5M5TA

Clathrin heavy chain n-terminal domain bound to a non-natural clathrin-box motif peptide (amph4t1)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5tA00
3GD1I 3GC3B 5M5UA 4G55A 1BPOA 5M5RA 2XZGA 1C9IA 5M5TA 1C9LA 5M61A 1UTCA 5M5SA 5M5VA
chains in the Genus database with same CATH superfamily
4NC4A 1GG2B 5HDBA 2H6NA 3PVUB 2VDLA 2BKLA 4A11B 3IURA 5TF2A 5GXIA 4FA1D 2VDOA 3OF7A 3FGBA 5FKQA 4NAAA 2EICA 2H9PA 2QXVA 3GFCA 2H6KA 4BCDA 1TYEA 3SXTD 1GOHA 1TYQC 2XL3A 4E54B 2CE9A 2YMUA 3UVOA 4ZOZA 5IGQA 3SJLD 5FKTA 3FCUA 1K3IA 4CZVA 5FLXg 4DNVA 2HJ4A 1SQJA 1U2VC 5E6UA 3HFQA 4CY3A 4R7AB 4A2LA 3OKWA 4DNWA 4J0WA 3RN0D 5M5RA 2EBSA 2AGWA 3ZDYA 4N14A 2AGYA 4X63B 2B5MA 2IUPA 2YNOA 3PSCB 3CIKB 2PM9A 5H17A 4IMMA 1GXRA 4FA5D 1SQ9A 3IUQA 4D9SA 3NVXA 4G1MA 5EMJB 2HYEA 5GSAA 4FWWA 3IJ1A 1PGUA 3I7HA 1UOOA 4PXWA 3EI4B 2H6QA 4GMBA 1MDAH 2AH0A 3MKQA 3ZE0A 3RMZD 4TZ4A 1U8CA 3AL8B 1K8KC 5IJ7E 3O4GA 1Q47A 1L5GA 2H3XA 3ORVD 1R5MA 3K6SA 3I7NA 5M5VA 4J0XA 4LGNA 1N6DA 3B7FA 4L3HD 5EAPA 4PBYA 2H13A 3JPXA 3UVKA 3FRXA 3UKRC 3K27A 5M5UA 3F3GA 4LG9A 3JZGA 2P9NC 4A2MA 4AMZA 4YVDA 4A08A 1B9XA 4GZ8A 2B5NA 5IT9g 2J57G 3CFSB 4L9OA 3VH0A 3W15A 4A0AB 4E5ZB 2P9LC 2XL2A 1YFQA 4U7AA 1JMXB 3I8CA 3E0CA 1PBYB 1K32A 3GC3B 5KDOB 3EQ7A 4K3JB 4EWRA 3F3FA 4J87A 4XYIA 2IURA 3SHFA 3IVMA 3BG1A 4O3UB 5CXBA 3GREA 3UR4A 3A0FA 4ES0A 4ERQA 3EI3B 3EI1A 4QAMA 4CZXA 3EU7A 5FQDA 4MMYA 2PBIB 2YNPA 4JHPC 2HESX 1UTCA 4WK0A 2GC4A 2Z2PA 5EAMA 5I5MA 5EM2B 1RI6A 3SCYA 4U1EI 5FFOA 2I0RA 4ZOVA 3EQ8A 4GGAA 3I8EA 2OJYA 4Z8LA 3AH8B 5TEEA 3V4PA 4LG8A 2OK6A 4X3EA 4WJKA 3N0EA 4H5JA 4PBZA 4ZN4A 4Z7NA 3RRMC 3C99A 4L1MA 3IUJA 2AGXA 2IUVA 4NBMA 4ERYA 5K19A 3K71A 4J73A 3EG6A 3NIDA 4AN1A 4CY5A 2XZGA 3JROA 4HDJA 4L3GD 2QC5A 3EI2B 1H2YA 2H9NA 1VE6A 3PXTD 4L1QD 4J86A 3OKYB 3SVWD 4ERZA 4CI2A 4XEIC 4A09A 3QHYB 5AFU3 2AQ5A 2CN3A 1A0RB 1JMZB 2I0TA 2CO0C 2YB8B 3GD1I 4O2WA 2PM6B 4BCCA 3JAMg 1H2WA 1UOQA 3N0DA 3EQ9A 3NIFA 4Y7RA 4D0KA 1S4UX 3UVLA 1U4CA 4J81A 2VDNA 4CZYA 3V5WB 3CFVA 4JSVC 5IJ8E 1N6EA 3I89A 5FXYA 5FFGA 1C9LA 5EALA 4A11A 4GM8A 5C2WB 3NVNA 4IRZA 2GC7A 3IJ0A 4UM8A 5B4WA 3C5MA 5SXMA 3MZLA 2H14A 4E54A 5I5JA 2I0SA 4IA9A 3I2NA 3FM0A 4GM3A 4RE5A 5K1CC 3J80g 2VZ1A 1JJUB 1FWXA 2IWFA 5FKSA 3T3MA 4A0BB 3RFHA 4O1QD 2VZ3A 3I7LA 3OL2B 2CE8A 4J78A 5AJAA 3ULEC 1YR2A 4DNUA 1GOGA 4GQ2P 3RN1D 4BUJC 3FCSA 3MZKA 1H2XA 1MG3A 2YBAA 3SBQA 2OK4A 4QQEA 3O4HA 4AN0A 1PI6A 3MUNA 4O02A 4Z7QA 2B5LA 4O9DA 4MMXA 4J8GA 3IKOA 3P4FA 4X60B 3U4YA 4CI3A 2H9MA 3DDUA 2IWKA 4RE6A 3T3PA 2YNNA 3SMRA 1BPOA 4J79A 5GMKn 5EARA 3V9FA 3L4OD 3MMYA 2XDWA 5HE3B 5EMMB 3EI4A 3OL2A 5TEFA 3AL8A 3I7OA 4CI1A 5M5SA 3OW8A 3AL9A 1MG2A 1M1XA 2OVQB 1QFSA 5CXCB 2CN2A 2HU5A 4BCBA 2O9KA 4CY2A 3SWSD 3UKUC 4GQBB 5EMLB 4OWRA 2P9KC 2XU7A 2G99A 3MKSB 4NSXA 5CYKB 4BP8A 4GGCA 1QNIA 5JWZA 4H5IA 1QFMA 5H14A 4PNKB 1VE7A 4A0AA 4AEZA 4E5ZA 3EMHA 4G56B 4GM9A 1T2XA 3SN6B 2H47A 5C92A 3JB9L 2CNXA 3O4IA 3K72A 3IJCA 4JHNA 5HYNB 1PEVA 5E6SA 3EI3A 1H2ZA 4X61B 2P9SC 5M61A 3EWEA 4O45A 3UVNA 2OIZA 3JZNA 2I3SA 4CI8A 4Y5RD 3VI3A 3MUOA 1L0QA 5IGOA 5C86A 4FHLA 1GOFA 3IUNA 4AMYA 5FKRA 1O6GA 5EM2A 4QL1A 5HE0B 1GP2B 3K26A 3C75H 3AFCA 3DXMC 5HE2B 4CC9A 2UZYB 1XKSA 3IUMA 5FA5B 1A12A 4AX4A 3ZE1A 5M5TA 2PM7B 3NIGA 3DM0A 3UVMA 3RFGA 4FA4D 2AH1A 4JSXC 4CY1A 3V7DB 1P22A 2H9LA 3DXKC 3O4JA 1XIPA 3PVWB 4JXMA 4ZOXA 5THAA 2HXCA 2QR5A 1C9IA 4KFMB 1E5TA 3SLED 5AMSA 4PC0A 4PSXB 4WK4A 2PM9B 2J56H 4QRJA 4JSPC 4XYHA 3EI2A 4BL0A 3OKYA 3V4VA 1SHYB 4UM9A 4JT5C 4J84A 2VDPA 2IUQA 3QI0A 5C9ZB 2JKXA 2GNQA 3JRPA 2OVPB 4A7JA 4JSNC 1I2MB 3ODTA 2XE4A 3SBRA 1OLZA 2HU8A 4J77A 4FAND 3OTTA 3IJEA 3IIWA 1JTDB 2OVRB 2Z2NA 1VZ3A 3I7PA 4J82A 4I79A 4G55A 3VI4A 1NR0A 2VDKA 4OZUA 4D6VA 5GXHA 4K3ID 4ZOYA 3IULA 3ZDXA 2EIBA 2IAAA 2P9IC 2VDQA 4A08B 2MTAH 5I5IA 4O3TB 3SFZA 2UZXB 1GOTB 4FAVD 4Z7OA 3RLMD 2BCJB 3VGZA 3PXSD 2VC2A 2HKMA 4BP9A 4A0BA 2WQ8A 1ERJA 2VDRA 3OKTA 1E8NA 5CXBB 1O6FA 5TDHB 3ZE2A 1VYHC 4UI9R 5HQGA 2EIEA 2TRCB 1UOPA 5A2Qg 3EI1B 1OMWB 3PE7A 2J55H 4JT6C 2P9PC 2P9UC 3MVDK 3L4MD 2VDMA 2G9AA 2W18A 2Q7QA 4J8BA 1N6FA 1JOFA 3KRWB 1XHMA 3RSEC 4FB1D 3IIYA 1TBGA 3F3PA 2H68A 3KRXB 4NENA 3BWSA 2HU7A 5E6RA 4AOWA 4WK2A 4MMZA 2XYIA 4BH6A 3DSMA 4MK0B 3DWLC 2I3TA 2HKRA 4JD2C 3VA6A 1VZ2A 4PSWB 3NVQA 3J81g 2BBKH 3MXXA 5CXCA 5EMKB 2AGZA 5C2VB 4GQ1A 3JZHA 3C9CA 2QZPA 3KCIA 2AGLA 4ESGA 3BG0A 5HE1B 1E8MA 4GGDA 5CYKA 2B4EA 3PXWD 2Z2OA 4A09B 3SBPA 2HJBA 2EIDA 3I7KA 3PSLA 2CO0A 1JV2A 4G1EA 1B9YA 5IC7A 1NEXB 4FA9D 3ZWLB 5H1MA 4QT8A 3ZDZA
chains in the Genus database with same CATH topology
3GD1I 3GC3B 5M5UA 4G55A 1BPOA 5M5RA 2XZGA 1C9IA 5M5TA 1C9LA 5M61A 1UTCA 5M5SA 5M5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD1 I;  3GC3 B;  5M5U A;  4G55 A;  1BPO A;  5M5R A;  2XZG A;  1C9I A;  5M5T A;  1C9L A;  5M61 A;  1UTC A;  5M5S A;  5M5V A; 
#chains in the Genus database with same CATH topology
 4NC4 A;  1GG2 B;  5HDB A;  2H6N A;  3PVU B;  2VDL A;  2BKL A;  4A11 B;  3IUR A;  5TF2 A;  5GXI A;  4FA1 D;  2VDO A;  3OF7 A;  3FGB A;  5FKQ A;  4NAA A;  2EIC A;  2H9P A;  2QXV A;  3GFC A;  2H6K A;  4BCD A;  1TYE A;  3SXT D;  1GOH A;  1TYQ C;  2XL3 A;  4E54 B;  2CE9 A;  2YMU A;  3UVO A;  4ZOZ A;  5IGQ A;  3SJL D;  5FKT A;  3FCU A;  1K3I A;  4CZV A;  5FLX g;  4DNV A;  2HJ4 A;  1SQJ A;  1U2V C;  5E6U A;  3HFQ A;  4CY3 A;  4R7A B;  4A2L A;  3OKW A;  4DNW A;  4J0W A;  3RN0 D;  5M5R A;  2EBS A;  2AGW A;  3ZDY A;  4N14 A;  2AGY A;  4X63 B;  2B5M A;  2IUP A;  2YNO A;  3PSC B;  3CIK B;  2PM9 A;  5H17 A;  4IMM A;  1GXR A;  4FA5 D;  1SQ9 A;  3IUQ A;  4D9S A;  3NVX A;  4G1M A;  5EMJ B;  2HYE A;  5GSA A;  4FWW A;  3IJ1 A;  1PGU A;  3I7H A;  1UOO A;  4PXW A;  3EI4 B;  2H6Q A;  4GMB A;  1MDA H;  2AH0 A;  3MKQ A;  3ZE0 A;  3RMZ D;  4TZ4 A;  1U8C A;  3AL8 B;  1K8K C;  5IJ7 E;  3O4G A;  1Q47 A;  1L5G A;  2H3X A;  3ORV D;  1R5M A;  3K6S A;  3I7N A;  5M5V A;  4J0X A;  4LGN A;  1N6D A;  3B7F A;  4L3H D;  5EAP A;  4PBY A;  2H13 A;  3JPX A;  3UVK A;  3FRX A;  3UKR C;  3K27 A;  5M5U A;  3F3G A;  4LG9 A;  3JZG A;  2P9N C;  4A2M A;  4AMZ A;  4YVD A;  4A08 A;  1B9X A;  4GZ8 A;  2B5N A;  5IT9 g;  2J57 G;  3CFS B;  4L9O A;  3VH0 A;  3W15 A;  4A0A B;  4E5Z B;  2P9L C;  2XL2 A;  1YFQ A;  4U7A A;  1JMX B;  3I8C A;  3E0C A;  1PBY B;  1K32 A;  3GC3 B;  5KDO B;  3EQ7 A;  4K3J B;  4EWR A;  3F3F A;  4J87 A;  4XYI A;  2IUR A;  3SHF A;  3IVM A;  3BG1 A;  4O3U B;  5CXB A;  3GRE A;  3UR4 A;  3A0F A;  4ES0 A;  4ERQ A;  3EI3 B;  3EI1 A;  4QAM A;  4CZX A;  3EU7 A;  5FQD A;  4MMY A;  2PBI B;  2YNP A;  4JHP C;  2HES X;  1UTC A;  4WK0 A;  2GC4 A;  2Z2P A;  5EAM A;  5I5M A;  5EM2 B;  1RI6 A;  3SCY A;  4U1E I;  5FFO A;  2I0R A;  4ZOV A;  3EQ8 A;  4GGA A;  3I8E A;  2OJY A;  4Z8L A;  3AH8 B;  5TEE A;  3V4P A;  4LG8 A;  2OK6 A;  4X3E A;  4WJK A;  3N0E A;  4H5J A;  4PBZ A;  4ZN4 A;  4Z7N A;  3RRM C;  3C99 A;  4L1M A;  3IUJ A;  2AGX A;  2IUV A;  4NBM A;  4ERY A;  5K19 A;  3K71 A;  4J73 A;  3EG6 A;  3NID A;  4AN1 A;  4CY5 A;  2XZG A;  3JRO A;  4HDJ A;  4L3G D;  2QC5 A;  3EI2 B;  1H2Y A;  2H9N A;  1VE6 A;  3PXT D;  4L1Q D;  4J86 A;  3OKY B;  3SVW D;  4ERZ A;  4CI2 A;  4XEI C;  4A09 A;  3QHY B;  5AFU 3;  2AQ5 A;  2CN3 A;  1A0R B;  1JMZ B;  2I0T A;  2CO0 C;  2YB8 B;  3GD1 I;  4O2W A;  2PM6 B;  4BCC A;  3JAM g;  1H2W A;  1UOQ A;  3N0D A;  3EQ9 A;  3NIF A;  4Y7R A;  4D0K A;  1S4U X;  3UVL A;  1U4C A;  4J81 A;  2VDN A;  4CZY A;  3V5W B;  3CFV A;  4JSV C;  5IJ8 E;  1N6E A;  3I89 A;  5FXY A;  5FFG A;  1C9L A;  5EAL A;  4A11 A;  4GM8 A;  5C2W B;  3NVN A;  4IRZ A;  2GC7 A;  3IJ0 A;  4UM8 A;  5B4W A;  3C5M A;  5SXM A;  3MZL A;  2H14 A;  4E54 A;  5I5J A;  2I0S A;  4IA9 A;  3I2N A;  3FM0 A;  4GM3 A;  4RE5 A;  5K1C C;  3J80 g;  2VZ1 A;  1JJU B;  1FWX A;  2IWF A;  5FKS A;  3T3M A;  4A0B B;  3RFH A;  4O1Q D;  2VZ3 A;  3I7L A;  3OL2 B;  2CE8 A;  4J78 A;  5AJA A;  3ULE C;  1YR2 A;  4DNU A;  1GOG A;  4GQ2 P;  3RN1 D;  4BUJ C;  3FCS A;  3MZK A;  1H2X A;  1MG3 A;  2YBA A;  3SBQ A;  2OK4 A;  4QQE A;  3O4H A;  4AN0 A;  1PI6 A;  3MUN A;  4O02 A;  4Z7Q A;  2B5L A;  4O9D A;  4MMX A;  4J8G A;  3IKO A;  3P4F A;  4X60 B;  3U4Y A;  4CI3 A;  2H9M A;  3DDU A;  2IWK A;  4RE6 A;  3T3P A;  2YNN A;  3SMR A;  1BPO A;  4J79 A;  5GMK n;  5EAR A;  3V9F A;  3L4O D;  3MMY A;  2XDW A;  5HE3 B;  5EMM B;  3EI4 A;  3OL2 A;  5TEF A;  3AL8 A;  3I7O A;  4CI1 A;  5M5S A;  3OW8 A;  3AL9 A;  1MG2 A;  1M1X A;  2OVQ B;  1QFS A;  5CXC B;  2CN2 A;  2HU5 A;  4BCB A;  2O9K A;  4CY2 A;  3SWS D;  3UKU C;  4GQB B;  5EML B;  4OWR A;  2P9K C;  2XU7 A;  2G99 A;  3MKS B;  4NSX A;  5CYK B;  4BP8 A;  4GGC A;  1QNI A;  5JWZ A;  4H5I A;  1QFM A;  5H14 A;  4PNK B;  1VE7 A;  4A0A A;  4AEZ A;  4E5Z A;  3EMH A;  4G56 B;  4GM9 A;  1T2X A;  3SN6 B;  2H47 A;  5C92 A;  3JB9 L;  2CNX A;  3O4I A;  3K72 A;  3IJC A;  4JHN A;  5HYN B;  1PEV A;  5E6S A;  3EI3 A;  1H2Z A;  4X61 B;  2P9S C;  5M61 A;  3EWE A;  4O45 A;  3UVN A;  2OIZ A;  3JZN A;  2I3S A;  4CI8 A;  4Y5R D;  3VI3 A;  3MUO A;  1L0Q A;  5IGO A;  5C86 A;  4FHL A;  1GOF A;  3IUN A;  4AMY A;  5FKR A;  1O6G A;  5EM2 A;  4QL1 A;  5HE0 B;  1GP2 B;  3K26 A;  3C75 H;  3AFC A;  3DXM C;  5HE2 B;  4CC9 A;  2UZY B;  1XKS A;  3IUM A;  5FA5 B;  1A12 A;  4AX4 A;  3ZE1 A;  5M5T A;  2PM7 B;  3NIG A;  3DM0 A;  3UVM A;  3RFG A;  4FA4 D;  2AH1 A;  4JSX C;  4CY1 A;  3V7D B;  1P22 A;  2H9L A;  3DXK C;  3O4J A;  1XIP A;  3PVW B;  4JXM A;  4ZOX A;  5THA A;  2HXC A;  2QR5 A;  1C9I A;  4KFM B;  1E5T A;  3SLE D;  5AMS A;  4PC0 A;  4PSX B;  4WK4 A;  2PM9 B;  2J56 H;  4QRJ A;  4JSP C;  4XYH A;  3EI2 A;  4BL0 A;  3OKY A;  3V4V A;  1SHY B;  4UM9 A;  4JT5 C;  4J84 A;  2VDP A;  2IUQ A;  3QI0 A;  5C9Z B;  2JKX A;  2GNQ A;  3JRP A;  2OVP B;  4A7J A;  4JSN C;  1I2M B;  3ODT A;  2XE4 A;  3SBR A;  1OLZ A;  2HU8 A;  4J77 A;  4FAN D;  3OTT A;  3IJE A;  3IIW A;  1JTD B;  2OVR B;  2Z2N A;  1VZ3 A;  3I7P A;  4J82 A;  4I79 A;  4G55 A;  3VI4 A;  1NR0 A;  2VDK A;  4OZU A;  4D6V A;  5GXH A;  4K3I D;  4ZOY A;  3IUL A;  3ZDX A;  2EIB A;  2IAA A;  2P9I C;  2VDQ A;  4A08 B;  2MTA H;  5I5I A;  4O3T B;  3SFZ A;  2UZX B;  1GOT B;  4FAV D;  4Z7O A;  3RLM D;  2BCJ B;  3VGZ A;  3PXS D;  2VC2 A;  2HKM A;  4BP9 A;  4A0B A;  2WQ8 A;  1ERJ A;  2VDR A;  3OKT A;  1E8N A;  5CXB B;  1O6F A;  5TDH B;  3ZE2 A;  1VYH C;  4UI9 R;  5HQG A;  2EIE A;  2TRC B;  1UOP A;  5A2Q g;  3EI1 B;  1OMW B;  3PE7 A;  2J55 H;  4JT6 C;  2P9P C;  2P9U C;  3MVD K;  3L4M D;  2VDM A;  2G9A A;  2W18 A;  2Q7Q A;  4J8B A;  1N6F A;  1JOF A;  3KRW B;  1XHM A;  3RSE C;  4FB1 D;  3IIY A;  1TBG A;  3F3P A;  2H68 A;  3KRX B;  4NEN A;  3BWS A;  2HU7 A;  5E6R A;  4AOW A;  4WK2 A;  4MMZ A;  2XYI A;  4BH6 A;  3DSM A;  4MK0 B;  3DWL C;  2I3T A;  2HKR A;  4JD2 C;  3VA6 A;  1VZ2 A;  4PSW B;  3NVQ A;  3J81 g;  2BBK H;  3MXX A;  5CXC A;  5EMK B;  2AGZ A;  5C2V B;  4GQ1 A;  3JZH A;  3C9C A;  2QZP A;  3KCI A;  2AGL A;  4ESG A;  3BG0 A;  5HE1 B;  1E8M A;  4GGD A;  5CYK A;  2B4E A;  3PXW D;  2Z2O A;  4A09 B;  3SBP A;  2HJB A;  2EID A;  3I7K A;  3PSL A;  2CO0 A;  1JV2 A;  4G1E A;  1B9Y A;  5IC7 A;  1NEX B;  4FA9 D;  3ZWL B;  5H1M A;  4QT8 A;  3ZDZ A; 
#chains in the Genus database with same CATH homology
 3GD1 I;  3GC3 B;  5M5U A;  4G55 A;  1BPO A;  5M5R A;  2XZG A;  1C9I A;  5M5T A;  1C9L A;  5M61 A;  1UTC A;  5M5S A;  5M5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...