5M5UA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 1)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 83
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5uA00
4G55A 2XZGA 5M5UA 3GD1I 5M5VA 5M61A 1C9IA 1BPOA 5M5RA 1UTCA 1C9LA 5M5TA 5M5SA 3GC3B
chains in the Genus database with same CATH superfamily
4RE6A 3EQ8A 3UVOA 1JOFA 3V9FA 4FA4D 1XHMA 2I0SA 1GOHA 4GM3A 3RMZD 3GC3B 1JV2A 3O4JA 4G1EA 3U4YA 1H2WA 3JAMg 3ZE2A 3EQ7A 1A12A 4GZ8A 3KRXB 3GD1I 5H1MA 2I3TA 3DM0A 4I79A 4CY1A 2Z2OA 3SBQA 3ZWLB 4Z7QA 3EI3A 3UVLA 2GNQA 3UKUC 5IGQA 4X60B 1N6EA 3RRMC 2IUVA 4A11B 4O2WA 2AH0A 3SBPA 4Z8LA 1UTCA 4AN0A 2VDLA 4O02A 5E6SA 4QRJA 2AGYA 3IJCA 4ESGA 2AH1A 4PBZA 1JTDB 4UM9A 5IGOA 3RSEC 4PBYA 1E8MA 4A2MA 4DNWA 3UVNA 4BCBA 5CXCA 2EIDA 4J8BA 4JSVC 3O4GA 4ZOVA 2B5LA 4G55A 3MKSB 2H13A 3ZDZA 4Y5RD 3FCUA 3AFCA 5FKRA 3VH0A 4J79A 3IULA 1GOGA 5FXYA 3K27A 4GM9A 3VI3A 3EI2B 2OVPB 4CI3A 3N0EA 4E5ZB 1SQJA 4WK4A 2AGZA 3QI0A 3EMHA 3V4PA 4QAMA 4E5ZA 1U2VC 2HU8A 4K3ID 1B9YA 2CN2A 3MVDK 4BH6A 4JHNA 5C92A 2CE8A 4A09A 2W18A 3NVQA 3F3GA 3I7NA 2YNOA 3BG1A 4CY3A 2VDRA 4GGAA 4BCCA 2HJBA 4PXWA 1U4CA 1PI6A 3VA6A 4NBMA 4FA5D 5FKTA 5GMKn 2OK6A 3JZGA 3SBRA 4NSXA 4N14A 2HESX 1SQ9A 1MG2A 4JHPC 3DXKC 5AMSA 4BCDA 1O6GA 4DNUA 5C86A 2OVQB 1PEVA 4CZXA 4JD2C 3NVXA 2PM9A 5GXIA 2XU7A 3ULEC 5EALA 1NEXB 5EMMB 5E6UA 2G99A 3I7KA 4JSXC 4O45A 3JB9L 2I0TA 2YMUA 2XE4A 4ZN4A 2P9IC 3PSCB 2XDWA 3OKTA 2IWFA 3E0CA 4GM8A 3IURA 4MMZA 3HFQA 5EMLB 1NR0A 3F3PA 2I3SA 5HDBA 5GXHA 3IUQA 2H9PA 2BBKH 4JSNC 1JJUB 1K32A 2HXCA 4QL1A 4TZ4A 4WJKA 4FA9D 3OF7A 1H2YA 3OKYB 3J80g 2VZ3A 2GC7A 4BUJC 1H2ZA 2I0RA 3EQ9A 4MMYA 3PXSD 5C2VB 2J57G 4AOWA 3SXTD 1VYHC 3I7LA 2J55H 2PM6B 3A0FA 2P9UC 3JZHA 1N6DA 5FFGA 4A0AB 2H9MA 2QR5A 4GQ2P 4A0AA 3IIWA 4XYHA 3PVUB 3O4IA 4LG8A 3IIYA 3V7DB 3K71A 5FFOA 5EM2B 2AGLA 5FKQA 1QFMA 2CO0A 4MMXA 3V4VA 5AJAA 4J86A 2CN3A 5THAA 5H17A 5HE0B 3UVMA 2BKLA 4A7JA 3MKQA 4O1QD 1M1XA 3UKRC 4A11A 3SN6B 3NIGA 1GP2B 2CNXA 1PBYB 4R7AB 3F3FA 4MK0B 4L3GD 2Z2PA 3IUNA 3ZE1A 4AX4A 4AN1A 2BCJB 5C2WB 1OMWB 2WQ8A 2XYIA 4NENA 4CC9A 5M5VA 3CFVA 5EAPA 4J81A 3C75H 4GMBA 5EMKB 1GG2B 3ZDYA 3CFSB 3KCIA 3AL8B 3UR4A 4L1MA 3SHFA 2IUPA 4OZUA 5CXBB 4CY2A 2VDQA 3OKWA 3IJ0A 3EI2A 4E54B 1JMXB 1O6FA 3MZLA 2GC4A 2H6QA 4GQBB 4E54A 2TRCB 2H3XA 2VDNA 4FHLA 2CE9A 4O9DA 4L1QD 4Z7NA 3UVKA 3PSLA 4PSWB 3RFGA 2IWKA 4GQ1A 3KRWB 1K3IA 3FRXA 4H5IA 3JPXA 3SWSD 4EWRA 1VZ2A 2IURA 3RFHA 4NC4A 4WK2A 2H6KA 4AMYA 4J8GA 2EICA 3DXMC 3OL2B 4LGNA 3VGZA 4FB1D 4J82A 4IA9A 4A08B 4J73A 4BP8A 1GOTB 1ERJA 3EWEA 3I8CA 3PXTD 4BL0A 5M5RA 3T3PA 3I7OA 1TYEA 2P9PC 3SJLD 2IAAA 2G9AA 1P22A 4J78A 3ZDXA 3BWSA 5TDHB 3I7PA 3B7FA 3MMYA 4G1MA 3ODTA 5M5TA 2QZPA 4GGDA 3EI4B 4NAAA 3IUMA 3PE7A 4U7AA 1S4UX 4PSXB 2VC2A 4IRZA 2XZGA 5I5JA 3NVNA 4WK0A 2CO0C 1H2XA 1R5MA 5H14A 2EBSA 1SHYB 1L5GA 3C99A 4RE5A 5FKSA 3W15A 3IJ1A 4D0KA 3K72A 2OIZA 4XYIA 2J56H 4LG9A 3DDUA 2Z2NA 2H9LA 5CYKB 1JMZB 3OKYA 3QHYB 3OW8A 5EMJB 4CZVA 2B5NA 3EI1B 4AMZA 2EIBA 5CYKA 2B4EA 4KFMB 2P9NC 5HE1B 5HYNB 3NIDA 3JZNA 3GREA 5M5UA 4A0BB 5M61A 4L3HD 4A2LA 3PVWB 5M5SA 3FM0A 2H14A 1YR2A 3I2NA 3EU7A 4J77A 3I89A 2OJYA 3FGBA 3K6SA 2B5MA 1UOOA 4Z7OA 5SXMA 4D9SA 5GSAA 3JRPA 4OWRA 2QXVA 2AGXA 5IC7A 3SCYA 4K3JB 1K8KC 5EM2A 1VE6A 3DWLC 2P9KC 4DNVA 4J0WA 5A2Qg 4CY5A 4ES0A 3C5MA 5HQGA 3ORVD 5FA5B 4HDJA 2HKRA 2Q7QA 3EI3B 4UM8A 1FWXA 5HE3B 2UZXB 4ZOXA 3SFZA 1TBGA 3SVWD 2P9LC 4GGCA 4JSPC 3MZKA 4CI1A 2OK4A 2EIEA 5IT9g 1C9IA 1BPOA 3V5WB 4QT8A 3C9CA 5B4WA 4G56B 2VZ1A 5JWZA 1VZ3A 4UI9R 3L4MD 4O3UB 1E5TA 4ERZA 4L9OA 2HJ4A 5CXCB 4ERQA 5KDOB 1XIPA 3SLED 3AL8A 5CXBA 3VI4A 2YNNA 3RN0D 2VDPA 4YVDA 3AH8B 1L0QA 3RN1D 3NIFA 5K1CC 5IJ8E 4X61B 3MXXA 1MG3A 1E8NA 1Q47A 1GXRA 5HE2B 3OTTA 4X3EA 2HU7A 3SMRA 2OVRB 1XKSA 4ERYA 2H68A 1N6FA 1RI6A 2XL2A 1OLZA 2VDOA 3IJEA 4FAND 1QFSA 4XEIC 2XL3A 3N0DA 2O9KA 3BG0A 3K26A 4X63B 3IVMA 3OL2A 3ZE0A 3RLMD 3I7HA 4A09B 4A08A 4PNKB 3I8EA 4BP9A 5TEFA 4ZOYA 2H6NA 1U8CA 2HU5A 4FA1D 4FAVD 2HKMA 2UZYB 5EARA 2IUQA 4ZOZA 2VDKA 3FCSA 1PGUA 2H9NA 2PBIB 1T2XA 3JROA 4U1EI 3EI4A 1UOQA 1TYQC 4CI2A 3J81g 2VDMA 5K19A 2AGWA 4AEZA 4J87A 2PM9B 3O4HA 4D6VA 3AL9A 5FLXg 3CIKB 5EAMA 5IJ7E 2H47A 2MTAH 3DSMA 2JKXA 3EG6A 4CZYA 1YFQA 3PXWD 3IUJA 1MDAH 4Y7RA 5I5MA 5AFU3 5TEEA 4QQEA 3MUOA 2YB8B 3T3MA 1B9XA 3IKOA 5I5IA 4J0XA 3L4OD 2AQ5A 1A0RB 4CI8A 5TF2A 1QNIA 2YBAA 3EI1A 1VE7A 3MUNA 1C9LA 2YNPA 2P9SC 4PC0A 5C9ZB 4JT6C 5E6RA 4JT5C 4A0BA 2PM7B 4O3TB 2QC5A 2HYEA 1UOPA 5FQDA 4IMMA 4FWWA 3GFCA 4JXMA 1GOFA 3P4FA 4H5JA 1I2MB 4J84A
chains in the Genus database with same CATH topology
4G55A 2XZGA 5M5UA 3GD1I 5M5VA 5M61A 1C9IA 1BPOA 5M5RA 1UTCA 1C9LA 5M5TA 5M5SA 3GC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G55 A;  2XZG A;  5M5U A;  3GD1 I;  5M5V A;  5M61 A;  1C9I A;  1BPO A;  5M5R A;  1UTC A;  1C9L A;  5M5T A;  5M5S A;  3GC3 B; 
#chains in the Genus database with same CATH topology
 4RE6 A;  3EQ8 A;  3UVO A;  1JOF A;  3V9F A;  4FA4 D;  1XHM A;  2I0S A;  1GOH A;  4GM3 A;  3RMZ D;  3GC3 B;  1JV2 A;  3O4J A;  4G1E A;  3U4Y A;  1H2W A;  3JAM g;  3ZE2 A;  3EQ7 A;  1A12 A;  4GZ8 A;  3KRX B;  3GD1 I;  5H1M A;  2I3T A;  3DM0 A;  4I79 A;  4CY1 A;  2Z2O A;  3SBQ A;  3ZWL B;  4Z7Q A;  3EI3 A;  3UVL A;  2GNQ A;  3UKU C;  5IGQ A;  4X60 B;  1N6E A;  3RRM C;  2IUV A;  4A11 B;  4O2W A;  2AH0 A;  3SBP A;  4Z8L A;  1UTC A;  4AN0 A;  2VDL A;  4O02 A;  5E6S A;  4QRJ A;  2AGY A;  3IJC A;  4ESG A;  2AH1 A;  4PBZ A;  1JTD B;  4UM9 A;  5IGO A;  3RSE C;  4PBY A;  1E8M A;  4A2M A;  4DNW A;  3UVN A;  4BCB A;  5CXC A;  2EID A;  4J8B A;  4JSV C;  3O4G A;  4ZOV A;  2B5L A;  4G55 A;  3MKS B;  2H13 A;  3ZDZ A;  4Y5R D;  3FCU A;  3AFC A;  5FKR A;  3VH0 A;  4J79 A;  3IUL A;  1GOG A;  5FXY A;  3K27 A;  4GM9 A;  3VI3 A;  3EI2 B;  2OVP B;  4CI3 A;  3N0E A;  4E5Z B;  1SQJ A;  4WK4 A;  2AGZ A;  3QI0 A;  3EMH A;  3V4P A;  4QAM A;  4E5Z A;  1U2V C;  2HU8 A;  4K3I D;  1B9Y A;  2CN2 A;  3MVD K;  4BH6 A;  4JHN A;  5C92 A;  2CE8 A;  4A09 A;  2W18 A;  3NVQ A;  3F3G A;  3I7N A;  2YNO A;  3BG1 A;  4CY3 A;  2VDR A;  4GGA A;  4BCC A;  2HJB A;  4PXW A;  1U4C A;  1PI6 A;  3VA6 A;  4NBM A;  4FA5 D;  5FKT A;  5GMK n;  2OK6 A;  3JZG A;  3SBR A;  4NSX A;  4N14 A;  2HES X;  1SQ9 A;  1MG2 A;  4JHP C;  3DXK C;  5AMS A;  4BCD A;  1O6G A;  4DNU A;  5C86 A;  2OVQ B;  1PEV A;  4CZX A;  4JD2 C;  3NVX A;  2PM9 A;  5GXI A;  2XU7 A;  3ULE C;  5EAL A;  1NEX B;  5EMM B;  5E6U A;  2G99 A;  3I7K A;  4JSX C;  4O45 A;  3JB9 L;  2I0T A;  2YMU A;  2XE4 A;  4ZN4 A;  2P9I C;  3PSC B;  2XDW A;  3OKT A;  2IWF A;  3E0C A;  4GM8 A;  3IUR A;  4MMZ A;  3HFQ A;  5EML B;  1NR0 A;  3F3P A;  2I3S A;  5HDB A;  5GXH A;  3IUQ A;  2H9P A;  2BBK H;  4JSN C;  1JJU B;  1K32 A;  2HXC A;  4QL1 A;  4TZ4 A;  4WJK A;  4FA9 D;  3OF7 A;  1H2Y A;  3OKY B;  3J80 g;  2VZ3 A;  2GC7 A;  4BUJ C;  1H2Z A;  2I0R A;  3EQ9 A;  4MMY A;  3PXS D;  5C2V B;  2J57 G;  4AOW A;  3SXT D;  1VYH C;  3I7L A;  2J55 H;  2PM6 B;  3A0F A;  2P9U C;  3JZH A;  1N6D A;  5FFG A;  4A0A B;  2H9M A;  2QR5 A;  4GQ2 P;  4A0A A;  3IIW A;  4XYH A;  3PVU B;  3O4I A;  4LG8 A;  3IIY A;  3V7D B;  3K71 A;  5FFO A;  5EM2 B;  2AGL A;  5FKQ A;  1QFM A;  2CO0 A;  4MMX A;  3V4V A;  5AJA A;  4J86 A;  2CN3 A;  5THA A;  5H17 A;  5HE0 B;  3UVM A;  2BKL A;  4A7J A;  3MKQ A;  4O1Q D;  1M1X A;  3UKR C;  4A11 A;  3SN6 B;  3NIG A;  1GP2 B;  2CNX A;  1PBY B;  4R7A B;  3F3F A;  4MK0 B;  4L3G D;  2Z2P A;  3IUN A;  3ZE1 A;  4AX4 A;  4AN1 A;  2BCJ B;  5C2W B;  1OMW B;  2WQ8 A;  2XYI A;  4NEN A;  4CC9 A;  5M5V A;  3CFV A;  5EAP A;  4J81 A;  3C75 H;  4GMB A;  5EMK B;  1GG2 B;  3ZDY A;  3CFS B;  3KCI A;  3AL8 B;  3UR4 A;  4L1M A;  3SHF A;  2IUP A;  4OZU A;  5CXB B;  4CY2 A;  2VDQ A;  3OKW A;  3IJ0 A;  3EI2 A;  4E54 B;  1JMX B;  1O6F A;  3MZL A;  2GC4 A;  2H6Q A;  4GQB B;  4E54 A;  2TRC B;  2H3X A;  2VDN A;  4FHL A;  2CE9 A;  4O9D A;  4L1Q D;  4Z7N A;  3UVK A;  3PSL A;  4PSW B;  3RFG A;  2IWK A;  4GQ1 A;  3KRW B;  1K3I A;  3FRX A;  4H5I A;  3JPX A;  3SWS D;  4EWR A;  1VZ2 A;  2IUR A;  3RFH A;  4NC4 A;  4WK2 A;  2H6K A;  4AMY A;  4J8G A;  2EIC A;  3DXM C;  3OL2 B;  4LGN A;  3VGZ A;  4FB1 D;  4J82 A;  4IA9 A;  4A08 B;  4J73 A;  4BP8 A;  1GOT B;  1ERJ A;  3EWE A;  3I8C A;  3PXT D;  4BL0 A;  5M5R A;  3T3P A;  3I7O A;  1TYE A;  2P9P C;  3SJL D;  2IAA A;  2G9A A;  1P22 A;  4J78 A;  3ZDX A;  3BWS A;  5TDH B;  3I7P A;  3B7F A;  3MMY A;  4G1M A;  3ODT A;  5M5T A;  2QZP A;  4GGD A;  3EI4 B;  4NAA A;  3IUM A;  3PE7 A;  4U7A A;  1S4U X;  4PSX B;  2VC2 A;  4IRZ A;  2XZG A;  5I5J A;  3NVN A;  4WK0 A;  2CO0 C;  1H2X A;  1R5M A;  5H14 A;  2EBS A;  1SHY B;  1L5G A;  3C99 A;  4RE5 A;  5FKS A;  3W15 A;  3IJ1 A;  4D0K A;  3K72 A;  2OIZ A;  4XYI A;  2J56 H;  4LG9 A;  3DDU A;  2Z2N A;  2H9L A;  5CYK B;  1JMZ B;  3OKY A;  3QHY B;  3OW8 A;  5EMJ B;  4CZV A;  2B5N A;  3EI1 B;  4AMZ A;  2EIB A;  5CYK A;  2B4E A;  4KFM B;  2P9N C;  5HE1 B;  5HYN B;  3NID A;  3JZN A;  3GRE A;  5M5U A;  4A0B B;  5M61 A;  4L3H D;  4A2L A;  3PVW B;  5M5S A;  3FM0 A;  2H14 A;  1YR2 A;  3I2N A;  3EU7 A;  4J77 A;  3I89 A;  2OJY A;  3FGB A;  3K6S A;  2B5M A;  1UOO A;  4Z7O A;  5SXM A;  4D9S A;  5GSA A;  3JRP A;  4OWR A;  2QXV A;  2AGX A;  5IC7 A;  3SCY A;  4K3J B;  1K8K C;  5EM2 A;  1VE6 A;  3DWL C;  2P9K C;  4DNV A;  4J0W A;  5A2Q g;  4CY5 A;  4ES0 A;  3C5M A;  5HQG A;  3ORV D;  5FA5 B;  4HDJ A;  2HKR A;  2Q7Q A;  3EI3 B;  4UM8 A;  1FWX A;  5HE3 B;  2UZX B;  4ZOX A;  3SFZ A;  1TBG A;  3SVW D;  2P9L C;  4GGC A;  4JSP C;  3MZK A;  4CI1 A;  2OK4 A;  2EIE A;  5IT9 g;  1C9I A;  1BPO A;  3V5W B;  4QT8 A;  3C9C A;  5B4W A;  4G56 B;  2VZ1 A;  5JWZ A;  1VZ3 A;  4UI9 R;  3L4M D;  4O3U B;  1E5T A;  4ERZ A;  4L9O A;  2HJ4 A;  5CXC B;  4ERQ A;  5KDO B;  1XIP A;  3SLE D;  3AL8 A;  5CXB A;  3VI4 A;  2YNN A;  3RN0 D;  2VDP A;  4YVD A;  3AH8 B;  1L0Q A;  3RN1 D;  3NIF A;  5K1C C;  5IJ8 E;  4X61 B;  3MXX A;  1MG3 A;  1E8N A;  1Q47 A;  1GXR A;  5HE2 B;  3OTT A;  4X3E A;  2HU7 A;  3SMR A;  2OVR B;  1XKS A;  4ERY A;  2H68 A;  1N6F A;  1RI6 A;  2XL2 A;  1OLZ A;  2VDO A;  3IJE A;  4FAN D;  1QFS A;  4XEI C;  2XL3 A;  3N0D A;  2O9K A;  3BG0 A;  3K26 A;  4X63 B;  3IVM A;  3OL2 A;  3ZE0 A;  3RLM D;  3I7H A;  4A09 B;  4A08 A;  4PNK B;  3I8E A;  4BP9 A;  5TEF A;  4ZOY A;  2H6N A;  1U8C A;  2HU5 A;  4FA1 D;  4FAV D;  2HKM A;  2UZY B;  5EAR A;  2IUQ A;  4ZOZ A;  2VDK A;  3FCS A;  1PGU A;  2H9N A;  2PBI B;  1T2X A;  3JRO A;  4U1E I;  3EI4 A;  1UOQ A;  1TYQ C;  4CI2 A;  3J81 g;  2VDM A;  5K19 A;  2AGW A;  4AEZ A;  4J87 A;  2PM9 B;  3O4H A;  4D6V A;  3AL9 A;  5FLX g;  3CIK B;  5EAM A;  5IJ7 E;  2H47 A;  2MTA H;  3DSM A;  2JKX A;  3EG6 A;  4CZY A;  1YFQ A;  3PXW D;  3IUJ A;  1MDA H;  4Y7R A;  5I5M A;  5AFU 3;  5TEE A;  4QQE A;  3MUO A;  2YB8 B;  3T3M A;  1B9X A;  3IKO A;  5I5I A;  4J0X A;  3L4O D;  2AQ5 A;  1A0R B;  4CI8 A;  5TF2 A;  1QNI A;  2YBA A;  3EI1 A;  1VE7 A;  3MUN A;  1C9L A;  2YNP A;  2P9S C;  4PC0 A;  5C9Z B;  4JT6 C;  5E6R A;  4JT5 C;  4A0B A;  2PM7 B;  4O3T B;  2QC5 A;  2HYE A;  1UOP A;  5FQD A;  4IMM A;  4FWW A;  3GFC A;  4JXM A;  1GOF A;  3P4F A;  4H5J A;  1I2M B;  4J84 A; 
#chains in the Genus database with same CATH homology
 4G55 A;  2XZG A;  5M5U A;  3GD1 I;  5M5V A;  5M61 A;  1C9I A;  1BPO A;  5M5R A;  1UTC A;  1C9L A;  5M5T A;  5M5S A;  3GC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...