5M5SA

Clathrin heavy chain n-terminal domain bound to amphiphysin clathrin-box motif
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 87
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5sA00
3GC3B 5M5RA 5M5SA 5M5VA 2XZGA 1C9IA 5M5UA 1UTCA 5M61A 4G55A 1BPOA 1C9LA 3GD1I 5M5TA
chains in the Genus database with same CATH superfamily
4GM3A 1SQJA 3N0EA 2AGWA 4Z8LA 2G99A 1GOGA 3IIWA 4WK0A 4AN0A 2BKLA 4PSWB 3BWSA 5AMSA 4ERQA 2VDKA 1MG2A 2EIBA 3C5MA 4Y7RA 1VE6A 2IWFA 1A0RB 1O6FA 4JSVC 4CI3A 2AGLA 2OVRB 5EMMB 2IUVA 4A09B 4CZXA 2CN2A 3OKWA 4A09A 2AQ5A 4A2LA 5E6RA 1TBGA 1L0QA 2VDOA 4FWWA 3F3PA 3O4IA 3DSMA 4BUJC 1PEVA 2HXCA 3OW8A 4XYHA 5GMKn 4Z7QA 3ULEC 5FKRA 4J79A 1B9YA 1XKSA 3RMZD 5TF2A 2QC5A 3EU7A 1YR2A 3IUJA 4FAVD 4JHPC 1NEXB 3F3GA 3VA6A 3P4FA 2XL3A 4PBZA 3RN1D 4A7JA 2YB8B 4Y5RD 1OMWB 3OF7A 5TDHB 2J57G 3IVMA 2IUPA 3W15A 2BBKH 2P9IC 2B5NA 3EQ8A 5IGQA 4LG8A 3EI2A 2GNQA 3AH8B 4ESGA 3FRXA 5EM2B 3CFVA 3C99A 4J87A 3V4VA 5EARA 5GSAA 1A12A 1N6FA 5IJ8E 1QNIA 2Z2PA 4DNUA 2EBSA 3PSLA 3SBQA 4FA1D 1T2XA 2PM7B 1N6EA 4IA9A 3UVKA 1C9IA 5E6UA 4WK4A 2P9UC 2PM9B 1JV2A 2VDPA 4BCCA 5HE1B 2XYIA 3IURA 4O45A 2CN3A 2UZXB 3UVLA 4X61B 5EMKB 3NVXA 4U1EI 4D0KA 4BP8A 2YNNA 4AOWA 3L4OD 4BP9A 4WJKA 3K26A 5KDOB 4L9OA 4A2MA 2JKXA 4GMBA 4GM9A 4J73A 4AMZA 2HYEA 1GP2B 2OK4A 1PI6A 3NVQA 2HESX 3EI4A 3QI0A 5IC7A 3OTTA 5HDBA 4O9DA 3MUOA 3IUNA 4QT8A 2VDQA 4E54B 2VZ1A 4CY5A 4O2WA 3K72A 3SJLD 3AL8B 4PXWA 5FKSA 2IUQA 2VZ3A 2YMUA 4G55A 2UZYB 3EG6A 4MMYA 2I0RA 4A11A 3GC3B 4L1QD 3K27A 3B7FA 3ZE2A 4A0AB 5C2WB 4G1EA 1UOOA 2EIEA 3GD1I 3IJEA 5HE0B 5K1CC 3JZNA 3I7HA 1VZ3A 2CE8A 4JXMA 4NC4A 5CYKB 3ZDXA 3SBRA 2VDLA 3MKQA 5FKQA 4UM9A 3V5WB 4PSXB 3I7KA 2HU5A 3OL2B 3K71A 5FLXg 4H5JA 3ZDZA 1VZ2A 2QZPA 4G56B 5FQDA 4U7AA 2AGXA 5IT9g 2EIDA 4ZOZA 2J55H 2BCJB 3I7NA 1NR0A 3KRWB 3OKTA 4D6VA 5M5TA 4GQ1A 4GQ2P 3N0DA 3KRXB 1JJUB 3V7DB 4Z7OA 2O9KA 2HJBA 3SFZA 4L3HD 1JTDB 4Z7NA 3IUQA 3MZLA 3DM0A 2HKMA 1YFQA 2WQ8A 4JSPC 5E6SA 5GXHA 5C9ZB 1Q47A 5I5JA 1K32A 3IULA 2H13A 2VDMA 3EI1B 3KCIA 4J84A 3EI1A 3AFCA 5CXCB 5IJ7E 2IAAA 2AGZA 2P9LC 1JMZB 4PBYA 4FHLA 1R5MA 4MMZA 5THAA 4BCBA 3O4HA 1RI6A 4RE5A 2VDRA 3A0FA 3O4JA 3ZDYA 2I3SA 3CFSB 3DXKC 3SHFA 2H9MA 3MZKA 1SHYB 1TYQC 4ZN4A 3MVDK 1PGUA 3RSEC 3NIGA 1C9LA 3MKSB 3IJ1A 4X60B 1H2ZA 4QRJA 3EMHA 2QXVA 2PBIB 5M5RA 2HU8A 2H47A 5FA5B 3RLMD 3JRPA 4JT6C 3RFHA 2B5LA 5EM2A 3IUMA 3PXSD 5CXBB 4D9SA 2OVPB 5EALA 4JD2C 5JWZA 4J8BA 2PM9A 3E0CA 4KFMB 4MMXA 1U8CA 4GZ8A 4J0WA 5FXYA 2AH1A 2AH0A 3MMYA 1VYHC 4CY3A 4I79A 3ZE0A 3ZWLB 5B4WA 3SXTD 3ODTA 3UVNA 3JZHA 5K19A 3J80g 1QFSA 4GM8A 4J8GA 4FA5D 2CO0A 3EQ9A 4DNVA 3IIYA 2H6KA 4LG9A 4CZVA 2H9LA 4CZYA 2P9NC 4AMYA 5C92A 3FCUA 4J0XA 3T3MA 2IURA 2VC2A 2H9PA 2XE4A 5H17A 1JMXB 4L1MA 4E54A 4HDJA 4J77A 5AJAA 3QHYB 3IJCA 4H5IA 3OKYB 2H14A 3AL8A 3RRMC 3VI3A 5A2Qg 4GQBB 4X63B 4JSXC 3V4PA 1ERJA 2IWKA 4A0AA 5HE2B 5FKTA 4OWRA 3IKOA 5GXIA 3DWLC 2H9NA 4BCDA 1BPOA 3C9CA 3DXMC 4A08B 1MDAH 5CYKA 3EI3B 3I7LA 2G9AA 1L5GA 2PM6B 4MK0B 3OL2A 4TZ4A 3IJ0A 3VGZA 3MUNA 2YBAA 4GGAA 3RFGA 4ZOVA 3V9FA 3FGBA 4CI8A 3JB9L 4GGDA 4IMMA 4GGCA 1VE7A 3AL9A 1I2MB 3I8CA 3T3PA 1OLZA 3SN6B 4JHNA 3NIFA 3PE7A 4J78A 4QL1A 3SMRA 3NVNA 2YNOA 5SXMA 1E8MA 5M5UA 4ZOXA 4K3JB 5I5MA 2OIZA 2I0TA 3FM0A 4QAMA 2OJYA 4UM8A 4E5ZB 3UVMA 5EAPA 5H1MA 2I3TA 3UKUC 1UOPA 2B5MA 4YVDA 2GC7A 5FFOA 1K3IA 2Z2NA 2MTAH 1S4UX 2EICA 1QFMA 4NBMA 1PBYB 4A0BB 5CXCA 1M1XA 4CI2A 4OZUA 3FCSA 3NIDA 4A0BA 4AX4A 2P9PC 5HE3B 4CY1A 1UTCA 3SLED 3BG1A 4NSXA 1K8KC 2H3XA 3ORVD 2VDNA 3UKRC 3UR4A 3I8EA 1GOHA 1GG2B 4XYIA 4O3UB 2QR5A 5M61A 4O3TB 1E8NA 2AGYA 2YNPA 4ERZA 2P9SC 4IRZA 3L4MD 3MXXA 3VH0A 5EAMA 2XDWA 5M5VA 1GOTB 3PVUB 1UOQA 4AEZA 5I5IA 3PSCB 2GC4A 2J56H 3PXWD 4FA4D 5CXBA 1XIPA 3SWSD 4AN1A 4CY2A 3C75H 3I89A 4PNKB 2Z2OA 3EI2B 3PVWB 2H6QA 4O1QD 3ZE1A 2XZGA 4O02A 2CE9A 4LGNA 4XEIC 2Q7QA 4FA9D 3DDUA 2I0SA 1B9XA 1FWXA 4RE6A 1N6DA 2OVQB 4J81A 5M5SA 4JSNC 4DNWA 4FB1D 2CNXA 5IGOA 4G1MA 1MG3A 4K3ID 1GOFA 3SBPA 4QQEA 3EWEA 3O4GA 1SQ9A 5HQGA 4J86A 3I7PA 4NENA 5C86A 4CC9A 3I7OA 1XHMA 4ERYA 3VI4A 3EI4B 3OKYA 1JOFA 4R7AB 5EMLB 5TEFA 1GXRA 3UVOA 3SVWD 1E5TA 5FFGA 4UI9R 2W18A 2H6NA 3J81g 2XU7A 4N14A 2CO0C 4A08A 3F3FA 1U2VC 4ZOYA 4JT5C 3HFQA 1P22A 4A11B 3EI3A 1U4CA 1H2XA 5AFU3 1H2YA 3JPXA 4J82A 4BH6A 3CIKB 3EQ7A 4CI1A 3GFCA 3RN0D 3U4YA 3PXTD 5HYNB 4FAND 2P9KC 3K6SA 1TYEA 4ES0A 2TRCB 5C2VB 1O6GA 3SCYA 2B4EA 3GREA 3JAMg 2HJ4A 3BG0A 5H14A 4WK2A 4BL0A 4L3GD 4NAAA 4X3EA 5TEEA 4EWRA 3JZGA 5EMJB 4PC0A 2HU7A 3I2NA 3JROA 2OK6A 1H2WA 2H68A 2XL2A 2HKRA 4E5ZA
chains in the Genus database with same CATH topology
3GC3B 5M5RA 5M5SA 5M5VA 2XZGA 1C9IA 5M5UA 1UTCA 5M61A 4G55A 1BPOA 1C9LA 3GD1I 5M5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GC3 B;  5M5R A;  5M5S A;  5M5V A;  2XZG A;  1C9I A;  5M5U A;  1UTC A;  5M61 A;  4G55 A;  1BPO A;  1C9L A;  3GD1 I;  5M5T A; 
#chains in the Genus database with same CATH topology
 4GM3 A;  1SQJ A;  3N0E A;  2AGW A;  4Z8L A;  2G99 A;  1GOG A;  3IIW A;  4WK0 A;  4AN0 A;  2BKL A;  4PSW B;  3BWS A;  5AMS A;  4ERQ A;  2VDK A;  1MG2 A;  2EIB A;  3C5M A;  4Y7R A;  1VE6 A;  2IWF A;  1A0R B;  1O6F A;  4JSV C;  4CI3 A;  2AGL A;  2OVR B;  5EMM B;  2IUV A;  4A09 B;  4CZX A;  2CN2 A;  3OKW A;  4A09 A;  2AQ5 A;  4A2L A;  5E6R A;  1TBG A;  1L0Q A;  2VDO A;  4FWW A;  3F3P A;  3O4I A;  3DSM A;  4BUJ C;  1PEV A;  2HXC A;  3OW8 A;  4XYH A;  5GMK n;  4Z7Q A;  3ULE C;  5FKR A;  4J79 A;  1B9Y A;  1XKS A;  3RMZ D;  5TF2 A;  2QC5 A;  3EU7 A;  1YR2 A;  3IUJ A;  4FAV D;  4JHP C;  1NEX B;  3F3G A;  3VA6 A;  3P4F A;  2XL3 A;  4PBZ A;  3RN1 D;  4A7J A;  2YB8 B;  4Y5R D;  1OMW B;  3OF7 A;  5TDH B;  2J57 G;  3IVM A;  2IUP A;  3W15 A;  2BBK H;  2P9I C;  2B5N A;  3EQ8 A;  5IGQ A;  4LG8 A;  3EI2 A;  2GNQ A;  3AH8 B;  4ESG A;  3FRX A;  5EM2 B;  3CFV A;  3C99 A;  4J87 A;  3V4V A;  5EAR A;  5GSA A;  1A12 A;  1N6F A;  5IJ8 E;  1QNI A;  2Z2P A;  4DNU A;  2EBS A;  3PSL A;  3SBQ A;  4FA1 D;  1T2X A;  2PM7 B;  1N6E A;  4IA9 A;  3UVK A;  1C9I A;  5E6U A;  4WK4 A;  2P9U C;  2PM9 B;  1JV2 A;  2VDP A;  4BCC A;  5HE1 B;  2XYI A;  3IUR A;  4O45 A;  2CN3 A;  2UZX B;  3UVL A;  4X61 B;  5EMK B;  3NVX A;  4U1E I;  4D0K A;  4BP8 A;  2YNN A;  4AOW A;  3L4O D;  4BP9 A;  4WJK A;  3K26 A;  5KDO B;  4L9O A;  4A2M A;  2JKX A;  4GMB A;  4GM9 A;  4J73 A;  4AMZ A;  2HYE A;  1GP2 B;  2OK4 A;  1PI6 A;  3NVQ A;  2HES X;  3EI4 A;  3QI0 A;  5IC7 A;  3OTT A;  5HDB A;  4O9D A;  3MUO A;  3IUN A;  4QT8 A;  2VDQ A;  4E54 B;  2VZ1 A;  4CY5 A;  4O2W A;  3K72 A;  3SJL D;  3AL8 B;  4PXW A;  5FKS A;  2IUQ A;  2VZ3 A;  2YMU A;  4G55 A;  2UZY B;  3EG6 A;  4MMY A;  2I0R A;  4A11 A;  3GC3 B;  4L1Q D;  3K27 A;  3B7F A;  3ZE2 A;  4A0A B;  5C2W B;  4G1E A;  1UOO A;  2EIE A;  3GD1 I;  3IJE A;  5HE0 B;  5K1C C;  3JZN A;  3I7H A;  1VZ3 A;  2CE8 A;  4JXM A;  4NC4 A;  5CYK B;  3ZDX A;  3SBR A;  2VDL A;  3MKQ A;  5FKQ A;  4UM9 A;  3V5W B;  4PSX B;  3I7K A;  2HU5 A;  3OL2 B;  3K71 A;  5FLX g;  4H5J A;  3ZDZ A;  1VZ2 A;  2QZP A;  4G56 B;  5FQD A;  4U7A A;  2AGX A;  5IT9 g;  2EID A;  4ZOZ A;  2J55 H;  2BCJ B;  3I7N A;  1NR0 A;  3KRW B;  3OKT A;  4D6V A;  5M5T A;  4GQ1 A;  4GQ2 P;  3N0D A;  3KRX B;  1JJU B;  3V7D B;  4Z7O A;  2O9K A;  2HJB A;  3SFZ A;  4L3H D;  1JTD B;  4Z7N A;  3IUQ A;  3MZL A;  3DM0 A;  2HKM A;  1YFQ A;  2WQ8 A;  4JSP C;  5E6S A;  5GXH A;  5C9Z B;  1Q47 A;  5I5J A;  1K32 A;  3IUL A;  2H13 A;  2VDM A;  3EI1 B;  3KCI A;  4J84 A;  3EI1 A;  3AFC A;  5CXC B;  5IJ7 E;  2IAA A;  2AGZ A;  2P9L C;  1JMZ B;  4PBY A;  4FHL A;  1R5M A;  4MMZ A;  5THA A;  4BCB A;  3O4H A;  1RI6 A;  4RE5 A;  2VDR A;  3A0F A;  3O4J A;  3ZDY A;  2I3S A;  3CFS B;  3DXK C;  3SHF A;  2H9M A;  3MZK A;  1SHY B;  1TYQ C;  4ZN4 A;  3MVD K;  1PGU A;  3RSE C;  3NIG A;  1C9L A;  3MKS B;  3IJ1 A;  4X60 B;  1H2Z A;  4QRJ A;  3EMH A;  2QXV A;  2PBI B;  5M5R A;  2HU8 A;  2H47 A;  5FA5 B;  3RLM D;  3JRP A;  4JT6 C;  3RFH A;  2B5L A;  5EM2 A;  3IUM A;  3PXS D;  5CXB B;  4D9S A;  2OVP B;  5EAL A;  4JD2 C;  5JWZ A;  4J8B A;  2PM9 A;  3E0C A;  4KFM B;  4MMX A;  1U8C A;  4GZ8 A;  4J0W A;  5FXY A;  2AH1 A;  2AH0 A;  3MMY A;  1VYH C;  4CY3 A;  4I79 A;  3ZE0 A;  3ZWL B;  5B4W A;  3SXT D;  3ODT A;  3UVN A;  3JZH A;  5K19 A;  3J80 g;  1QFS A;  4GM8 A;  4J8G A;  4FA5 D;  2CO0 A;  3EQ9 A;  4DNV A;  3IIY A;  2H6K A;  4LG9 A;  4CZV A;  2H9L A;  4CZY A;  2P9N C;  4AMY A;  5C92 A;  3FCU A;  4J0X A;  3T3M A;  2IUR A;  2VC2 A;  2H9P A;  2XE4 A;  5H17 A;  1JMX B;  4L1M A;  4E54 A;  4HDJ A;  4J77 A;  5AJA A;  3QHY B;  3IJC A;  4H5I A;  3OKY B;  2H14 A;  3AL8 A;  3RRM C;  3VI3 A;  5A2Q g;  4GQB B;  4X63 B;  4JSX C;  3V4P A;  1ERJ A;  2IWK A;  4A0A A;  5HE2 B;  5FKT A;  4OWR A;  3IKO A;  5GXI A;  3DWL C;  2H9N A;  4BCD A;  1BPO A;  3C9C A;  3DXM C;  4A08 B;  1MDA H;  5CYK A;  3EI3 B;  3I7L A;  2G9A A;  1L5G A;  2PM6 B;  4MK0 B;  3OL2 A;  4TZ4 A;  3IJ0 A;  3VGZ A;  3MUN A;  2YBA A;  4GGA A;  3RFG A;  4ZOV A;  3V9F A;  3FGB A;  4CI8 A;  3JB9 L;  4GGD A;  4IMM A;  4GGC A;  1VE7 A;  3AL9 A;  1I2M B;  3I8C A;  3T3P A;  1OLZ A;  3SN6 B;  4JHN A;  3NIF A;  3PE7 A;  4J78 A;  4QL1 A;  3SMR A;  3NVN A;  2YNO A;  5SXM A;  1E8M A;  5M5U A;  4ZOX A;  4K3J B;  5I5M A;  2OIZ A;  2I0T A;  3FM0 A;  4QAM A;  2OJY A;  4UM8 A;  4E5Z B;  3UVM A;  5EAP A;  5H1M A;  2I3T A;  3UKU C;  1UOP A;  2B5M A;  4YVD A;  2GC7 A;  5FFO A;  1K3I A;  2Z2N A;  2MTA H;  1S4U X;  2EIC A;  1QFM A;  4NBM A;  1PBY B;  4A0B B;  5CXC A;  1M1X A;  4CI2 A;  4OZU A;  3FCS A;  3NID A;  4A0B A;  4AX4 A;  2P9P C;  5HE3 B;  4CY1 A;  1UTC A;  3SLE D;  3BG1 A;  4NSX A;  1K8K C;  2H3X A;  3ORV D;  2VDN A;  3UKR C;  3UR4 A;  3I8E A;  1GOH A;  1GG2 B;  4XYI A;  4O3U B;  2QR5 A;  5M61 A;  4O3T B;  1E8N A;  2AGY A;  2YNP A;  4ERZ A;  2P9S C;  4IRZ A;  3L4M D;  3MXX A;  3VH0 A;  5EAM A;  2XDW A;  5M5V A;  1GOT B;  3PVU B;  1UOQ A;  4AEZ A;  5I5I A;  3PSC B;  2GC4 A;  2J56 H;  3PXW D;  4FA4 D;  5CXB A;  1XIP A;  3SWS D;  4AN1 A;  4CY2 A;  3C75 H;  3I89 A;  4PNK B;  2Z2O A;  3EI2 B;  3PVW B;  2H6Q A;  4O1Q D;  3ZE1 A;  2XZG A;  4O02 A;  2CE9 A;  4LGN A;  4XEI C;  2Q7Q A;  4FA9 D;  3DDU A;  2I0S A;  1B9X A;  1FWX A;  4RE6 A;  1N6D A;  2OVQ B;  4J81 A;  5M5S A;  4JSN C;  4DNW A;  4FB1 D;  2CNX A;  5IGO A;  4G1M A;  1MG3 A;  4K3I D;  1GOF A;  3SBP A;  4QQE A;  3EWE A;  3O4G A;  1SQ9 A;  5HQG A;  4J86 A;  3I7P A;  4NEN A;  5C86 A;  4CC9 A;  3I7O A;  1XHM A;  4ERY A;  3VI4 A;  3EI4 B;  3OKY A;  1JOF A;  4R7A B;  5EML B;  5TEF A;  1GXR A;  3UVO A;  3SVW D;  1E5T A;  5FFG A;  4UI9 R;  2W18 A;  2H6N A;  3J81 g;  2XU7 A;  4N14 A;  2CO0 C;  4A08 A;  3F3F A;  1U2V C;  4ZOY A;  4JT5 C;  3HFQ A;  1P22 A;  4A11 B;  3EI3 A;  1U4C A;  1H2X A;  5AFU 3;  1H2Y A;  3JPX A;  4J82 A;  4BH6 A;  3CIK B;  3EQ7 A;  4CI1 A;  3GFC A;  3RN0 D;  3U4Y A;  3PXT D;  5HYN B;  4FAN D;  2P9K C;  3K6S A;  1TYE A;  4ES0 A;  2TRC B;  5C2V B;  1O6G A;  3SCY A;  2B4E A;  3GRE A;  3JAM g;  2HJ4 A;  3BG0 A;  5H14 A;  4WK2 A;  4BL0 A;  4L3G D;  4NAA A;  4X3E A;  5TEE A;  4EWR A;  3JZG A;  5EMJ B;  4PC0 A;  2HU7 A;  3I2N A;  3JRO A;  2OK6 A;  1H2W A;  2H68 A;  2XL2 A;  2HKR A;  4E5Z A; 
#chains in the Genus database with same CATH homology
 3GC3 B;  5M5R A;  5M5S A;  5M5V A;  2XZG A;  1C9I A;  5M5U A;  1UTC A;  5M61 A;  4G55 A;  1BPO A;  1C9L A;  3GD1 I;  5M5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...