5KDOB

Heterotrimeric complex of the 4 alanine insertion variant of the gi alpha1 subunit and the gbeta1-ggamma1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
339
structure length
335
Chain Sequence
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein G(i) subunit alpha-1
publication title A Conserved Hydrophobic Core in G alpha i1 Regulates G Protein Activation and Release from Activated Receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 110
structure length 335
sequence length 339
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5kdoB00
4FA4D 2P9SC 2BCJB 2CE8A 4GGDA 4NSXA 5FA5B 2IAAA 2AH1A 3NVQA 5TF2A 5AMSA 1VYHC 3GFCA 4J0WA 3SN6B 1SHYB 2PM9A 4CC9A 4O9DA 3EI3B 2AGLA 2YNOA 4L3GD 2P9LC 5HE3B 3IKOA 3KRWB 4ZN4A 4CY2A 4O45A 3VGZA 1PEVA 2B5MA 3J80g 4A0AA 5EM2B 4D0KA 4CZYA 2AQ5A 2HESX 3PVUB 3I7PA 5FKSA 3V9FA 2IUQA 3I89A 3RN1D 2H6QA 3GREA 1L0QA 3IJ0A 3NVNA 4A08A 3DSMA 2HJ4A 1XHMA 3PSLA 3EI4B 2H47A 3W15A 3I7NA 2IURA 2AGXA 2AGYA 5TEFA 3JROA 2PM7B 5AFU3 4CZXA 3UVKA 4A2LA 5TEEA 3ODTA 4A0BB 4A11B 3SWSD 4D6VA 5A2Qg 5H14A 3K27A 1N6EA 3CIKB 2H6KA 4MK0B 3RMZD 5IJ7E 4PNKB 1JJUB 4A09B 4JT6C 4QQEA 4OZUA 3L4OD 2H68A 3JZGA 5FLXg 2GC4A 1OMWB 3FGBA 3JB9L 5C2WB 3SBPA 3V7DB 1SQJA 5FKTA 3OW8A 5B4WA 4O3TB 4L3HD 4XYIA 5K1CC 3I2NA 4AOWA 4H5IA 4LG9A 4R7AB 4FB1D 5HE0B 5CYKB 5GSAA 3OTTA 4J81A 4FAVD 5FXYA 4HDJA 2QXVA 4J87A 4ERYA 4CI8A 2AGWA 4CI1A 3EI1A 4CI3A 4ZOYA 2P9UC 3MZKA 1FWXA 1TBGA 4AEZA 3J81g 5IJ8E 4PSWB 5IGQA 3SBRA 2GNQA 5AJAA 2YB8B 5KDOB 3K26A 4ERQA 3N0EA 4XYHA 3AL8A 3RRMC 1ERJA 4XEIC 2J57G 5CXBB 1N6DA 3IJCA 4L1QD 4J82A 4U7AA 4GQ1A 4K3ID 4A2MA 2OK4A 2AGZA 4Y5RD 4J77A 3JAMg 3SVWD 4N14A 4A0AB 2G9AA 2PM6B 2H14A 3PE7A 4BL0A 4EWRA 5FKQA 2O9KA 3RFGA 3F3PA 3SXTD 3RSEC 2CN3A 5EMJB 1YFQA 2HKRA 5THAA 4CY5A 5EMKB 5C9ZB 5GMKn 3AL9A 2IWKA 3ORVD 4A08B 5IGOA 3CFVA 3PXWD 2XU7A 2P9PC 2I0RA 4OWRA 1B9XA 5H17A 3UVNA 1GXRA 3DWLC 4FA9D 2Q7QA 4GM3A 4X3EA 4LG8A 2AH0A 4GM9A 2GC7A 3C75H 4Z8LA 4E5ZA 4J79A 2HYEA 3F3FA 3A0FA 3DM0A 5CXCB 1U4CA 3AFCA 3SHFA 4BH6A 1XKSA 4FWWA 3C99A 4CY3A 3MKSB 2Z2PA 3DXMC 2J56H 3B7FA 4X60B 2I3SA 1TYQC 2OK6A 3RN0D 3BG1A 4GGAA 4E54A 3CFSB 5HYNB 3EG6A 4ES0A 2IUVA 4FHLA 4PXWA 3UKRC 3I7HA 3C9CA 3AH8B 4J78A 2PBIB 1XIPA 5EALA 1NR0A 5EAPA 2YNPA 3MZLA 3EI2A 4QT8A 3BG0A 2HXCA 2OVRB 2W18A 4JSPC 1PI6A 4GQBB 1P22A 3PXSD 1RI6A 4X61B 2CO0A 4U1EI 4ZOXA 2G99A 2H6NA 3JZHA 2IUPA 5JWZA 4JT5C 1GG2B 1OLZA 2UZYB 3EI1B 2CE9A 4KFMB 4A09A 4L9OA 2HJBA 3UVMA 1A0RB 4IA9A 2P9IC 4FA1D 3PXTD 3JRPA 2QC5A 4H5JA 3OKYA 1R5MA 2I0SA 3AL8B 3PSCB 3SMRA 1K32A 4CZVA 4QL1A 4GGCA 4BUJC 5IC7A 3SFZA 1PGUA 4ZOZA 3NVXA 3OKWA 2TRCB 4JXMA 2PM9B 1SQ9A 2OVQB 3OL2A 3SJLD 3FRXA 3IJ1A 2CO0C 3F3GA 3ZWLB 4J86A 3IIYA 2H13A 4JSVC 2H3XA 1U2VC 4J73A 3VA6A 5SXMA 4JSNC 2OJYA 4J8BA 4TZ4A 3I8CA 4GQ2P 5CXBA 3VH0A 4PBZA 5I5IA 5GXHA 4E5ZB 4J8GA 3E0CA 2Z2OA 4PC0A 2MTAH 3RLMD 2B4EA 1MDAH 2I3TA 5HQGA 4J0XA 2HKMA 4GMBA 3EWEA 1PBYB 5C2VB 2Z2NA 5IT9g 3I8EA 2H9LA 3EI3A 3KRXB 2B5LA 2EBSA 4JSXC 4ERZA 4FAND 4ZOVA 3MXXA 1Q47A 2J55H 4JD2C 1JMZB 5EM2A 5EMMB 3FM0A 3JZNA 1S4UX 2UZXB 4E54B 1K8KC 5EAMA 4A7JA 3L4MD 2YNNA 5I5JA 2OVPB 3MKQA 3EU7A 3I7OA 1GOTB 4UI9R 5HE1B 3EI2B 3RFHA 4K3JB 5HE2B 2CNXA 2OIZA 3DXKC 3EI4A 3I7KA 1B9YA 1N6FA 2YBAA 2XL2A 4PSXB 2P9NC 3ULEC 4LGNA 1JOFA 5CXCA 4G56B 4PBYA 4O1QD 1MG2A 4YVDA 3UR4A 2P9KC 1MG3A 4A0BA 4A11A 5TDHB 2IWFA 2H9NA 1JMXB 4CI2A 3IIWA 4GZ8A 3MMYA 4Y7RA 5GXIA 3EMHA 3OKYB 2XL3A 2B5NA 2BBKH 3UVLA 3UKUC 4GM8A 5FKRA 3P4FA 3PVWB 3SCYA 3U4YA 2YMUA 3SLED 3V5WB 3N0DA 3UVOA 4I79A 2CN2A 3JPXA 1QNIA 4FA5D 4X63B 5H1MA 3I7LA 3OL2B 5EARA 2XYIA 4QRJA 5FQDA 3HFQA 2H9MA 4ESGA 4O3UB 5K19A 4IMMA 3OKTA 2H9PA 5CYKA 3SBQA 5EMLB 1NEXB 4J84A 3BWSA 5I5MA 3C5MA 4CY1A 1GP2B 2I0TA
chains in the Genus database with same CATH superfamily
3KCIA 1O6GA 4FA4D 2P9SC 2BCJB 2WQ8A 4D9SA 3IUJA 4WK0A 2CE8A 1VE6A 4NC4A 4GGDA 4NSXA 1GOHA 5FA5B 2IAAA 2AH1A 3NVQA 1H2YA 5TF2A 5AMSA 1VYHC 3GFCA 4J0WA 1YR2A 5FFGA 3SN6B 3QI0A 3QHYB 1SHYB 2PM9A 4CC9A 4O9DA 3EI3B 1H2ZA 4RE6A 2AGLA 2YNOA 4QAMA 4L3GD 2P9LC 2VDRA 5HE3B 4BCCA 3IKOA 3KRWB 4ZN4A 4CY2A 4O45A 3VGZA 1PEVA 2B5MA 3J80g 4AN0A 4A0AA 5EM2B 4D0KA 4CZYA 5M5RA 2AQ5A 2HESX 3PVUB 3I7PA 5FKSA 2EIEA 3V9FA 1QFSA 2IUQA 3I89A 5E6RA 3RN1D 2H6QA 2QZPA 3GREA 1L5GA 1L0QA 3IJ0A 3NVNA 4A08A 3DSMA 2HJ4A 1XHMA 3PSLA 3EI4B 2H47A 3W15A 3I7NA 2IURA 2AGXA 2AGYA 5TEFA 3JROA 5M61A 2PM7B 5AFU3 4CZXA 3UVKA 4A2LA 1U8CA 3T3MA 5TEEA 3ODTA 4A0BB 4A11B 4G1MA 3SWSD 4D6VA 5A2Qg 3MUOA 5H14A 5E6SA 3K27A 4AN1A 1N6EA 3CIKB 2H6KA 4MK0B 2XE4A 3RMZD 5IJ7E 4PNKB 1JJUB 3IJEA 4A09B 4RE5A 3ZDXA 4JT6C 2VDMA 4QQEA 4OZUA 1UOQA 1E8MA 1T2XA 3L4OD 2H68A 3K72A 3JZGA 5FLXg 1TYEA 2GC4A 1OMWB 3FGBA 3JB9L 3V4PA 5C2WB 3SBPA 3V7DB 1SQJA 5FKTA 4WK2A 3OW8A 5B4WA 4O3TB 4L3HD 4XYIA 5K1CC 3VI4A 2BKLA 3I2NA 4AOWA 4H5IA 2VC2A 4LG9A 4R7AB 5C92A 4G1EA 4FB1D 5HE0B 1O6FA 5CYKB 5GSAA 3OTTA 4J81A 4FAVD 5FXYA 1E5TA 4HDJA 3ZE1A 2QXVA 4UM8A 4J87A 4ERYA 4CI8A 2AGWA 4CI1A 3EI1A 4CI3A 4UM9A 4ZOYA 2P9UC 3MZKA 1FWXA 1TBGA 4AEZA 3J81g 2EIDA 4Z7QA 5IJ8E 4PSWB 5IGQA 3SBRA 2GNQA 5AJAA 2YB8B 5KDOB 3K26A 1BPOA 4ERQA 3N0EA 4XYHA 3AL8A 3RRMC 1ERJA 3MUNA 4JHPC 4MMYA 4XEIC 2J57G 3O4GA 5CXBB 1N6DA 3IJCA 4L1QD 4J82A 1C9IA 4GQ1A 4U7AA 4MMXA 4K3ID 4A2MA 4BP8A 2JKXA 2OK4A 2AGZA 4Y5RD 2EICA 3FCUA 4J77A 3JAMg 3SVWD 2EIBA 4N14A 1E8NA 4A0AB 3K71A 2G9AA 2PM6B 2H14A 3PE7A 4BL0A 4EWRA 5FKQA 4L1MA 2O9KA 3RFGA 3F3PA 3SXTD 1VZ2A 3RSEC 2CN3A 5EMJB 1YFQA 3ZDYA 2HKRA 5THAA 1H2XA 3VI3A 1M1XA 4CY5A 5EMKB 5C9ZB 5GMKn 3ZDZA 3AL9A 2IWKA 3ORVD 4A08B 5IGOA 3CFVA 3PXWD 2XU7A 2P9PC 5M5UA 2I0RA 4OWRA 1B9XA 5H17A 3UVNA 1GXRA 5M5TA 3DWLC 4FA9D 2Q7QA 2VDPA 4GM3A 4LG8A 4X3EA 2AH0A 1UOPA 2GC7A 3C75H 4GM9A 4Z8LA 4E5ZA 4J79A 2HYEA 3F3FA 3A0FA 2VDNA 2VDLA 3DM0A 5CXCB 1U4CA 3AFCA 3SHFA 4BH6A 1XKSA 4FWWA 3C99A 1VZ3A 4CY3A 3MKSB 4DNUA 2Z2PA 3O4HA 4WK4A 3DXMC 1GOGA 2J56H 4AMYA 3B7FA 4X60B 2I3SA 1TYQC 2OK6A 3T3PA 3RN0D 3BG1A 1JTDB 4GGAA 4E54A 3CFSB 5HYNB 3EG6A 4ES0A 2IUVA 5M5SA 4FHLA 2VDKA 3IURA 4PXWA 3UKRC 3I7HA 3C9CA 3NIDA 3AH8B 3GD1I 4J78A 2PBIB 1XIPA 5EALA 1NR0A 5EAPA 2YNPA 3MZLA 3EI2A 4QT8A 3BG0A 2HXCA 2OVRB 4DNWA 2W18A 5M5VA 4JSPC 1PI6A 3DDUA 4GQBB 1P22A 3PXSD 1RI6A 4X61B 2CO0A 4U1EI 2HU8A 4ZOXA 2G99A 2H6NA 3JZHA 2IUPA 4Z7OA 3V4VA 5JWZA 1UTCA 2HU5A 4JT5C 1GG2B 1OLZA 2UZYB 3EI1B 2CE9A 4KFMB 4A09A 4L9OA 2HJBA 2VZ3A 2VZ1A 3UVMA 1A0RB 4IA9A 2P9IC 4FA1D 3PXTD 3JRPA 2QC5A 3EQ7A 4H5JA 3OKYA 3EQ8A 1R5MA 2I0SA 3AL8B 3PSCB 3SMRA 1K3IA 1K32A 4CZVA 4QL1A 3NIFA 4GGCA 4AMZA 4BUJC 5IC7A 3K6SA 3SFZA 1PGUA 3MVDK 4NAAA 4WJKA 4ZOZA 3NVXA 3OKWA 2TRCB 4JXMA 2PM9B 1SQ9A 4IRZA 2OVQB 4BCDA 3OL2A 5FFOA 3IVMA 3SJLD 2VDOA 1A12A 3FRXA 3IJ1A 2CO0C 3F3GA 3ZWLB 4J86A 3IIYA 2H13A 4JSVC 2H3XA 1U2VC 4NBMA 3IUNA 3O4IA 4J73A 2QR5A 1VE7A 3VA6A 5SXMA 4JSNC 2OJYA 4J8BA 4TZ4A 4BCBA 4JHNA 3I8CA 4GQ2P 3IULA 5CXBA 3VH0A 4PBZA 3EQ9A 5I5IA 4E5ZB 5GXHA 4J8GA 3E0CA 5C86A 3IUQA 2Z2OA 4PC0A 2MTAH 3RLMD 2B4EA 1MDAH 2I3TA 5HQGA 4J0XA 1JV2A 2HKMA 3ZE2A 4GMBA 3EWEA 3NIGA 1PBYB 5C2VB 2Z2NA 5IT9g 3I8EA 2H9LA 3EI3A 4AX4A 3KRXB 2B5LA 2EBSA 4JSXC 4ERZA 4O02A 4FAND 4ZOVA 3MXXA 1Q47A 2J55H 4JD2C 5HDBA 1JMZB 5EM2A 5EMMB 3FM0A 3JZNA 1S4UX 3IUMA 1C9LA 2UZXB 3FCSA 4E54B 4NENA 1K8KC 5EAMA 4A7JA 3L4MD 2YNNA 5I5JA 2OVPB 3MKQA 3EU7A 3I7OA 1GOTB 4UI9R 5HE1B 3EI2B 3RFHA 4K3JB 5HE2B 2CNXA 2OIZA 3DXKC 3EI4A 3I7KA 1B9YA 2XZGA 1GOFA 1N6FA 2YBAA 2HU7A 2XL2A 4PSXB 2P9NC 3ULEC 4LGNA 1JOFA 5CXCA 4G56B 4PBYA 4Z7NA 1QFMA 4O1QD 1MG2A 4DNVA 4BP9A 1I2MB 4YVDA 3UR4A 2P9KC 1MG3A 4A0BA 4A11A 5TDHB 2IWFA 2H9NA 1JMXB 4CI2A 3IIWA 4GZ8A 3MMYA 2XDWA 4Y7RA 5GXIA 3EMHA 3OKYB 2XL3A 2VDQA 5E6UA 2B5NA 2BBKH 3UVLA 3UKUC 4GM8A 5FKRA 3P4FA 3GC3B 3PVWB 3SCYA 3U4YA 2YMUA 3SLED 3V5WB 3ZE0A 3N0DA 3UVOA 4I79A 2CN2A 3JPXA 3O4JA 1QNIA 4FA5D 4X63B 5H1MA 3I7LA 3OL2B 5EARA 2XYIA 4QRJA 5FQDA 3HFQA 1H2WA 2H9MA 4ESGA 4O2WA 4MMZA 4O3UB 5K19A 4IMMA 3OKTA 2H9PA 5CYKA 3SBQA 5EMLB 4G55A 1NEXB 4J84A 3BWSA 5I5MA 3C5MA 4CY1A 1UOOA 3OF7A 1GP2B 2I0TA
chains in the Genus database with same CATH topology
4FA4D 2P9SC 2BCJB 2CE8A 4GGDA 4NSXA 5FA5B 2IAAA 2AH1A 3NVQA 5TF2A 5AMSA 1VYHC 3GFCA 4J0WA 3SN6B 1SHYB 2PM9A 4CC9A 4O9DA 3EI3B 2AGLA 2YNOA 4L3GD 2P9LC 5HE3B 3IKOA 3KRWB 4ZN4A 4CY2A 4O45A 3VGZA 1PEVA 2B5MA 3J80g 4A0AA 5EM2B 4D0KA 4CZYA 2AQ5A 2HESX 3PVUB 3I7PA 5FKSA 3V9FA 2IUQA 3I89A 3RN1D 2H6QA 3GREA 1L0QA 3IJ0A 3NVNA 4A08A 3DSMA 2HJ4A 1XHMA 3PSLA 3EI4B 2H47A 3W15A 3I7NA 2IURA 2AGXA 2AGYA 5TEFA 3JROA 2PM7B 5AFU3 4CZXA 3UVKA 4A2LA 5TEEA 3ODTA 4A0BB 4A11B 3SWSD 4D6VA 5A2Qg 5H14A 3K27A 1N6EA 3CIKB 2H6KA 4MK0B 3RMZD 5IJ7E 4PNKB 1JJUB 4A09B 4JT6C 4QQEA 4OZUA 3L4OD 2H68A 3JZGA 5FLXg 2GC4A 1OMWB 3FGBA 3JB9L 5C2WB 3SBPA 3V7DB 1SQJA 5FKTA 3OW8A 5B4WA 4O3TB 4L3HD 4XYIA 5K1CC 3I2NA 4AOWA 4H5IA 4LG9A 4R7AB 4FB1D 5HE0B 5CYKB 5GSAA 3OTTA 4J81A 4FAVD 5FXYA 4HDJA 2QXVA 4J87A 4ERYA 4CI8A 2AGWA 4CI1A 3EI1A 4CI3A 4ZOYA 2P9UC 3MZKA 1FWXA 1TBGA 4AEZA 3J81g 5IJ8E 4PSWB 5IGQA 3SBRA 2GNQA 5AJAA 2YB8B 5KDOB 3K26A 4ERQA 3N0EA 4XYHA 3AL8A 3RRMC 1ERJA 4XEIC 2J57G 5CXBB 1N6DA 3IJCA 4L1QD 4J82A 4U7AA 4GQ1A 4K3ID 4A2MA 2OK4A 2AGZA 4Y5RD 4J77A 3JAMg 3SVWD 4N14A 4A0AB 2G9AA 2PM6B 2H14A 3PE7A 4BL0A 4EWRA 5FKQA 2O9KA 3RFGA 3F3PA 3SXTD 3RSEC 2CN3A 5EMJB 1YFQA 2HKRA 5THAA 4CY5A 5EMKB 5C9ZB 5GMKn 3AL9A 2IWKA 3ORVD 4A08B 5IGOA 3CFVA 3PXWD 2XU7A 2P9PC 2I0RA 4OWRA 1B9XA 5H17A 3UVNA 1GXRA 3DWLC 4FA9D 2Q7QA 4GM3A 4X3EA 4LG8A 2AH0A 4GM9A 2GC7A 3C75H 4Z8LA 4E5ZA 4J79A 2HYEA 3F3FA 3A0FA 3DM0A 5CXCB 1U4CA 3AFCA 3SHFA 4BH6A 1XKSA 4FWWA 3C99A 4CY3A 3MKSB 2Z2PA 3DXMC 2J56H 3B7FA 4X60B 2I3SA 1TYQC 2OK6A 3RN0D 3BG1A 4GGAA 4E54A 3CFSB 5HYNB 3EG6A 4ES0A 2IUVA 4FHLA 4PXWA 3UKRC 3I7HA 3C9CA 3AH8B 4J78A 2PBIB 1XIPA 5EALA 1NR0A 5EAPA 2YNPA 3MZLA 3EI2A 4QT8A 3BG0A 2HXCA 2OVRB 2W18A 4JSPC 1PI6A 4GQBB 1P22A 3PXSD 1RI6A 4X61B 2CO0A 4U1EI 4ZOXA 2G99A 2H6NA 3JZHA 2IUPA 5JWZA 4JT5C 1GG2B 1OLZA 2UZYB 3EI1B 2CE9A 4KFMB 4A09A 4L9OA 2HJBA 3UVMA 1A0RB 4IA9A 2P9IC 4FA1D 3PXTD 3JRPA 2QC5A 4H5JA 3OKYA 1R5MA 2I0SA 3AL8B 3PSCB 3SMRA 1K32A 4CZVA 4QL1A 4GGCA 4BUJC 5IC7A 3SFZA 1PGUA 4ZOZA 3NVXA 3OKWA 2TRCB 4JXMA 2PM9B 1SQ9A 2OVQB 3OL2A 3SJLD 3FRXA 3IJ1A 2CO0C 3F3GA 3ZWLB 4J86A 3IIYA 2H13A 4JSVC 2H3XA 1U2VC 4J73A 3VA6A 5SXMA 4JSNC 2OJYA 4J8BA 4TZ4A 3I8CA 4GQ2P 5CXBA 3VH0A 4PBZA 5I5IA 5GXHA 4E5ZB 4J8GA 3E0CA 2Z2OA 4PC0A 2MTAH 3RLMD 2B4EA 1MDAH 2I3TA 5HQGA 4J0XA 2HKMA 4GMBA 3EWEA 1PBYB 5C2VB 2Z2NA 5IT9g 3I8EA 2H9LA 3EI3A 3KRXB 2B5LA 2EBSA 4JSXC 4ERZA 4FAND 4ZOVA 3MXXA 1Q47A 2J55H 4JD2C 1JMZB 5EM2A 5EMMB 3FM0A 3JZNA 1S4UX 2UZXB 4E54B 1K8KC 5EAMA 4A7JA 3L4MD 2YNNA 5I5JA 2OVPB 3MKQA 3EU7A 3I7OA 1GOTB 4UI9R 5HE1B 3EI2B 3RFHA 4K3JB 5HE2B 2CNXA 2OIZA 3DXKC 3EI4A 3I7KA 1B9YA 1N6FA 2YBAA 2XL2A 4PSXB 2P9NC 3ULEC 4LGNA 1JOFA 5CXCA 4G56B 4PBYA 4O1QD 1MG2A 4YVDA 3UR4A 2P9KC 1MG3A 4A0BA 4A11A 5TDHB 2IWFA 2H9NA 1JMXB 4CI2A 3IIWA 4GZ8A 3MMYA 4Y7RA 5GXIA 3EMHA 3OKYB 2XL3A 2B5NA 2BBKH 3UVLA 3UKUC 4GM8A 5FKRA 3P4FA 3PVWB 3SCYA 3U4YA 2YMUA 3SLED 3V5WB 3N0DA 3UVOA 4I79A 2CN2A 3JPXA 1QNIA 4FA5D 4X63B 5H1MA 3I7LA 3OL2B 5EARA 2XYIA 4QRJA 5FQDA 3HFQA 2H9MA 4ESGA 4O3UB 5K19A 4IMMA 3OKTA 2H9PA 5CYKA 3SBQA 5EMLB 1NEXB 4J84A 3BWSA 5I5MA 3C5MA 4CY1A 1GP2B 2I0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  2P9S C;  2BCJ B;  2CE8 A;  4GGD A;  4NSX A;  5FA5 B;  2IAA A;  2AH1 A;  3NVQ A;  5TF2 A;  5AMS A;  1VYH C;  3GFC A;  4J0W A;  3SN6 B;  1SHY B;  2PM9 A;  4CC9 A;  4O9D A;  3EI3 B;  2AGL A;  2YNO A;  4L3G D;  2P9L C;  5HE3 B;  3IKO A;  3KRW B;  4ZN4 A;  4CY2 A;  4O45 A;  3VGZ A;  1PEV A;  2B5M A;  3J80 g;  4A0A A;  5EM2 B;  4D0K A;  4CZY A;  2AQ5 A;  2HES X;  3PVU B;  3I7P A;  5FKS A;  3V9F A;  2IUQ A;  3I89 A;  3RN1 D;  2H6Q A;  3GRE A;  1L0Q A;  3IJ0 A;  3NVN A;  4A08 A;  3DSM A;  2HJ4 A;  1XHM A;  3PSL A;  3EI4 B;  2H47 A;  3W15 A;  3I7N A;  2IUR A;  2AGX A;  2AGY A;  5TEF A;  3JRO A;  2PM7 B;  5AFU 3;  4CZX A;  3UVK A;  4A2L A;  5TEE A;  3ODT A;  4A0B B;  4A11 B;  3SWS D;  4D6V A;  5A2Q g;  5H14 A;  3K27 A;  1N6E A;  3CIK B;  2H6K A;  4MK0 B;  3RMZ D;  5IJ7 E;  4PNK B;  1JJU B;  4A09 B;  4JT6 C;  4QQE A;  4OZU A;  3L4O D;  2H68 A;  3JZG A;  5FLX g;  2GC4 A;  1OMW B;  3FGB A;  3JB9 L;  5C2W B;  3SBP A;  3V7D B;  1SQJ A;  5FKT A;  3OW8 A;  5B4W A;  4O3T B;  4L3H D;  4XYI A;  5K1C C;  3I2N A;  4AOW A;  4H5I A;  4LG9 A;  4R7A B;  4FB1 D;  5HE0 B;  5CYK B;  5GSA A;  3OTT A;  4J81 A;  4FAV D;  5FXY A;  4HDJ A;  2QXV A;  4J87 A;  4ERY A;  4CI8 A;  2AGW A;  4CI1 A;  3EI1 A;  4CI3 A;  4ZOY A;  2P9U C;  3MZK A;  1FWX A;  1TBG A;  4AEZ A;  3J81 g;  5IJ8 E;  4PSW B;  5IGQ A;  3SBR A;  2GNQ A;  5AJA A;  2YB8 B;  5KDO B;  3K26 A;  4ERQ A;  3N0E A;  4XYH A;  3AL8 A;  3RRM C;  1ERJ A;  4XEI C;  2J57 G;  5CXB B;  1N6D A;  3IJC A;  4L1Q D;  4J82 A;  4U7A A;  4GQ1 A;  4K3I D;  4A2M A;  2OK4 A;  2AGZ A;  4Y5R D;  4J77 A;  3JAM g;  3SVW D;  4N14 A;  4A0A B;  2G9A A;  2PM6 B;  2H14 A;  3PE7 A;  4BL0 A;  4EWR A;  5FKQ A;  2O9K A;  3RFG A;  3F3P A;  3SXT D;  3RSE C;  2CN3 A;  5EMJ B;  1YFQ A;  2HKR A;  5THA A;  4CY5 A;  5EMK B;  5C9Z B;  5GMK n;  3AL9 A;  2IWK A;  3ORV D;  4A08 B;  5IGO A;  3CFV A;  3PXW D;  2XU7 A;  2P9P C;  2I0R A;  4OWR A;  1B9X A;  5H17 A;  3UVN A;  1GXR A;  3DWL C;  4FA9 D;  2Q7Q A;  4GM3 A;  4X3E A;  4LG8 A;  2AH0 A;  4GM9 A;  2GC7 A;  3C75 H;  4Z8L A;  4E5Z A;  4J79 A;  2HYE A;  3F3F A;  3A0F A;  3DM0 A;  5CXC B;  1U4C A;  3AFC A;  3SHF A;  4BH6 A;  1XKS A;  4FWW A;  3C99 A;  4CY3 A;  3MKS B;  2Z2P A;  3DXM C;  2J56 H;  3B7F A;  4X60 B;  2I3S A;  1TYQ C;  2OK6 A;  3RN0 D;  3BG1 A;  4GGA A;  4E54 A;  3CFS B;  5HYN B;  3EG6 A;  4ES0 A;  2IUV A;  4FHL A;  4PXW A;  3UKR C;  3I7H A;  3C9C A;  3AH8 B;  4J78 A;  2PBI B;  1XIP A;  5EAL A;  1NR0 A;  5EAP A;  2YNP A;  3MZL A;  3EI2 A;  4QT8 A;  3BG0 A;  2HXC A;  2OVR B;  2W18 A;  4JSP C;  1PI6 A;  4GQB B;  1P22 A;  3PXS D;  1RI6 A;  4X61 B;  2CO0 A;  4U1E I;  4ZOX A;  2G99 A;  2H6N A;  3JZH A;  2IUP A;  5JWZ A;  4JT5 C;  1GG2 B;  1OLZ A;  2UZY B;  3EI1 B;  2CE9 A;  4KFM B;  4A09 A;  4L9O A;  2HJB A;  3UVM A;  1A0R B;  4IA9 A;  2P9I C;  4FA1 D;  3PXT D;  3JRP A;  2QC5 A;  4H5J A;  3OKY A;  1R5M A;  2I0S A;  3AL8 B;  3PSC B;  3SMR A;  1K32 A;  4CZV A;  4QL1 A;  4GGC A;  4BUJ C;  5IC7 A;  3SFZ A;  1PGU A;  4ZOZ A;  3NVX A;  3OKW A;  2TRC B;  4JXM A;  2PM9 B;  1SQ9 A;  2OVQ B;  3OL2 A;  3SJL D;  3FRX A;  3IJ1 A;  2CO0 C;  3F3G A;  3ZWL B;  4J86 A;  3IIY A;  2H13 A;  4JSV C;  2H3X A;  1U2V C;  4J73 A;  3VA6 A;  5SXM A;  4JSN C;  2OJY A;  4J8B A;  4TZ4 A;  3I8C A;  4GQ2 P;  5CXB A;  3VH0 A;  4PBZ A;  5I5I A;  5GXH A;  4E5Z B;  4J8G A;  3E0C A;  2Z2O A;  4PC0 A;  2MTA H;  3RLM D;  2B4E A;  1MDA H;  2I3T A;  5HQG A;  4J0X A;  2HKM A;  4GMB A;  3EWE A;  1PBY B;  5C2V B;  2Z2N A;  5IT9 g;  3I8E A;  2H9L A;  3EI3 A;  3KRX B;  2B5L A;  2EBS A;  4JSX C;  4ERZ A;  4FAN D;  4ZOV A;  3MXX A;  1Q47 A;  2J55 H;  4JD2 C;  1JMZ B;  5EM2 A;  5EMM B;  3FM0 A;  3JZN A;  1S4U X;  2UZX B;  4E54 B;  1K8K C;  5EAM A;  4A7J A;  3L4M D;  2YNN A;  5I5J A;  2OVP B;  3MKQ A;  3EU7 A;  3I7O A;  1GOT B;  4UI9 R;  5HE1 B;  3EI2 B;  3RFH A;  4K3J B;  5HE2 B;  2CNX A;  2OIZ A;  3DXK C;  3EI4 A;  3I7K A;  1B9Y A;  1N6F A;  2YBA A;  2XL2 A;  4PSX B;  2P9N C;  3ULE C;  4LGN A;  1JOF A;  5CXC A;  4G56 B;  4PBY A;  4O1Q D;  1MG2 A;  4YVD A;  3UR4 A;  2P9K C;  1MG3 A;  4A0B A;  4A11 A;  5TDH B;  2IWF A;  2H9N A;  1JMX B;  4CI2 A;  3IIW A;  4GZ8 A;  3MMY A;  4Y7R A;  5GXI A;  3EMH A;  3OKY B;  2XL3 A;  2B5N A;  2BBK H;  3UVL A;  3UKU C;  4GM8 A;  5FKR A;  3P4F A;  3PVW B;  3SCY A;  3U4Y A;  2YMU A;  3SLE D;  3V5W B;  3N0D A;  3UVO A;  4I79 A;  2CN2 A;  3JPX A;  1QNI A;  4FA5 D;  4X63 B;  5H1M A;  3I7L A;  3OL2 B;  5EAR A;  2XYI A;  4QRJ A;  5FQD A;  3HFQ A;  2H9M A;  4ESG A;  4O3U B;  5K19 A;  4IMM A;  3OKT A;  2H9P A;  5CYK A;  3SBQ A;  5EML B;  1NEX B;  4J84 A;  3BWS A;  5I5M A;  3C5M A;  4CY1 A;  1GP2 B;  2I0T A; 
#chains in the Genus database with same CATH topology
 3KCI A;  1O6G A;  4FA4 D;  2P9S C;  2BCJ B;  2WQ8 A;  4D9S A;  3IUJ A;  4WK0 A;  2CE8 A;  1VE6 A;  4NC4 A;  4GGD A;  4NSX A;  1GOH A;  5FA5 B;  2IAA A;  2AH1 A;  3NVQ A;  1H2Y A;  5TF2 A;  5AMS A;  1VYH C;  3GFC A;  4J0W A;  1YR2 A;  5FFG A;  3SN6 B;  3QI0 A;  3QHY B;  1SHY B;  2PM9 A;  4CC9 A;  4O9D A;  3EI3 B;  1H2Z A;  4RE6 A;  2AGL A;  2YNO A;  4QAM A;  4L3G D;  2P9L C;  2VDR A;  5HE3 B;  4BCC A;  3IKO A;  3KRW B;  4ZN4 A;  4CY2 A;  4O45 A;  3VGZ A;  1PEV A;  2B5M A;  3J80 g;  4AN0 A;  4A0A A;  5EM2 B;  4D0K A;  4CZY A;  5M5R A;  2AQ5 A;  2HES X;  3PVU B;  3I7P A;  5FKS A;  2EIE A;  3V9F A;  1QFS A;  2IUQ A;  3I89 A;  5E6R A;  3RN1 D;  2H6Q A;  2QZP A;  3GRE A;  1L5G A;  1L0Q A;  3IJ0 A;  3NVN A;  4A08 A;  3DSM A;  2HJ4 A;  1XHM A;  3PSL A;  3EI4 B;  2H47 A;  3W15 A;  3I7N A;  2IUR A;  2AGX A;  2AGY A;  5TEF A;  3JRO A;  5M61 A;  2PM7 B;  5AFU 3;  4CZX A;  3UVK A;  4A2L A;  1U8C A;  3T3M A;  5TEE A;  3ODT A;  4A0B B;  4A11 B;  4G1M A;  3SWS D;  4D6V A;  5A2Q g;  3MUO A;  5H14 A;  5E6S A;  3K27 A;  4AN1 A;  1N6E A;  3CIK B;  2H6K A;  4MK0 B;  2XE4 A;  3RMZ D;  5IJ7 E;  4PNK B;  1JJU B;  3IJE A;  4A09 B;  4RE5 A;  3ZDX A;  4JT6 C;  2VDM A;  4QQE A;  4OZU A;  1UOQ A;  1E8M A;  1T2X A;  3L4O D;  2H68 A;  3K72 A;  3JZG A;  5FLX g;  1TYE A;  2GC4 A;  1OMW B;  3FGB A;  3JB9 L;  3V4P A;  5C2W B;  3SBP A;  3V7D B;  1SQJ A;  5FKT A;  4WK2 A;  3OW8 A;  5B4W A;  4O3T B;  4L3H D;  4XYI A;  5K1C C;  3VI4 A;  2BKL A;  3I2N A;  4AOW A;  4H5I A;  2VC2 A;  4LG9 A;  4R7A B;  5C92 A;  4G1E A;  4FB1 D;  5HE0 B;  1O6F A;  5CYK B;  5GSA A;  3OTT A;  4J81 A;  4FAV D;  5FXY A;  1E5T A;  4HDJ A;  3ZE1 A;  2QXV A;  4UM8 A;  4J87 A;  4ERY A;  4CI8 A;  2AGW A;  4CI1 A;  3EI1 A;  4CI3 A;  4UM9 A;  4ZOY A;  2P9U C;  3MZK A;  1FWX A;  1TBG A;  4AEZ A;  3J81 g;  2EID A;  4Z7Q A;  5IJ8 E;  4PSW B;  5IGQ A;  3SBR A;  2GNQ A;  5AJA A;  2YB8 B;  5KDO B;  3K26 A;  1BPO A;  4ERQ A;  3N0E A;  4XYH A;  3AL8 A;  3RRM C;  1ERJ A;  3MUN A;  4JHP C;  4MMY A;  4XEI C;  2J57 G;  3O4G A;  5CXB B;  1N6D A;  3IJC A;  4L1Q D;  4J82 A;  1C9I A;  4GQ1 A;  4U7A A;  4MMX A;  4K3I D;  4A2M A;  4BP8 A;  2JKX A;  2OK4 A;  2AGZ A;  4Y5R D;  2EIC A;  3FCU A;  4J77 A;  3JAM g;  3SVW D;  2EIB A;  4N14 A;  1E8N A;  4A0A B;  3K71 A;  2G9A A;  2PM6 B;  2H14 A;  3PE7 A;  4BL0 A;  4EWR A;  5FKQ A;  4L1M A;  2O9K A;  3RFG A;  3F3P A;  3SXT D;  1VZ2 A;  3RSE C;  2CN3 A;  5EMJ B;  1YFQ A;  3ZDY A;  2HKR A;  5THA A;  1H2X A;  3VI3 A;  1M1X A;  4CY5 A;  5EMK B;  5C9Z B;  5GMK n;  3ZDZ A;  3AL9 A;  2IWK A;  3ORV D;  4A08 B;  5IGO A;  3CFV A;  3PXW D;  2XU7 A;  2P9P C;  5M5U A;  2I0R A;  4OWR A;  1B9X A;  5H17 A;  3UVN A;  1GXR A;  5M5T A;  3DWL C;  4FA9 D;  2Q7Q A;  2VDP A;  4GM3 A;  4LG8 A;  4X3E A;  2AH0 A;  1UOP A;  2GC7 A;  3C75 H;  4GM9 A;  4Z8L A;  4E5Z A;  4J79 A;  2HYE A;  3F3F A;  3A0F A;  2VDN A;  2VDL A;  3DM0 A;  5CXC B;  1U4C A;  3AFC A;  3SHF A;  4BH6 A;  1XKS A;  4FWW A;  3C99 A;  1VZ3 A;  4CY3 A;  3MKS B;  4DNU A;  2Z2P A;  3O4H A;  4WK4 A;  3DXM C;  1GOG A;  2J56 H;  4AMY A;  3B7F A;  4X60 B;  2I3S A;  1TYQ C;  2OK6 A;  3T3P A;  3RN0 D;  3BG1 A;  1JTD B;  4GGA A;  4E54 A;  3CFS B;  5HYN B;  3EG6 A;  4ES0 A;  2IUV A;  5M5S A;  4FHL A;  2VDK A;  3IUR A;  4PXW A;  3UKR C;  3I7H A;  3C9C A;  3NID A;  3AH8 B;  3GD1 I;  4J78 A;  2PBI B;  1XIP A;  5EAL A;  1NR0 A;  5EAP A;  2YNP A;  3MZL A;  3EI2 A;  4QT8 A;  3BG0 A;  2HXC A;  2OVR B;  4DNW A;  2W18 A;  5M5V A;  4JSP C;  1PI6 A;  3DDU A;  4GQB B;  1P22 A;  3PXS D;  1RI6 A;  4X61 B;  2CO0 A;  4U1E I;  2HU8 A;  4ZOX A;  2G99 A;  2H6N A;  3JZH A;  2IUP A;  4Z7O A;  3V4V A;  5JWZ A;  1UTC A;  2HU5 A;  4JT5 C;  1GG2 B;  1OLZ A;  2UZY B;  3EI1 B;  2CE9 A;  4KFM B;  4A09 A;  4L9O A;  2HJB A;  2VZ3 A;  2VZ1 A;  3UVM A;  1A0R B;  4IA9 A;  2P9I C;  4FA1 D;  3PXT D;  3JRP A;  2QC5 A;  3EQ7 A;  4H5J A;  3OKY A;  3EQ8 A;  1R5M A;  2I0S A;  3AL8 B;  3PSC B;  3SMR A;  1K3I A;  1K32 A;  4CZV A;  4QL1 A;  3NIF A;  4GGC A;  4AMZ A;  4BUJ C;  5IC7 A;  3K6S A;  3SFZ A;  1PGU A;  3MVD K;  4NAA A;  4WJK A;  4ZOZ A;  3NVX A;  3OKW A;  2TRC B;  4JXM A;  2PM9 B;  1SQ9 A;  4IRZ A;  2OVQ B;  4BCD A;  3OL2 A;  5FFO A;  3IVM A;  3SJL D;  2VDO A;  1A12 A;  3FRX A;  3IJ1 A;  2CO0 C;  3F3G A;  3ZWL B;  4J86 A;  3IIY A;  2H13 A;  4JSV C;  2H3X A;  1U2V C;  4NBM A;  3IUN A;  3O4I A;  4J73 A;  2QR5 A;  1VE7 A;  3VA6 A;  5SXM A;  4JSN C;  2OJY A;  4J8B A;  4TZ4 A;  4BCB A;  4JHN A;  3I8C A;  4GQ2 P;  3IUL A;  5CXB A;  3VH0 A;  4PBZ A;  3EQ9 A;  5I5I A;  4E5Z B;  5GXH A;  4J8G A;  3E0C A;  5C86 A;  3IUQ A;  2Z2O A;  4PC0 A;  2MTA H;  3RLM D;  2B4E A;  1MDA H;  2I3T A;  5HQG A;  4J0X A;  1JV2 A;  2HKM A;  3ZE2 A;  4GMB A;  3EWE A;  3NIG A;  1PBY B;  5C2V B;  2Z2N A;  5IT9 g;  3I8E A;  2H9L A;  3EI3 A;  4AX4 A;  3KRX B;  2B5L A;  2EBS A;  4JSX C;  4ERZ A;  4O02 A;  4FAN D;  4ZOV A;  3MXX A;  1Q47 A;  2J55 H;  4JD2 C;  5HDB A;  1JMZ B;  5EM2 A;  5EMM B;  3FM0 A;  3JZN A;  1S4U X;  3IUM A;  1C9L A;  2UZX B;  3FCS A;  4E54 B;  4NEN A;  1K8K C;  5EAM A;  4A7J A;  3L4M D;  2YNN A;  5I5J A;  2OVP B;  3MKQ A;  3EU7 A;  3I7O A;  1GOT B;  4UI9 R;  5HE1 B;  3EI2 B;  3RFH A;  4K3J B;  5HE2 B;  2CNX A;  2OIZ A;  3DXK C;  3EI4 A;  3I7K A;  1B9Y A;  2XZG A;  1GOF A;  1N6F A;  2YBA A;  2HU7 A;  2XL2 A;  4PSX B;  2P9N C;  3ULE C;  4LGN A;  1JOF A;  5CXC A;  4G56 B;  4PBY A;  4Z7N A;  1QFM A;  4O1Q D;  1MG2 A;  4DNV A;  4BP9 A;  1I2M B;  4YVD A;  3UR4 A;  2P9K C;  1MG3 A;  4A0B A;  4A11 A;  5TDH B;  2IWF A;  2H9N A;  1JMX B;  4CI2 A;  3IIW A;  4GZ8 A;  3MMY A;  2XDW A;  4Y7R A;  5GXI A;  3EMH A;  3OKY B;  2XL3 A;  2VDQ A;  5E6U A;  2B5N A;  2BBK H;  3UVL A;  3UKU C;  4GM8 A;  5FKR A;  3P4F A;  3GC3 B;  3PVW B;  3SCY A;  3U4Y A;  2YMU A;  3SLE D;  3V5W B;  3ZE0 A;  3N0D A;  3UVO A;  4I79 A;  2CN2 A;  3JPX A;  3O4J A;  1QNI A;  4FA5 D;  4X63 B;  5H1M A;  3I7L A;  3OL2 B;  5EAR A;  2XYI A;  4QRJ A;  5FQD A;  3HFQ A;  1H2W A;  2H9M A;  4ESG A;  4O2W A;  4MMZ A;  4O3U B;  5K19 A;  4IMM A;  3OKT A;  2H9P A;  5CYK A;  3SBQ A;  5EML B;  4G55 A;  1NEX B;  4J84 A;  3BWS A;  5I5M A;  3C5M A;  4CY1 A;  1UOO A;  3OF7 A;  1GP2 B;  2I0T A; 
#chains in the Genus database with same CATH homology
 4FA4 D;  2P9S C;  2BCJ B;  2CE8 A;  4GGD A;  4NSX A;  5FA5 B;  2IAA A;  2AH1 A;  3NVQ A;  5TF2 A;  5AMS A;  1VYH C;  3GFC A;  4J0W A;  3SN6 B;  1SHY B;  2PM9 A;  4CC9 A;  4O9D A;  3EI3 B;  2AGL A;  2YNO A;  4L3G D;  2P9L C;  5HE3 B;  3IKO A;  3KRW B;  4ZN4 A;  4CY2 A;  4O45 A;  3VGZ A;  1PEV A;  2B5M A;  3J80 g;  4A0A A;  5EM2 B;  4D0K A;  4CZY A;  2AQ5 A;  2HES X;  3PVU B;  3I7P A;  5FKS A;  3V9F A;  2IUQ A;  3I89 A;  3RN1 D;  2H6Q A;  3GRE A;  1L0Q A;  3IJ0 A;  3NVN A;  4A08 A;  3DSM A;  2HJ4 A;  1XHM A;  3PSL A;  3EI4 B;  2H47 A;  3W15 A;  3I7N A;  2IUR A;  2AGX A;  2AGY A;  5TEF A;  3JRO A;  2PM7 B;  5AFU 3;  4CZX A;  3UVK A;  4A2L A;  5TEE A;  3ODT A;  4A0B B;  4A11 B;  3SWS D;  4D6V A;  5A2Q g;  5H14 A;  3K27 A;  1N6E A;  3CIK B;  2H6K A;  4MK0 B;  3RMZ D;  5IJ7 E;  4PNK B;  1JJU B;  4A09 B;  4JT6 C;  4QQE A;  4OZU A;  3L4O D;  2H68 A;  3JZG A;  5FLX g;  2GC4 A;  1OMW B;  3FGB A;  3JB9 L;  5C2W B;  3SBP A;  3V7D B;  1SQJ A;  5FKT A;  3OW8 A;  5B4W A;  4O3T B;  4L3H D;  4XYI A;  5K1C C;  3I2N A;  4AOW A;  4H5I A;  4LG9 A;  4R7A B;  4FB1 D;  5HE0 B;  5CYK B;  5GSA A;  3OTT A;  4J81 A;  4FAV D;  5FXY A;  4HDJ A;  2QXV A;  4J87 A;  4ERY A;  4CI8 A;  2AGW A;  4CI1 A;  3EI1 A;  4CI3 A;  4ZOY A;  2P9U C;  3MZK A;  1FWX A;  1TBG A;  4AEZ A;  3J81 g;  5IJ8 E;  4PSW B;  5IGQ A;  3SBR A;  2GNQ A;  5AJA A;  2YB8 B;  5KDO B;  3K26 A;  4ERQ A;  3N0E A;  4XYH A;  3AL8 A;  3RRM C;  1ERJ A;  4XEI C;  2J57 G;  5CXB B;  1N6D A;  3IJC A;  4L1Q D;  4J82 A;  4U7A A;  4GQ1 A;  4K3I D;  4A2M A;  2OK4 A;  2AGZ A;  4Y5R D;  4J77 A;  3JAM g;  3SVW D;  4N14 A;  4A0A B;  2G9A A;  2PM6 B;  2H14 A;  3PE7 A;  4BL0 A;  4EWR A;  5FKQ A;  2O9K A;  3RFG A;  3F3P A;  3SXT D;  3RSE C;  2CN3 A;  5EMJ B;  1YFQ A;  2HKR A;  5THA A;  4CY5 A;  5EMK B;  5C9Z B;  5GMK n;  3AL9 A;  2IWK A;  3ORV D;  4A08 B;  5IGO A;  3CFV A;  3PXW D;  2XU7 A;  2P9P C;  2I0R A;  4OWR A;  1B9X A;  5H17 A;  3UVN A;  1GXR A;  3DWL C;  4FA9 D;  2Q7Q A;  4GM3 A;  4X3E A;  4LG8 A;  2AH0 A;  4GM9 A;  2GC7 A;  3C75 H;  4Z8L A;  4E5Z A;  4J79 A;  2HYE A;  3F3F A;  3A0F A;  3DM0 A;  5CXC B;  1U4C A;  3AFC A;  3SHF A;  4BH6 A;  1XKS A;  4FWW A;  3C99 A;  4CY3 A;  3MKS B;  2Z2P A;  3DXM C;  2J56 H;  3B7F A;  4X60 B;  2I3S A;  1TYQ C;  2OK6 A;  3RN0 D;  3BG1 A;  4GGA A;  4E54 A;  3CFS B;  5HYN B;  3EG6 A;  4ES0 A;  2IUV A;  4FHL A;  4PXW A;  3UKR C;  3I7H A;  3C9C A;  3AH8 B;  4J78 A;  2PBI B;  1XIP A;  5EAL A;  1NR0 A;  5EAP A;  2YNP A;  3MZL A;  3EI2 A;  4QT8 A;  3BG0 A;  2HXC A;  2OVR B;  2W18 A;  4JSP C;  1PI6 A;  4GQB B;  1P22 A;  3PXS D;  1RI6 A;  4X61 B;  2CO0 A;  4U1E I;  4ZOX A;  2G99 A;  2H6N A;  3JZH A;  2IUP A;  5JWZ A;  4JT5 C;  1GG2 B;  1OLZ A;  2UZY B;  3EI1 B;  2CE9 A;  4KFM B;  4A09 A;  4L9O A;  2HJB A;  3UVM A;  1A0R B;  4IA9 A;  2P9I C;  4FA1 D;  3PXT D;  3JRP A;  2QC5 A;  4H5J A;  3OKY A;  1R5M A;  2I0S A;  3AL8 B;  3PSC B;  3SMR A;  1K32 A;  4CZV A;  4QL1 A;  4GGC A;  4BUJ C;  5IC7 A;  3SFZ A;  1PGU A;  4ZOZ A;  3NVX A;  3OKW A;  2TRC B;  4JXM A;  2PM9 B;  1SQ9 A;  2OVQ B;  3OL2 A;  3SJL D;  3FRX A;  3IJ1 A;  2CO0 C;  3F3G A;  3ZWL B;  4J86 A;  3IIY A;  2H13 A;  4JSV C;  2H3X A;  1U2V C;  4J73 A;  3VA6 A;  5SXM A;  4JSN C;  2OJY A;  4J8B A;  4TZ4 A;  3I8C A;  4GQ2 P;  5CXB A;  3VH0 A;  4PBZ A;  5I5I A;  5GXH A;  4E5Z B;  4J8G A;  3E0C A;  2Z2O A;  4PC0 A;  2MTA H;  3RLM D;  2B4E A;  1MDA H;  2I3T A;  5HQG A;  4J0X A;  2HKM A;  4GMB A;  3EWE A;  1PBY B;  5C2V B;  2Z2N A;  5IT9 g;  3I8E A;  2H9L A;  3EI3 A;  3KRX B;  2B5L A;  2EBS A;  4JSX C;  4ERZ A;  4FAN D;  4ZOV A;  3MXX A;  1Q47 A;  2J55 H;  4JD2 C;  1JMZ B;  5EM2 A;  5EMM B;  3FM0 A;  3JZN A;  1S4U X;  2UZX B;  4E54 B;  1K8K C;  5EAM A;  4A7J A;  3L4M D;  2YNN A;  5I5J A;  2OVP B;  3MKQ A;  3EU7 A;  3I7O A;  1GOT B;  4UI9 R;  5HE1 B;  3EI2 B;  3RFH A;  4K3J B;  5HE2 B;  2CNX A;  2OIZ A;  3DXK C;  3EI4 A;  3I7K A;  1B9Y A;  1N6F A;  2YBA A;  2XL2 A;  4PSX B;  2P9N C;  3ULE C;  4LGN A;  1JOF A;  5CXC A;  4G56 B;  4PBY A;  4O1Q D;  1MG2 A;  4YVD A;  3UR4 A;  2P9K C;  1MG3 A;  4A0B A;  4A11 A;  5TDH B;  2IWF A;  2H9N A;  1JMX B;  4CI2 A;  3IIW A;  4GZ8 A;  3MMY A;  4Y7R A;  5GXI A;  3EMH A;  3OKY B;  2XL3 A;  2B5N A;  2BBK H;  3UVL A;  3UKU C;  4GM8 A;  5FKR A;  3P4F A;  3PVW B;  3SCY A;  3U4Y A;  2YMU A;  3SLE D;  3V5W B;  3N0D A;  3UVO A;  4I79 A;  2CN2 A;  3JPX A;  1QNI A;  4FA5 D;  4X63 B;  5H1M A;  3I7L A;  3OL2 B;  5EAR A;  2XYI A;  4QRJ A;  5FQD A;  3HFQ A;  2H9M A;  4ESG A;  4O3U B;  5K19 A;  4IMM A;  3OKT A;  2H9P A;  5CYK A;  3SBQ A;  5EML B;  1NEX B;  4J84 A;  3BWS A;  5I5M A;  3C5M A;  4CY1 A;  1GP2 B;  2I0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...