1B4BA

Structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
ALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Repressor
molecule keywords ARGININE REPRESSOR
publication title Structure of the arginine repressor from Bacillus stearothermophilus.
pubmed doi rcsb
total genus 22
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1b4bA00
5CJ9A 1AB4A 1BJTA 4KB4A 3FOEA 4KC6A 1DD5A 2Y3PA 4FM9A 4G0WA 2KWAA 2PHCB 2RGRA 1WQFA 1WQHA 1ZVUA 4DDQA 2XCRB 2ZFZA 3V4GA 1GE9A 3LPXA 1B4BA 1EK8A 1EH1A 3OREA 3L4KA 2XCQA 3CAGA 3MMLB 3NUHA 3LAPA 3ERED 3LAJA 3OPFA 1XXAA 4KAWX 1IS1A 4KB2A 4KDDA 4GFQA 4J3NA 5JVOA 1XXBA 3BUEA 3FHZA 3FOFA 3L4JA 4G0VA 1WIHA 4G0UA 1F9NA 1B4AA 1XXCA 3OEPA 3VA7A 3QX3A 2XCOA 1ISEA 2P5MA 1BGWA 1WQGA
chains in the Genus database with same CATH superfamily
1O27A 1USOA 1DD5A 1USMA 2R93K 4A3DK 5C3EC 3GTPA 2XCRB 4LK0A 4LK1A 3GEIA 4XSXA 2JA6C 3GTJA 3GTOK 4Y52C 1O2FB 4A3BC 2Y0SD 3GDZA 1Y1WA 3FOFA 2JA6A 4GTFA 2JA7C 4GTAA 2XCOA 2P5MA 2P8TA 1XZPA 4JK1A 1I3QC 3GTGK 1SMYA 3T02A 2GSOA 3S1NC 3K7AK 1TWHC 1TWFK 5L46A 1XZQB 1Y1WK 2RGRA 1C0AA 4FZBA 4BBRK 3OREA 4XLNA 2VUMC 1WCMC 3PO3K 3T01A 5IOQA 3L4KA 4ILDA 1XXBA 4C3HC 5IOTA 1F7VA 4BY7C 3S1MK 1ISEA 4C3IK 4GTCA 2R7ZC 2ZUFA 1WOSA 3S2DC 2GAGC 4KATA 1O24A 1JVIA 3CQZC 2E2JC 3GTQA 2R7ZA 1WQFA 3S1RK 3HOWC 3PO2K 4NOIA 5TMFA 4LQYA 3S17C 4Q5SA 3LAJA 1DCPA 3EQLA 1VGXA 3G4CA 4P5AA 4BBSC 1O2AA 1TWGC 5IORA 3GTQK 4KM9A 4BKWA 1DCOA 1PJ7A 1BGWA 1J6WA 1F7UA 3AD9C 2E2HA 1XZQA 1ZXOA 3RZOC 1TWGA 4KC6A 3A8IA 3HOXC 2NVQK 1O26A 1Y1VC 4GTDA 1EFWA 5IYBC 2ZFZA 5FLMC 3HOVC 4PABA 4A3LC 1ZQ1C 4GTBA 2E2HK 4A3EC 1IW7A 1L0WA 1IE0A 2A68A 2BE5A 3S1QK 3BP8C 1PJ6A 3S16C 4C2MK 2YU9K 3H0GC 5IYDC 5IP7C 3AH5A 4GTEA 3S2HC 4YFKA 2PMZD 5IP9K 2A69A 5M5YK 1I50K 2R93C 4OIPA 4GTLA 1O28A 4Q4ZA 1SFOK 1G51A 4A3DC 1IQ0A 4OIRA 1XXAA 3WODA 1IL2A 2E2IK 4G0VA 2B63K 3GTOC 5EGEA 1F9NA 1IBAA 4YFNA 2NVTK 3M4OK 3GTPC 3TFJA 3AD8C 2JA8K 3GTGC 2PA8D 3M3YK 3H3VL 3GTJC 5M5WK 3K7AC 1TWAK 1TWFC 3V4GA 1Y1WC 1EH1A 3GTGA 4BBRC 3GSIA 4A3KK 4QJVB 1TWFA 3PO3C 3H3VD 2NVYA 3GTOA 2Y3PA 4WILA 2NVXA 3S1MC 1AB4A 1BJTA 4C3IC 5C4XK 2WB1L 1WSVA 3HOUK 1ZVUA 1ZBSA 1JOEA 3GTMK 2NVYK 3S1RC 3PO2C 1VJEA 2NVXK 1V5VA 3OEPA 3VA7A 3HOYK 4A3GK 5FJ8K 3GTQC 2PPBA 4BXXK 3HKZL 4KN7A 1J98A 1K83A 4X6AK 2NVQC 2GSUA 3FKIK 4QJVA 1B4BA 1JQWA 3CAGA 4Y7NK 3NUHA 1EQRA 5D4DA 4KB2A 4QIWL 4J3NA 4BLAA 2W7VA 2E2HC 1K83K 3ADAC 4PAAA 4KM8A 3GEEA 3S1QC 4BLBA 1VLOA 4A93K 5C44K 1O29A 4C2MC 2YU9C 4KARA 2FQTA 1PJ5A 2JA5A 4C3JK 5C4JK 5IP9C 2YU9A 1I50C 1WOPA 2R92A 1SFOC 4A3CK 1I50A 1B4AA 1SFOA 3G4AA 5E68A 2E2IC 2JA5K 2B63C 1WQGA 5JFEA 3BP3A 3S0XA 3AD7C 3GEHA 4GZYA 2R92K 2E2IA 3M4OC 2B63A 3TFIA 4DDQA 2JA8C 2GAHC 3M3YC 2FQOA 4OINA 1TWAC 3S14K 4C45A 1IS1A 4A3KC 1INNA 4AYBL 1R9TK 1TWAA 3HOZK 4KB4A 5HL8A 4KASA 5IYCK 4G7OA 1XZPB 2EBBA 4XLPA 2O5JA 4G7ZA 3GTLK 3S15K 5C4XC 3HOUC 3LAPA 4KMAA 4MEYA 3GTKK 3GTMC 3I4NK 1HQMA 4KDDA 2NVYC 3A8JA 2RH6A 1I6HK 4A3MK 2NVXC 3I4MK 3GTMA 1TWCA 4WJ4A 3HOYC 2Y0SL 4YG2A 3RZDK 4BY1K 4GT9A 4A3GC 4A3IK 4BXXC 2V6TA 3SZZA 3DXJA 4LLGA 2O5IA 4MQ9A 4X6AC 4A3JK 2CW0A 2XCQA 1TWCK 3FKIC 4P9SA 4Y7NC 3BUEA 5M3MK 4A3FK 4KMHA 4OIOA 1WORA 2WB1D 3FKIA 3GTPK 1YCLA 2V6SA 3TTGA 1K83C 4RMFA 2JA7A 1VRQC 3N0BA 1J6XA 3GTJK 5C3EK 4XSZA 1YX2A 2KWAA 4A93C 1I3QA 5C44C 2D6FC 2JA6K 2JH3A 4KMDA 4Y52K 1TWHA 1WSRA 3JSTA 3GIRA 3HXAA 3SZYA 4A3BK 1O25A 3N0CA 4C3JC 3N3YA 5C4JC 2JA7K 3Q3QA 1WOOA 4KAWX 2VUMA 4WJ3M 1WCMA 4A3CC 3HKZD 4KN4A 1J6VA 5IOSA 1X31C 1I3QK 4LJZA 3S1NK 1TWHK 4YFXA 2JA5C 4G0WA 2A6EA 1EI6A 4LR2A 2PHCB 2ZUEA 2VUMK 3AQPA 4QIWD 2CFAB 2A6HA 1WCMK 2R92C 1GE9A 3CQZA 5M3FK 1EK8A 4KMUA 4C3HK 1KQ4A 4BY7K 3L4JA 3S14C 1UV7A 3QX3A 2R7ZK 3S2DK 3T00A 4GFQA 3CQZK 1BDFA 1R9TC 2E2JK 5CJ9A 5TMCA 3AQOA 1F93A 2NVTC 3HOZC 5TJ3A 1YNJA 1VH2A 3HOWK 1I6VA 4P5BA 3S17K 5IYCC 1R9TA 3A8KA 1WQHA 3IPJA 1Y1VA 2WAQL 3GTLC 1XPPA 3S15C 3ERED 2PMZL 4BBSK 1TWGK 3GTLA 1O2BA 5JVOA 3FHZA 4ZH4A 3TFHA 4G0UA 1XXCA 3GTKC 3I4NC 4M1XA 3RZOK 1ZYRA 2WAQD 3HOXK 1DCHA 1Y1VK 4A3MC 1I6HC 3I4MC 3GTKA 3FOEA 2CFAA 5IYBK 4FM9A 1RU0A 5FLMK 3HOVK 3H0GA 4XCHA 4O2DA 3RZDC 4A3LK 4BY1C 4A3IC 3LPXA 4LOWA 4AYBD 4A3EK 3MMLB 2R93A 3OPFA 4MEXA 5M5XK 4A3JC 2PA8L 1BS2A 1TWCC 3S16K 1WIHA 2V6UA 3H0GK 1HI9A 5EGHA 5IYDK 2GSNA 5IP7K 4G7HA 1YNNA 4AH6A 5CHPA 4OIQA 3S2HK 4A3FC
chains in the Genus database with same CATH topology
2JA7A 4BLBA 3N0BA 1O27A 3AH5A 4GTEA 1O29A 4C2MC 1DD5A 4KARA 2KWAA 1I3QA 3GTPA 2XCRB 2JH3A 2JA5A 4GTLA 4KMDA 1O28A 1TWHA 2YU9A 1O25A 3N0CA 4C3JC 3N3YA 3GTJA 2R92A 1XXAA 3Q3QA 4KAWX 1Y1WA 2VUMA 3FOFA 2JA6A 4G0VA 1I50A 1WCMA 4GTFA 5EGEA 4GTAA 1F9NA 1B4AA 5IOSA 2XCOA 2P5MA 3G4AA 1SFOA 1WQGA 5JFEA 3S0XA 2GSOA 4G0WA 2E2IA 4LR2A 2PHCB 2B63A 2RGRA 3AQPA 2CFAB 4FZBA 4DDQA 3V4GA 1GE9A 3CQZA 3OREA 1EK8A 1EH1A 3GTGA 1KQ4A 5IOQA 1TWFA 1IS1A 3L4KA 3L4JA 4ILDA 1XXBA 4C3HC 5IOTA 3QX3A 1TWAA 1ISEA 2NVYA 4GFQA 2Y3PA 4GTCA 5CJ9A 2NVXA 1AB4A 1BJTA 3AQOA 4KB4A 4KASA 4KATA 1O24A 5TJ3A 4C3IC 4P5BA 3GTQA 2R7ZA 1WQFA 1R9TA 1WQHA 1ZVUA 1ZBSA 1Y1VA 4LQYA 3LAPA 3ERED 3LAJA 4KMAA 3GTLA 1O2BA 4KDDA 5JVOA 3FHZA 3G4CA 4P5AA 2RH6A 4G0UA 1XXCA 1O2AA 3OEPA 5IORA 4M1XA 3VA7A 4KM9A 4BKWA 3GTMA 1BGWA 1TWCA 2E2HA 1ZXOA 3GTKA 3FOEA 2CFAA 1TWGA 4KC6A 4FM9A 1O26A 4GT9A 4GTDA 3H0GA 1K83A 2ZFZA 2GSUA 3LPXA 1B4BA 2XCQA 3CAGA 3MMLB 3NUHA 2R93A 3OPFA 4GTBA 4KB2A 4J3NA 4BLAA 3BUEA 1WIHA 4KMHA 5EGHA 3FKIA 2GSNA 5CHPA 4KM8A 3GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CJ9 A;  1AB4 A;  1BJT A;  4KB4 A;  3FOE A;  4KC6 A;  1DD5 A;  2Y3P A;  4FM9 A;  4G0W A;  2KWA A;  2PHC B;  2RGR A;  1WQF A;  1WQH A;  1ZVU A;  4DDQ A;  2XCR B;  2ZFZ A;  3V4G A;  1GE9 A;  3LPX A;  1B4B A;  1EK8 A;  1EH1 A;  3ORE A;  3L4K A;  2XCQ A;  3CAG A;  3MML B;  3NUH A;  3LAP A;  3ERE D;  3LAJ A;  3OPF A;  1XXA A;  4KAW X;  1IS1 A;  4KB2 A;  4KDD A;  4GFQ A;  4J3N A;  5JVO A;  1XXB A;  3BUE A;  3FHZ A;  3FOF A;  3L4J A;  4G0V A;  1WIH A;  4G0U A;  1F9N A;  1B4A A;  1XXC A;  3OEP A;  3VA7 A;  3QX3 A;  2XCO A;  1ISE A;  2P5M A;  1BGW A;  1WQG A; 
#chains in the Genus database with same CATH topology
 1O27 A;  1USO A;  1DD5 A;  1USM A;  2R93 K;  4A3D K;  5C3E C;  3GTP A;  2XCR B;  4LK0 A;  4LK1 A;  3GEI A;  4XSX A;  2JA6 C;  3GTJ A;  3GTO K;  4Y52 C;  1O2F B;  4A3B C;  2Y0S D;  3GDZ A;  1Y1W A;  3FOF A;  2JA6 A;  4GTF A;  2JA7 C;  4GTA A;  2XCO A;  2P5M A;  2P8T A;  1XZP A;  4JK1 A;  1I3Q C;  3GTG K;  1SMY A;  3T02 A;  2GSO A;  3S1N C;  3K7A K;  1TWH C;  1TWF K;  5L46 A;  1XZQ B;  1Y1W K;  2RGR A;  1C0A A;  4FZB A;  4BBR K;  3ORE A;  4XLN A;  2VUM C;  1WCM C;  3PO3 K;  3T01 A;  5IOQ A;  3L4K A;  4ILD A;  1XXB A;  4C3H C;  5IOT A;  1F7V A;  4BY7 C;  3S1M K;  1ISE A;  4C3I K;  4GTC A;  2R7Z C;  2ZUF A;  1WOS A;  3S2D C;  2GAG C;  4KAT A;  1O24 A;  1JVI A;  3CQZ C;  2E2J C;  3GTQ A;  2R7Z A;  1WQF A;  3S1R K;  3HOW C;  3PO2 K;  4NOI A;  5TMF A;  4LQY A;  3S17 C;  4Q5S A;  3LAJ A;  1DCP A;  3EQL A;  1VGX A;  3G4C A;  4P5A A;  4BBS C;  1O2A A;  1TWG C;  5IOR A;  3GTQ K;  4KM9 A;  4BKW A;  1DCO A;  1PJ7 A;  1BGW A;  1J6W A;  1F7U A;  3AD9 C;  2E2H A;  1XZQ A;  1ZXO A;  3RZO C;  1TWG A;  4KC6 A;  3A8I A;  3HOX C;  2NVQ K;  1O26 A;  1Y1V C;  4GTD A;  1EFW A;  5IYB C;  2ZFZ A;  5FLM C;  3HOV C;  4PAB A;  4A3L C;  1ZQ1 C;  4GTB A;  2E2H K;  4A3E C;  1IW7 A;  1L0W A;  1IE0 A;  2A68 A;  2BE5 A;  3S1Q K;  3BP8 C;  1PJ6 A;  3S16 C;  4C2M K;  2YU9 K;  3H0G C;  5IYD C;  5IP7 C;  3AH5 A;  4GTE A;  3S2H C;  4YFK A;  2PMZ D;  5IP9 K;  2A69 A;  5M5Y K;  1I50 K;  2R93 C;  4OIP A;  4GTL A;  1O28 A;  4Q4Z A;  1SFO K;  1G51 A;  4A3D C;  1IQ0 A;  4OIR A;  1XXA A;  3WOD A;  1IL2 A;  2E2I K;  4G0V A;  2B63 K;  3GTO C;  5EGE A;  1F9N A;  1IBA A;  4YFN A;  2NVT K;  3M4O K;  3GTP C;  3TFJ A;  3AD8 C;  2JA8 K;  3GTG C;  2PA8 D;  3M3Y K;  3H3V L;  3GTJ C;  5M5W K;  3K7A C;  1TWA K;  1TWF C;  3V4G A;  1Y1W C;  1EH1 A;  3GTG A;  4BBR C;  3GSI A;  4A3K K;  4QJV B;  1TWF A;  3PO3 C;  3H3V D;  2NVY A;  3GTO A;  2Y3P A;  4WIL A;  2NVX A;  3S1M C;  1AB4 A;  1BJT A;  4C3I C;  5C4X K;  2WB1 L;  1WSV A;  3HOU K;  1ZVU A;  1ZBS A;  1JOE A;  3GTM K;  2NVY K;  3S1R C;  3PO2 C;  1VJE A;  2NVX K;  1V5V A;  3OEP A;  3VA7 A;  3HOY K;  4A3G K;  5FJ8 K;  3GTQ C;  2PPB A;  4BXX K;  3HKZ L;  4KN7 A;  1J98 A;  1K83 A;  4X6A K;  2NVQ C;  2GSU A;  3FKI K;  4QJV A;  1B4B A;  1JQW A;  3CAG A;  4Y7N K;  3NUH A;  1EQR A;  5D4D A;  4KB2 A;  4QIW L;  4J3N A;  4BLA A;  2W7V A;  2E2H C;  1K83 K;  3ADA C;  4PAA A;  4KM8 A;  3GEE A;  3S1Q C;  4BLB A;  1VLO A;  4A93 K;  5C44 K;  1O29 A;  4C2M C;  2YU9 C;  4KAR A;  2FQT A;  1PJ5 A;  2JA5 A;  4C3J K;  5C4J K;  5IP9 C;  2YU9 A;  1I50 C;  1WOP A;  2R92 A;  1SFO C;  4A3C K;  1I50 A;  1B4A A;  1SFO A;  3G4A A;  5E68 A;  2E2I C;  2JA5 K;  2B63 C;  1WQG A;  5JFE A;  3BP3 A;  3S0X A;  3AD7 C;  3GEH A;  4GZY A;  2R92 K;  2E2I A;  3M4O C;  2B63 A;  3TFI A;  4DDQ A;  2JA8 C;  2GAH C;  3M3Y C;  2FQO A;  4OIN A;  1TWA C;  3S14 K;  4C45 A;  1IS1 A;  4A3K C;  1INN A;  4AYB L;  1R9T K;  1TWA A;  3HOZ K;  4KB4 A;  5HL8 A;  4KAS A;  5IYC K;  4G7O A;  1XZP B;  2EBB A;  4XLP A;  2O5J A;  4G7Z A;  3GTL K;  3S15 K;  5C4X C;  3HOU C;  3LAP A;  4KMA A;  4MEY A;  3GTK K;  3GTM C;  3I4N K;  1HQM A;  4KDD A;  2NVY C;  3A8J A;  2RH6 A;  1I6H K;  4A3M K;  2NVX C;  3I4M K;  3GTM A;  1TWC A;  4WJ4 A;  3HOY C;  2Y0S L;  4YG2 A;  3RZD K;  4BY1 K;  4GT9 A;  4A3G C;  4A3I K;  4BXX C;  2V6T A;  3SZZ A;  3DXJ A;  4LLG A;  2O5I A;  4MQ9 A;  4X6A C;  4A3J K;  2CW0 A;  2XCQ A;  1TWC K;  3FKI C;  4P9S A;  4Y7N C;  3BUE A;  5M3M K;  4A3F K;  4KMH A;  4OIO A;  1WOR A;  2WB1 D;  3FKI A;  3GTP K;  1YCL A;  2V6S A;  3TTG A;  1K83 C;  4RMF A;  2JA7 A;  1VRQ C;  3N0B A;  1J6X A;  3GTJ K;  5C3E K;  4XSZ A;  1YX2 A;  2KWA A;  4A93 C;  1I3Q A;  5C44 C;  2D6F C;  2JA6 K;  2JH3 A;  4KMD A;  4Y52 K;  1TWH A;  1WSR A;  3JST A;  3GIR A;  3HXA A;  3SZY A;  4A3B K;  1O25 A;  3N0C A;  4C3J C;  3N3Y A;  5C4J C;  2JA7 K;  3Q3Q A;  1WOO A;  4KAW X;  2VUM A;  4WJ3 M;  1WCM A;  4A3C C;  3HKZ D;  4KN4 A;  1J6V A;  5IOS A;  1X31 C;  1I3Q K;  4LJZ A;  3S1N K;  1TWH K;  4YFX A;  2JA5 C;  4G0W A;  2A6E A;  1EI6 A;  4LR2 A;  2PHC B;  2ZUE A;  2VUM K;  3AQP A;  4QIW D;  2CFA B;  2A6H A;  1WCM K;  2R92 C;  1GE9 A;  3CQZ A;  5M3F K;  1EK8 A;  4KMU A;  4C3H K;  1KQ4 A;  4BY7 K;  3L4J A;  3S14 C;  1UV7 A;  3QX3 A;  2R7Z K;  3S2D K;  3T00 A;  4GFQ A;  3CQZ K;  1BDF A;  1R9T C;  2E2J K;  5CJ9 A;  5TMC A;  3AQO A;  1F93 A;  2NVT C;  3HOZ C;  5TJ3 A;  1YNJ A;  1VH2 A;  3HOW K;  1I6V A;  4P5B A;  3S17 K;  5IYC C;  1R9T A;  3A8K A;  1WQH A;  3IPJ A;  1Y1V A;  2WAQ L;  3GTL C;  1XPP A;  3S15 C;  3ERE D;  2PMZ L;  4BBS K;  1TWG K;  3GTL A;  1O2B A;  5JVO A;  3FHZ A;  4ZH4 A;  3TFH A;  4G0U A;  1XXC A;  3GTK C;  3I4N C;  4M1X A;  3RZO K;  1ZYR A;  2WAQ D;  3HOX K;  1DCH A;  1Y1V K;  4A3M C;  1I6H C;  3I4M C;  3GTK A;  3FOE A;  2CFA A;  5IYB K;  4FM9 A;  1RU0 A;  5FLM K;  3HOV K;  3H0G A;  4XCH A;  4O2D A;  3RZD C;  4A3L K;  4BY1 C;  4A3I C;  3LPX A;  4LOW A;  4AYB D;  4A3E K;  3MML B;  2R93 A;  3OPF A;  4MEX A;  5M5X K;  4A3J C;  2PA8 L;  1BS2 A;  1TWC C;  3S16 K;  1WIH A;  2V6U A;  3H0G K;  1HI9 A;  5EGH A;  5IYD K;  2GSN A;  5IP7 K;  4G7H A;  1YNN A;  4AH6 A;  5CHP A;  4OIQ A;  3S2H K;  4A3F C; 
#chains in the Genus database with same CATH homology
 2JA7 A;  4BLB A;  3N0B A;  1O27 A;  3AH5 A;  4GTE A;  1O29 A;  4C2M C;  1DD5 A;  4KAR A;  2KWA A;  1I3Q A;  3GTP A;  2XCR B;  2JH3 A;  2JA5 A;  4GTL A;  4KMD A;  1O28 A;  1TWH A;  2YU9 A;  1O25 A;  3N0C A;  4C3J C;  3N3Y A;  3GTJ A;  2R92 A;  1XXA A;  3Q3Q A;  4KAW X;  1Y1W A;  2VUM A;  3FOF A;  2JA6 A;  4G0V A;  1I50 A;  1WCM A;  4GTF A;  5EGE A;  4GTA A;  1F9N A;  1B4A A;  5IOS A;  2XCO A;  2P5M A;  3G4A A;  1SFO A;  1WQG A;  5JFE A;  3S0X A;  2GSO A;  4G0W A;  2E2I A;  4LR2 A;  2PHC B;  2B63 A;  2RGR A;  3AQP A;  2CFA B;  4FZB A;  4DDQ A;  3V4G A;  1GE9 A;  3CQZ A;  3ORE A;  1EK8 A;  1EH1 A;  3GTG A;  1KQ4 A;  5IOQ A;  1TWF A;  1IS1 A;  3L4K A;  3L4J A;  4ILD A;  1XXB A;  4C3H C;  5IOT A;  3QX3 A;  1TWA A;  1ISE A;  2NVY A;  4GFQ A;  2Y3P A;  4GTC A;  5CJ9 A;  2NVX A;  1AB4 A;  1BJT A;  3AQO A;  4KB4 A;  4KAS A;  4KAT A;  1O24 A;  5TJ3 A;  4C3I C;  4P5B A;  3GTQ A;  2R7Z A;  1WQF A;  1R9T A;  1WQH A;  1ZVU A;  1ZBS A;  1Y1V A;  4LQY A;  3LAP A;  3ERE D;  3LAJ A;  4KMA A;  3GTL A;  1O2B A;  4KDD A;  5JVO A;  3FHZ A;  3G4C A;  4P5A A;  2RH6 A;  4G0U A;  1XXC A;  1O2A A;  3OEP A;  5IOR A;  4M1X A;  3VA7 A;  4KM9 A;  4BKW A;  3GTM A;  1BGW A;  1TWC A;  2E2H A;  1ZXO A;  3GTK A;  3FOE A;  2CFA A;  1TWG A;  4KC6 A;  4FM9 A;  1O26 A;  4GT9 A;  4GTD A;  3H0G A;  1K83 A;  2ZFZ A;  2GSU A;  3LPX A;  1B4B A;  2XCQ A;  3CAG A;  3MML B;  3NUH A;  2R93 A;  3OPF A;  4GTB A;  4KB2 A;  4J3N A;  4BLA A;  3BUE A;  1WIH A;  4KMH A;  5EGH A;  3FKI A;  2GSN A;  5CHP A;  4KM8 A;  3GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...