1N6DA 3OTTA 1E5TA 3SXTD 4ERYA 4QL1A 3GC3B 4AN1A 3OF7A 3IKOA 4PSXB 3UR4A 1E8NA 2B5LA 1I2MB 4H5JA 5EMLB 4ERQA 3C75H 5C92A 5EM2B 3EI2B 4X3EA 3FM0A 2EICA 3V4VA 3SFZA 1TBGA 4AN0A 3DXKC 5JWZA 3IIYA 2EIEA 2BCJB 3O4IA 4G1EA 4FA1D 4J82A 1YR2A 2P9LC 4ERZA 2QC5A 3I7HA 3EI1A 1GG2B 4ZOYA 5FKQA 4IRZA 2PM7B 3MZLA 5CYKB 4A0AB 4AMZA 3FCSA 3OKYB 5TDHB 5B4WA 5EALA 1GXRA 5HQGA 3SCYA 4FA5D 4JSPC 4L9OA 5AFU3 4EWRA 2QZPA 3EI2A 1B9XA 3ULEC 4A7JA 5FFOA 5M5SA 3N0DA 4AOWA 3SBPA 5IGOA 4RE6A 3J80g 4NENA 5HE2B 4CZXA 3FCUA 1S4UX 5H1MA 5M61A 3AL8B 3IJCA 3IURA 4PNKB 3PVWB 3U4YA 5EMMB 5CYKA 4L3HD 5H14A 3SVWD 1VZ3A 1L5GA 3IUMA 3VI3A 3BG0A 2AH0A 2VZ1A 5M5UA 4JT5C 3I8EA 1U4CA 1B9YA 5I5IA 3IULA 3VH0A 1K3IA 1PGUA 2HU5A 3NIGA 4LGNA 5AJAA 2OK6A 3IUQA 4J79A 1GP2B 2HXCA 2CNXA 2XYIA 4UM9A 4G56B 2CE9A 4AX4A 2AH1A 5E6UA 2XL2A 5C2VB 2YB8B 4IMMA 1R5MA 2VDMA 3RSEC 2TRCB 3K71A 1QFSA 3VA6A 4LG9A 4L1MA 3ZE2A 4UI9R 1K32A 3EU7A 2G9AA 1H2WA 1TYQC 4CY2A 4BH6A 3NVNA 4OZUA 4WK2A 3K6SA 5FQDA 2H68A 4NBMA 1XIPA 4FA4D 4D6VA 5IJ7E 5C2WB 4PSWB 2Z2PA 3JRPA 2IAAA 4K3ID 2QR5A 2VDPA 3IVMA 3BG1A 4X61B 3MVDK 4GM3A 2H9NA 2VC2A 3VGZA 2I0SA 4R7AB 5I5MA 3N0EA 3PSCB 1UOPA 2OVPB 2H3XA 3L4OD 2H6NA 1JTDB 2UZXB 2IWFA 3W15A 2P9IC 4O9DA 2G99A 2HU8A 1GOGA 5IGQA 2AGWA 3UKRC 2IUVA 5HE3B 4DNVA 2I0TA
chains in the Genus database with same CATH topology
3KRXB 4A0BB 4A11B 3NVXA 5CXBB 5THAA 4JSNC 4FAVD 4QT8A 3UKUC 3PE7A 3J81g 3DWLC 3EI4B 2YNPA 2CN2A 4J77A 2HKRA 3IIWA 1YFQA 3I7OA 3RMZD 4YVDA 3BWSA 3MZKA 5GXHA 3JZNA 4A08B 4E5ZB 3CFVA 4HDJA 1SQJA 2IWKA 3C5MA 4Y7RA 2J55H 1ERJA 3EWEA 4FHLA 2O9KA 1A0RB 4A0BA 3AH8B 5CXBA 4Z8LA 3V9FA 1PI6A 4GGCA 5EM2A 1RI6A 3L4MD 3JROA 2Z2OA 4FWWA 2OIZA 4IA9A 2P9PC 4GGAA 2H9LA 5EMJB 4CY1A 4ZN4A 4A08A 3MKQA 4CY3A 4A0AA 3AFCA 4LG8A 1VYHC 3OKYA 4E54B 4GZ8A 4D0KA 3PSLA 3I8CA 1JOFA 3OKWA 1JJUB 1SHYB 3F3FA 3JZGA 4KFMB 1L0QA 3UVMA 3PVUB 4ZOVA 2HESX 4ES0A 2IUQA 4OWRA 3GREA 5SXMA 4J73A 1NEXB 4A09B 2H14A 4J8BA 4PBYA 2OJYA 2Q7QA 3AL8A 2P9SC 4ZOXA 1N6EA 3OL2B 2GC4A 2H47A 4PXWA 5CXCB 3I2NA 2YMUA 4J81A 2QXVA 2IUPA 2CN3A 1QNIA 3EI3B 4PC0A 4CY5A 1FWXA 3V7DB 5HYNB 3K26A 2H9PA 3MXXA 3P4FA 2J57G 4X63B 1JMZB 2AGLA 4CI8A 3PXTD 4X60B 5KDOB 3IJ0A 3PXSD 5FA5B 3I7LA 4U7AA 1Q47A 3F3PA 5EAPA 3ZWLB 2EBSA 1P22A 2YNOA 5GMKn 5FLXg 5AMSA 2H6KA 3OKTA 3SN6B 2I3SA 4JSVC 5A2Qg 1U2VC 4A2LA 2PBIB 3CFSB 3A0FA 3KRWB 1JMXB 2YNNA 3EI3A 3C99A 4L1QD 2H6QA 4TZ4A 4GQ1A 1PBYB 4BL0A 1NR0A 4JXMA 2HJBA 2I3TA 5EAMA 5IT9g 2UZYB 3I7KA 5H17A 4H5IA 4CI1A 2CO0C 3MMYA 5GXIA 3UVOA 3RN0D 4O3UB 3EG6A 4FAND 2B5MA 3JPXA 1MG2A 2PM9B 4Y5RD 3SBRA 4AEZA 4ZOZA 5GSAA 4CI2A 2I0RA 5TF2A 3ODTA 2P9UC 4PBZA 3UVNA 3IJ1A 4NSXA 4L3GD 3E0CA 3V5WB 4A11A 4GM9A 4BUJC 3OW8A 1XHMA 2B4EA 4GM8A 4U1EI 1OLZA 2H13A 2YBAA 3MKSB 2PM6B 3EI4A 4N14A 4A2MA 2HJ4A 2Z2NA 3UVKA 2PM9A 3DSMA 4GQ2P 5TEEA 3JAMg 4XYHA 4J0WA 3RFGA 3GFCA 4E5ZA 4FB1D 4JSXC 4O45A 4J78A 3F3GA 2AGXA 2GNQA 3FGBA 1OMWB 4J86A 4ESGA 1N6FA 4QQEA 3FRXA 3ORVD 4XYIA 4QRJA 2P9KC 5FXYA 2OK4A 4GQBB 3SWSD 3SLED 3EMHA 3UVLA 3SHFA 3RRMC 3DXMC 4J84A 5FKTA 5FKRA 3SMRA 1MG3A 1SQ9A 3I7NA 3PXWD 2CO0A 2B5NA 2MTAH 4J8GA 2HYEA 3JB9L 2OVRB 5FKSA 4GGDA 4E54A 3HFQA 2IURA 5TEFA 4JT6C 3K27A 4JD2C 4GMBA 3I7PA 4XEIC 4MK0B 3C9CA 5C9ZB 3CIKB 3NVQA 2XL3A 1K8KC 2H9MA 3DM0A 1MDAH 3SBQA 4A09A 2XU7A 5IC7A 4J87A 2AGZA 3RFHA 4FA9D 3RN1D 5HE0B 1XKSA 3OL2A 2AGYA 5K19A 5I5JA 2P9NC 5CXCA 2BBKH 1PEVA 4I79A 2HKMA 4O3TB 5K1CC 3SJLD 5IJ8E 2GC7A 3RLMD 4J0XA 2CE8A 4CC9A 4CZYA 2AQ5A 1GOTB 5EARA 5EMKB 3I89A 2OVQB 4K3JB 4O1QD 3JZHA 5HE1B 4CI3A 2J56H 4CZVA 3B7FA 3AL9A 3EI1B 2W18A 1N6DA 3OTTA 3SXTD 4ERYA 4QL1A 3IKOA 4PSXB 3UR4A 2B5LA 4H5JA 5EMLB 4ERQA 3C75H 5EM2B 3EI2B 4X3EA 3FM0A 3SFZA 1TBGA 5JWZA 3DXKC 3IIYA 2BCJB 4FA1D 4J82A 2P9LC 4ERZA 2QC5A 3I7HA 3EI1A 1GG2B 4ZOYA 5FKQA 5CYKB 2PM7B 3MZLA 4A0AB 3OKYB 5TDHB 5B4WA 5EALA 1GXRA 5HQGA 3SCYA 4FA5D 4JSPC 4L9OA 5AFU3 4EWRA 3EI2A 1B9XA 3ULEC 4A7JA 3N0DA 4AOWA 3SBPA 5IGOA 3J80g 5HE2B 4CZXA 1S4UX 5H1MA 3AL8B 3IJCA 4PNKB 3PVWB 3U4YA 5EMMB 5CYKA 4L3HD 5H14A 3SVWD 3BG0A 2AH0A 4JT5C 3I8EA 1U4CA 1B9YA 5I5IA 3VH0A 1PGUA 4LGNA 5AJAA 2OK6A 4J79A 1GP2B 2HXCA 2CNXA 2XYIA 4G56B 2CE9A 2AH1A 2XL2A 5C2VB 2YB8B 4IMMA 1R5MA 3RSEC 2TRCB 3VA6A 4LG9A 4UI9R 1K32A 3EU7A 2G9AA 1TYQC 4CY2A 4BH6A 3NVNA 4OZUA 5FQDA 2H68A 1XIPA 4FA4D 4D6VA 5IJ7E 5C2WB 4PSWB 2Z2PA 3JRPA 2IAAA 4K3ID 3BG1A 4X61B 4GM3A 2H9NA 3VGZA 2I0SA 4R7AB 5I5MA 3N0EA 3PSCB 2OVPB 2H3XA 3L4OD 2H6NA 2UZXB 2IWFA 3W15A 2P9IC 4O9DA 2G99A 5IGQA 2AGWA 3UKRC 2IUVA 5HE3B 2I0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRX B;  4A0B B;  4A11 B;  3NVX A;  5CXB B;  5THA A;  4JSN C;  4FAV D;  4QT8 A;  3UKU C;  3PE7 A;  3J81 g;  3DWL C;  3EI4 B;  2YNP A;  2CN2 A;  4J77 A;  2HKR A;  3IIW A;  1YFQ A;  3I7O A;  3RMZ D;  4YVD A;  3BWS A;  3MZK A;  5GXH A;  3JZN A;  4A08 B;  4E5Z B;  3CFV A;  4HDJ A;  1SQJ A;  2IWK A;  3C5M A;  4Y7R A;  2J55 H;  1ERJ A;  3EWE A;  4FHL A;  2O9K A;  1A0R B;  4A0B A;  3AH8 B;  5CXB A;  4Z8L A;  3V9F A;  1PI6 A;  4GGC A;  5EM2 A;  1RI6 A;  3L4M D;  3JRO A;  2Z2O A;  4FWW A;  2OIZ A;  4IA9 A;  2P9P C;  4GGA A;  2H9L A;  5EMJ B;  4CY1 A;  4ZN4 A;  4A08 A;  3MKQ A;  4CY3 A;  4A0A A;  3AFC A;  4LG8 A;  1VYH C;  3OKY A;  4E54 B;  4GZ8 A;  4D0K A;  3PSL A;  3I8C A;  1JOF A;  3OKW A;  1JJU B;  1SHY B;  3F3F A;  3JZG A;  4KFM B;  1L0Q A;  3UVM A;  3PVU B;  4ZOV A;  2HES X;  4ES0 A;  2IUQ A;  4OWR A;  3GRE A;  5SXM A;  4J73 A;  1NEX B;  4A09 B;  2H14 A;  4J8B A;  4PBY A;  2OJY A;  2Q7Q A;  3AL8 A;  2P9S C;  4ZOX A;  1N6E A;  3OL2 B;  2GC4 A;  2H47 A;  4PXW A;  5CXC B;  3I2N A;  2YMU A;  4J81 A;  2QXV A;  2IUP A;  2CN3 A;  1QNI A;  3EI3 B;  4PC0 A;  4CY5 A;  1FWX A;  3V7D B;  5HYN B;  3K26 A;  2H9P A;  3MXX A;  3P4F A;  2J57 G;  4X63 B;  1JMZ B;  2AGL A;  4CI8 A;  3PXT D;  4X60 B;  5KDO B;  3IJ0 A;  3PXS D;  5FA5 B;  3I7L A;  4U7A A;  1Q47 A;  3F3P A;  5EAP A;  3ZWL B;  2EBS A;  1P22 A;  2YNO A;  5GMK n;  5FLX g;  5AMS A;  2H6K A;  3OKT A;  3SN6 B;  2I3S A;  4JSV C;  5A2Q g;  1U2V C;  4A2L A;  2PBI B;  3CFS B;  3A0F A;  3KRW B;  1JMX B;  2YNN A;  3EI3 A;  3C99 A;  4L1Q D;  2H6Q A;  4TZ4 A;  4GQ1 A;  1PBY B;  4BL0 A;  1NR0 A;  4JXM A;  2HJB A;  2I3T A;  5EAM A;  5IT9 g;  2UZY B;  3I7K A;  5H17 A;  4H5I A;  4CI1 A;  2CO0 C;  3MMY A;  5GXI A;  3UVO A;  3RN0 D;  4O3U B;  3EG6 A;  4FAN D;  2B5M A;  3JPX A;  1MG2 A;  2PM9 B;  4Y5R D;  3SBR A;  4AEZ A;  4ZOZ A;  5GSA A;  4CI2 A;  2I0R A;  5TF2 A;  3ODT A;  2P9U C;  4PBZ A;  3UVN A;  3IJ1 A;  4NSX A;  4L3G D;  3E0C A;  3V5W B;  4A11 A;  4GM9 A;  4BUJ C;  3OW8 A;  1XHM A;  2B4E A;  4GM8 A;  4U1E I;  1OLZ A;  2H13 A;  2YBA A;  3MKS B;  2PM6 B;  3EI4 A;  4N14 A;  4A2M A;  2HJ4 A;  2Z2N A;  3UVK A;  2PM9 A;  3DSM A;  4GQ2 P;  5TEE A;  3JAM g;  4XYH A;  4J0W A;  3RFG A;  3GFC A;  4E5Z A;  4FB1 D;  4JSX C;  4O45 A;  4J78 A;  3F3G A;  2AGX A;  2GNQ A;  3FGB A;  1OMW B;  4J86 A;  4ESG A;  1N6F A;  4QQE A;  3FRX A;  3ORV D;  4XYI A;  4QRJ A;  2P9K C;  5FXY A;  2OK4 A;  4GQB B;  3SWS D;  3SLE D;  3EMH A;  3UVL A;  3SHF A;  3RRM C;  3DXM C;  4J84 A;  5FKT A;  5FKR A;  3SMR A;  1MG3 A;  1SQ9 A;  3I7N A;  3PXW D;  2CO0 A;  2B5N A;  2MTA H;  4J8G A;  2HYE A;  3JB9 L;  2OVR B;  5FKS A;  4GGD A;  4E54 A;  3HFQ A;  2IUR A;  5TEF A;  4JT6 C;  3K27 A;  4JD2 C;  4GMB A;  3I7P A;  4XEI C;  4MK0 B;  3C9C A;  5C9Z B;  3CIK B;  3NVQ A;  2XL3 A;  1K8K C;  2H9M A;  3DM0 A;  1MDA H;  3SBQ A;  4A09 A;  2XU7 A;  5IC7 A;  4J87 A;  2AGZ A;  3RFH A;  4FA9 D;  3RN1 D;  5HE0 B;  1XKS A;  3OL2 A;  2AGY A;  5K19 A;  5I5J A;  2P9N C;  5CXC A;  2BBK H;  1PEV A;  4I79 A;  2HKM A;  4O3T B;  5K1C C;  3SJL D;  5IJ8 E;  2GC7 A;  3RLM D;  4J0X A;  2CE8 A;  4CC9 A;  4CZY A;  2AQ5 A;  1GOT B;  5EAR A;  5EMK B;  3I89 A;  2OVQ B;  4K3J B;  4O1Q D;  3JZH A;  5HE1 B;  4CI3 A;  2J56 H;  4CZV A;  3B7F A;  3AL9 A;  3EI1 B;  2W18 A;  1N6D A;  3OTT A;  3SXT D;  4ERY A;  4QL1 A;  3IKO A;  4PSX B;  3UR4 A;  2B5L A;  4H5J A;  5EML B;  4ERQ A;  3C75 H;  5EM2 B;  3EI2 B;  4X3E A;  3FM0 A;  3SFZ A;  1TBG A;  5JWZ A;  3DXK C;  3IIY A;  2BCJ B;  4FA1 D;  4J82 A;  2P9L C;  4ERZ A;  2QC5 A;  3I7H A;  3EI1 A;  1GG2 B;  4ZOY A;  5FKQ A;  5CYK B;  2PM7 B;  3MZL A;  4A0A B;  3OKY B;  5TDH B;  5B4W A;  5EAL A;  1GXR A;  5HQG A;  3SCY A;  4FA5 D;  4JSP C;  4L9O A;  5AFU 3;  4EWR A;  3EI2 A;  1B9X A;  3ULE C;  4A7J A;  3N0D A;  4AOW A;  3SBP A;  5IGO A;  3J80 g;  5HE2 B;  4CZX A;  1S4U X;  5H1M A;  3AL8 B;  3IJC A;  4PNK B;  3PVW B;  3U4Y A;  5EMM B;  5CYK A;  4L3H D;  5H14 A;  3SVW D;  3BG0 A;  2AH0 A;  4JT5 C;  3I8E A;  1U4C A;  1B9Y A;  5I5I A;  3VH0 A;  1PGU A;  4LGN A;  5AJA A;  2OK6 A;  4J79 A;  1GP2 B;  2HXC A;  2CNX A;  2XYI A;  4G56 B;  2CE9 A;  2AH1 A;  2XL2 A;  5C2V B;  2YB8 B;  4IMM A;  1R5M A;  3RSE C;  2TRC B;  3VA6 A;  4LG9 A;  4UI9 R;  1K32 A;  3EU7 A;  2G9A A;  1TYQ C;  4CY2 A;  4BH6 A;  3NVN A;  4OZU A;  5FQD A;  2H68 A;  1XIP A;  4FA4 D;  4D6V A;  5IJ7 E;  5C2W B;  4PSW B;  2Z2P A;  3JRP A;  2IAA A;  4K3I D;  3BG1 A;  4X61 B;  4GM3 A;  2H9N A;  3VGZ A;  2I0S A;  4R7A B;  5I5M A;  3N0E A;  3PSC B;  2OVP B;  2H3X A;  3L4O D;  2H6N A;  2UZX B;  2IWF A;  3W15 A;  2P9I C;  4O9D A;  2G99 A;  5IGQ A;  2AGW A;  3UKR C;  2IUV A;  5HE3 B;  2I0T A; 
#chains in the Genus database with same CATH topology
 3IUN A;  3KRX B;  2VDQ A;  1T2X A;  4NC4 A;  4A0B B;  4A11 B;  3NVX A;  5CXB B;  5THA A;  3ZDX A;  4JSN C;  4FAV D;  4QT8 A;  3UKU C;  3PE7 A;  3J81 g;  3DWL C;  3EI4 B;  4RE5 A;  2YNP A;  1O6G A;  4Z7Q A;  2CN2 A;  3KCI A;  4J77 A;  2HKR A;  3IIW A;  1YFQ A;  3I7O A;  3RMZ D;  4YVD A;  3BWS A;  3MZK A;  5GXH A;  3JZN A;  4A08 B;  4E5Z B;  2VDN A;  3CFV A;  4G55 A;  4HDJ A;  1SQJ A;  2IWK A;  3C5M A;  4Y7R A;  3VI4 A;  2J55 H;  1ERJ A;  3EWE A;  4FHL A;  2O9K A;  1A0R B;  4BP9 A;  4A0B A;  3AH8 B;  5CXB A;  4Z8L A;  3V9F A;  1PI6 A;  3ZE0 A;  4GGC A;  5EM2 A;  1RI6 A;  3L4M D;  3JRO A;  2Z2O A;  4FWW A;  1QFM A;  2OIZ A;  4IA9 A;  2P9P C;  1UOQ A;  4GGA A;  4O02 A;  2H9L A;  5EMJ B;  2HU7 A;  3MUN A;  4CY1 A;  4ZN4 A;  1O6F A;  1UOO A;  4A08 A;  3MKQ A;  4CY3 A;  4A0A A;  3AFC A;  4LG8 A;  1VYH C;  3OKY A;  4E54 B;  4GZ8 A;  4D0K A;  3PSL A;  3I8C A;  4AMY A;  2EIB A;  1JOF A;  3EQ9 A;  3OKW A;  1JJU B;  1H2Y A;  1SHY B;  4O2W A;  3F3F A;  3JZG A;  4KFM B;  1L0Q A;  3UVM A;  3PVU B;  4ZOV A;  2HES X;  4ES0 A;  3NID A;  2IUQ A;  4OWR A;  3GRE A;  2EID A;  5SXM A;  4J73 A;  4DNU A;  1NEX B;  4A09 B;  3EQ7 A;  4DNW A;  2H14 A;  4BCD A;  4J8B A;  4PBY A;  3AL8 A;  2OJY A;  1E8M A;  2Q7Q A;  2P9S C;  4ZOX A;  1N6E A;  3OL2 B;  2GC4 A;  2H47 A;  4JHN A;  4PXW A;  1GOH A;  5CXC B;  3I2N A;  2YMU A;  4J81 A;  2QXV A;  2IUP A;  3MUO A;  2CN3 A;  1QNI A;  1TYE A;  5M5T A;  2VDR A;  3EI3 B;  4PC0 A;  1FWX A;  1C9I A;  4CY5 A;  3ZE1 A;  3V7D B;  5HYN B;  3K26 A;  2H9P A;  3MXX A;  1H2Z A;  3NIF A;  2J57 G;  3P4F A;  4X63 B;  1JMZ B;  1UTC A;  2AGL A;  4CI8 A;  3PXT D;  4X60 B;  5KDO B;  5FFG A;  3V4P A;  3IJ0 A;  4WK0 A;  3PXS D;  5FA5 B;  3DDU A;  3I7L A;  4U7A A;  1Q47 A;  3F3P A;  5EAP A;  3ZWL B;  4G1M A;  2EBS A;  1P22 A;  2YNO A;  3T3M A;  5GMK n;  3IUJ A;  4UM8 A;  5FLX g;  4NAA A;  5AMS A;  2H6K A;  3OKT A;  3SN6 B;  2I3S A;  4JSV C;  5A2Q g;  1U2V C;  4A2L A;  1JV2 A;  4QAM A;  2PBI B;  3CFS B;  3A0F A;  3KRW B;  1JMX B;  3GD1 I;  2YNN A;  3EI3 A;  3C99 A;  4L1Q D;  1VE7 A;  2H6Q A;  4TZ4 A;  4GQ1 A;  1PBY B;  4BL0 A;  1NR0 A;  4JXM A;  3EQ8 A;  2HJB A;  2I3T A;  5EAM A;  5IT9 g;  1U8C A;  1H2X A;  3ZDY A;  2UZY B;  3I7K A;  5H17 A;  4MMX A;  1GOF A;  4H5I A;  1C9L A;  2XE4 A;  4CI1 A;  2CO0 C;  3MMY A;  4BCC A;  5GXI A;  3UVO A;  2JKX A;  3RN0 D;  4O3U B;  3QHY B;  3EG6 A;  1BPO A;  4FAN D;  2B5M A;  3JPX A;  4Z7O A;  1MG2 A;  2PM9 B;  4Y5R D;  3SBR A;  4AEZ A;  4ZOZ A;  3O4J A;  4CI2 A;  2I0R A;  5TF2 A;  5GSA A;  3ODT A;  2P9U C;  4PBZ A;  4BCB A;  3UVN A;  3IJ1 A;  4NSX A;  4L3G D;  3E0C A;  3V5W B;  4A11 A;  4BP8 A;  4GM9 A;  4BUJ C;  3OW8 A;  1XHM A;  5E6S A;  2B4E A;  4GM8 A;  4U1E I;  1OLZ A;  2H13 A;  2YBA A;  4D9S A;  2VDK A;  3MKS B;  2PM6 B;  3EI4 A;  4N14 A;  4A2M A;  2HJ4 A;  5M5R A;  2Z2N A;  3UVK A;  2PM9 A;  3DSM A;  4GQ2 P;  5TEE A;  3JAM g;  1VZ2 A;  4XYH A;  4J0W A;  2WQ8 A;  3GFC A;  1M1X A;  3RFG A;  4E5Z A;  4FB1 D;  4JSX C;  4O45 A;  4J78 A;  3F3G A;  4Z7N A;  2AGX A;  2GNQ A;  3FGB A;  1OMW B;  3O4H A;  4J86 A;  5M5V A;  4ESG A;  1N6F A;  4QQE A;  3FRX A;  4WK4 A;  3ORV D;  4JHP C;  4XYI A;  4QRJ A;  2P9K C;  5FXY A;  2OK4 A;  4GQB B;  3SWS D;  3SLE D;  3EMH A;  3UVL A;  3SHF A;  3RRM C;  3DXM C;  4J84 A;  5FKT A;  1VE6 A;  5FKR A;  3SMR A;  1MG3 A;  1SQ9 A;  3I7N A;  3PXW D;  2CO0 A;  3QI0 A;  2B5N A;  2MTA H;  4J8G A;  2HYE A;  3JB9 L;  2OVR B;  5FKS A;  4GGD A;  3O4G A;  3HFQ A;  4E54 A;  2VDL A;  2IUR A;  5TEF A;  3IJE A;  4JT6 C;  3ZDZ A;  3K27 A;  4JD2 C;  4GMB A;  2VZ3 A;  3K72 A;  4WJK A;  2VDO A;  3I7P A;  1A12 A;  4XEI C;  4MK0 B;  5C86 A;  3C9C A;  5C9Z B;  3CIK B;  3NVQ A;  4MMZ A;  2BKL A;  2XL3 A;  1K8K C;  2H9M A;  3DM0 A;  4MMY A;  1MDA H;  3SBQ A;  4A09 A;  2XU7 A;  5IC7 A;  4J87 A;  2AGZ A;  3RFH A;  4FA9 D;  3RN1 D;  2XZG A;  1XKS A;  5HE0 B;  3OL2 A;  2AGY A;  5K19 A;  5I5J A;  2P9N C;  5CXC A;  2BBK H;  1PEV A;  4I79 A;  2HKM A;  4O3T B;  5K1C C;  5HDB A;  3SJL D;  3T3P A;  5IJ8 E;  2GC7 A;  3RLM D;  4J0X A;  2CE8 A;  4CC9 A;  2XDW A;  4CZY A;  2AQ5 A;  1GOT B;  5EAR A;  5EMK B;  3I89 A;  2OVQ B;  4K3J B;  4O1Q D;  3JZH A;  5HE1 B;  5E6R A;  4CI3 A;  2J56 H;  4CZV A;  3B7F A;  3AL9 A;  3EI1 B;  2W18 A;  1N6D A;  3OTT A;  1E5T A;  3SXT D;  4ERY A;  4QL1 A;  3GC3 B;  4AN1 A;  3OF7 A;  3IKO A;  4PSX B;  3UR4 A;  1E8N A;  2B5L A;  1I2M B;  4H5J A;  5EML B;  4ERQ A;  3C75 H;  5C92 A;  5EM2 B;  3EI2 B;  4X3E A;  3FM0 A;  2EIC A;  3V4V A;  3SFZ A;  1TBG A;  4AN0 A;  3DXK C;  5JWZ A;  3IIY A;  2EIE A;  2BCJ B;  3O4I A;  4G1E A;  4FA1 D;  4J82 A;  1YR2 A;  2P9L C;  4ERZ A;  2QC5 A;  3I7H A;  3EI1 A;  1GG2 B;  4ZOY A;  5FKQ A;  4IRZ A;  2PM7 B;  3MZL A;  5CYK B;  4A0A B;  4AMZ A;  3FCS A;  3OKY B;  5TDH B;  5B4W A;  5EAL A;  1GXR A;  5HQG A;  3SCY A;  4FA5 D;  4JSP C;  4L9O A;  5AFU 3;  4EWR A;  2QZP A;  3EI2 A;  1B9X A;  3ULE C;  4A7J A;  5FFO A;  5M5S A;  3N0D A;  4AOW A;  3SBP A;  5IGO A;  4RE6 A;  3J80 g;  4NEN A;  5HE2 B;  4CZX A;  3FCU A;  1S4U X;  5H1M A;  5M61 A;  3AL8 B;  3IJC A;  3IUR A;  4PNK B;  3PVW B;  3U4Y A;  5EMM B;  5CYK A;  4L3H D;  5H14 A;  3SVW D;  1VZ3 A;  1L5G A;  3IUM A;  3VI3 A;  3BG0 A;  2AH0 A;  2VZ1 A;  5M5U A;  4JT5 C;  3I8E A;  1U4C A;  1B9Y A;  5I5I A;  3IUL A;  3VH0 A;  1K3I A;  1PGU A;  2HU5 A;  3NIG A;  4LGN A;  5AJA A;  2OK6 A;  3IUQ A;  4J79 A;  1GP2 B;  2HXC A;  2CNX A;  2XYI A;  4UM9 A;  4G56 B;  2CE9 A;  4AX4 A;  2AH1 A;  5E6U A;  2XL2 A;  5C2V B;  2YB8 B;  4IMM A;  1R5M A;  2VDM A;  3RSE C;  2TRC B;  3K71 A;  1QFS A;  3VA6 A;  4LG9 A;  4L1M A;  3ZE2 A;  4UI9 R;  1K32 A;  3EU7 A;  2G9A A;  1H2W A;  1TYQ C;  4CY2 A;  4BH6 A;  3NVN A;  4OZU A;  4WK2 A;  3K6S A;  5FQD A;  2H68 A;  4NBM A;  1XIP A;  4FA4 D;  4D6V A;  5IJ7 E;  5C2W B;  4PSW B;  2Z2P A;  3JRP A;  2IAA A;  4K3I D;  2QR5 A;  2VDP A;  3IVM A;  3BG1 A;  4X61 B;  3MVD K;  4GM3 A;  2H9N A;  2VC2 A;  3VGZ A;  2I0S A;  4R7A B;  5I5M A;  3N0E A;  3PSC B;  1UOP A;  2OVP B;  2H3X A;  3L4O D;  2H6N A;  1JTD B;  2UZX B;  2IWF A;  3W15 A;  2P9I C;  4O9D A;  2G99 A;  2HU8 A;  1GOG A;  5IGQ A;  2AGW A;  3UKR C;  2IUV A;  5HE3 B;  4DNV A;  2I0T A; 
#chains in the Genus database with same CATH homology
 3KRX B;  4A0B B;  4A11 B;  3NVX A;  5CXB B;  5THA A;  4JSN C;  4FAV D;  4QT8 A;  3UKU C;  3PE7 A;  3J81 g;  3DWL C;  3EI4 B;  2YNP A;  2CN2 A;  4J77 A;  2HKR A;  3IIW A;  1YFQ A;  3I7O A;  3RMZ D;  4YVD A;  3BWS A;  3MZK A;  5GXH A;  3JZN A;  4A08 B;  4E5Z B;  3CFV A;  4HDJ A;  1SQJ A;  2IWK A;  3C5M A;  4Y7R A;  2J55 H;  1ERJ A;  3EWE A;  4FHL A;  2O9K A;  1A0R B;  4A0B A;  3AH8 B;  5CXB A;  4Z8L A;  3V9F A;  1PI6 A;  4GGC A;  5EM2 A;  1RI6 A;  3L4M D;  3JRO A;  2Z2O A;  4FWW A;  2OIZ A;  4IA9 A;  2P9P C;  4GGA A;  2H9L A;  5EMJ B;  4CY1 A;  4ZN4 A;  4A08 A;  3MKQ A;  4CY3 A;  4A0A A;  3AFC A;  4LG8 A;  1VYH C;  3OKY A;  4E54 B;  4GZ8 A;  4D0K A;  3PSL A;  3I8C A;  1JOF A;  3OKW A;  1JJU B;  1SHY B;  3F3F A;  3JZG A;  4KFM B;  1L0Q A;  3UVM A;  3PVU B;  4ZOV A;  2HES X;  4ES0 A;  2IUQ A;  4OWR A;  3GRE A;  5SXM A;  4J73 A;  1NEX B;  4A09 B;  2H14 A;  4J8B A;  4PBY A;  2OJY A;  2Q7Q A;  3AL8 A;  2P9S C;  4ZOX A;  1N6E A;  3OL2 B;  2GC4 A;  2H47 A;  4PXW A;  5CXC B;  3I2N A;  2YMU A;  4J81 A;  2QXV A;  2IUP A;  2CN3 A;  1QNI A;  3EI3 B;  4PC0 A;  4CY5 A;  1FWX A;  3V7D B;  5HYN B;  3K26 A;  2H9P A;  3MXX A;  3P4F A;  2J57 G;  4X63 B;  1JMZ B;  2AGL A;  4CI8 A;  3PXT D;  4X60 B;  5KDO B;  3IJ0 A;  3PXS D;  5FA5 B;  3I7L A;  4U7A A;  1Q47 A;  3F3P A;  5EAP A;  3ZWL B;  2EBS A;  1P22 A;  2YNO A;  5GMK n;  5FLX g;  5AMS A;  2H6K A;  3OKT A;  3SN6 B;  2I3S A;  4JSV C;  5A2Q g;  1U2V C;  4A2L A;  2PBI B;  3CFS B;  3A0F A;  3KRW B;  1JMX B;  2YNN A;  3EI3 A;  3C99 A;  4L1Q D;  2H6Q A;  4TZ4 A;  4GQ1 A;  1PBY B;  4BL0 A;  1NR0 A;  4JXM A;  2HJB A;  2I3T A;  5EAM A;  5IT9 g;  2UZY B;  3I7K A;  5H17 A;  4H5I A;  4CI1 A;  2CO0 C;  3MMY A;  5GXI A;  3UVO A;  3RN0 D;  4O3U B;  3EG6 A;  4FAN D;  2B5M A;  3JPX A;  1MG2 A;  2PM9 B;  4Y5R D;  3SBR A;  4AEZ A;  4ZOZ A;  5GSA A;  4CI2 A;  2I0R A;  5TF2 A;  3ODT A;  2P9U C;  4PBZ A;  3UVN A;  3IJ1 A;  4NSX A;  4L3G D;  3E0C A;  3V5W B;  4A11 A;  4GM9 A;  4BUJ C;  3OW8 A;  1XHM A;  2B4E A;  4GM8 A;  4U1E I;  1OLZ A;  2H13 A;  2YBA A;  3MKS B;  2PM6 B;  3EI4 A;  4N14 A;  4A2M A;  2HJ4 A;  2Z2N A;  3UVK A;  2PM9 A;  3DSM A;  4GQ2 P;  5TEE A;  3JAM g;  4XYH A;  4J0W A;  3RFG A;  3GFC A;  4E5Z A;  4FB1 D;  4JSX C;  4O45 A;  4J78 A;  3F3G A;  2AGX A;  2GNQ A;  3FGB A;  1OMW B;  4J86 A;  4ESG A;  1N6F A;  4QQE A;  3FRX A;  3ORV D;  4XYI A;  4QRJ A;  2P9K C;  5FXY A;  2OK4 A;  4GQB B;  3SWS D;  3SLE D;  3EMH A;  3UVL A;  3SHF A;  3RRM C;  3DXM C;  4J84 A;  5FKT A;  5FKR A;  3SMR A;  1MG3 A;  1SQ9 A;  3I7N A;  3PXW D;  2CO0 A;  2B5N A;  2MTA H;  4J8G A;  2HYE A;  3JB9 L;  2OVR B;  5FKS A;  4GGD A;  4E54 A;  3HFQ A;  2IUR A;  5TEF A;  4JT6 C;  3K27 A;  4JD2 C;  4GMB A;  3I7P A;  4XEI C;  4MK0 B;  3C9C A;  5C9Z B;  3CIK B;  3NVQ A;  2XL3 A;  1K8K C;  2H9M A;  3DM0 A;  1MDA H;  3SBQ A;  4A09 A;  2XU7 A;  5IC7 A;  4J87 A;  2AGZ A;  3RFH A;  4FA9 D;  3RN1 D;  5HE0 B;  1XKS A;  3OL2 A;  2AGY A;  5K19 A;  5I5J A;  2P9N C;  5CXC A;  2BBK H;  1PEV A;  4I79 A;  2HKM A;  4O3T B;  5K1C C;  3SJL D;  5IJ8 E;  2GC7 A;  3RLM D;  4J0X A;  2CE8 A;  4CC9 A;  4CZY A;  2AQ5 A;  1GOT B;  5EAR A;  5EMK B;  3I89 A;  2OVQ B;  4K3J B;  4O1Q D;  3JZH A;  5HE1 B;  4CI3 A;  2J56 H;  4CZV A;  3B7F A;  3AL9 A;  3EI1 B;  2W18 A;  1N6D A;  3OTT A;  3SXT D;  4ERY A;  4QL1 A;  3IKO A;  4PSX B;  3UR4 A;  2B5L A;  4H5J A;  5EML B;  4ERQ A;  3C75 H;  5EM2 B;  3EI2 B;  4X3E A;  3FM0 A;  3SFZ A;  1TBG A;  5JWZ A;  3DXK C;  3IIY A;  2BCJ B;  4FA1 D;  4J82 A;  2P9L C;  4ERZ A;  2QC5 A;  3I7H A;  3EI1 A;  1GG2 B;  4ZOY A;  5FKQ A;  5CYK B;  2PM7 B;  3MZL A;  4A0A B;  3OKY B;  5TDH B;  5B4W A;  5EAL A;  1GXR A;  5HQG A;  3SCY A;  4FA5 D;  4JSP C;  4L9O A;  5AFU 3;  4EWR A;  3EI2 A;  1B9X A;  3ULE C;  4A7J A;  3N0D A;  4AOW A;  3SBP A;  5IGO A;  3J80 g;  5HE2 B;  4CZX A;  1S4U X;  5H1M A;  3AL8 B;  3IJC A;  4PNK B;  3PVW B;  3U4Y A;  5EMM B;  5CYK A;  4L3H D;  5H14 A;  3SVW D;  3BG0 A;  2AH0 A;  4JT5 C;  3I8E A;  1U4C A;  1B9Y A;  5I5I A;  3VH0 A;  1PGU A;  4LGN A;  5AJA A;  2OK6 A;  4J79 A;  1GP2 B;  2HXC A;  2CNX A;  2XYI A;  4G56 B;  2CE9 A;  2AH1 A;  2XL2 A;  5C2V B;  2YB8 B;  4IMM A;  1R5M A;  3RSE C;  2TRC B;  3VA6 A;  4LG9 A;  4UI9 R;  1K32 A;  3EU7 A;  2G9A A;  1TYQ C;  4CY2 A;  4BH6 A;  3NVN A;  4OZU A;  5FQD A;  2H68 A;  1XIP A;  4FA4 D;  4D6V A;  5IJ7 E;  5C2W B;  4PSW B;  2Z2P A;  3JRP A;  2IAA A;  4K3I D;  3BG1 A;  4X61 B;  4GM3 A;  2H9N A;  3VGZ A;  2I0S A;  4R7A B;  5I5M A;  3N0E A;  3PSC B;  2OVP B;  2H3X A;  3L4O D;  2H6N A;  2UZX B;  2IWF A;  3W15 A;  2P9I C;  4O9D A;  2G99 A;  5IGQ A;  2AGW A;  3UKR C;  2IUV A;  5HE3 B;  2I0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...