1B4BA

Structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
71
structure length
71
Chain Sequence
ALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKKVSNQLLSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ARGININE REPRESSOR
publication title Structure of the arginine repressor from Bacillus stearothermophilus.
pubmed doi rcsb
molecule tags Repressor
total genus 22
structure length 71
sequence length 71
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1998-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1b4bA00
3LAJA 4G0WA 2XCRB 2KWAA 3FOEA 4KC6A 3LPXA 2ZFZA 3LAPA 1AB4A 3V4GA 3OEPA 1DD5A 2XCQA 4KB2A 1WQGA 4KAWX 1WQHA 4KDDA 4G0UA 1WQFA 3ERED 4FM9A 1BGWA 1EH1A 1IS1A 1XXBA 1XXAA 3CAGA 3BUEA 4G0VA 1GE9A 3FOFA 1WIHA 3L4JA 1ZVUA 2PHCB 3QX3A 3VA7A 1B4BA 4KB4A 1ISEA 5CJ9A 2Y3PA 1F9NA 2RGRA 3OREA 3NUHA 3FHZA 3L4KA 1B4AA 2P5MA 4GFQA 4DDQA 1BJTA 5JVOA 3MMLB 4J3NA 1EK8A 3OPFA 2XCOA 1XXCA
chains in the Genus database with same CATH superfamily
3M3YC 1ZYRA 3V4GA 5TMCA 4G7ZA 1XZPA 1J6VA 1ZBSA 4A3FC 1TWGC 5M5XK 1GE9A 5HL8A 1INNA 1JVIA 5JFEA 1Y1WK 2GAGC 3BP3A 4Y7NK 2E2HA 1TWAC 4A3KC 3HXAA 4A3DC 5TMFA 4GTFA 1IW7A 3BP8C 4G7OA 2RH6A 2R7ZA 4P9SA 1SFOK 2CFAB 1K83A 3N0CA 2YU9C 5C44C 4LOWA 4MQ9A 1Y1VA 4LR2A 1Y1WC 1I50C 4BLAA 1DD5A 4X6AK 2EBBA 4ILDA 3S1MK 1XXAA 1VLOA 1O28A 3FOFA 2WB1L 3S2HK 1ISEA 4XSZA 2Y3PA 3GTQA 3S1RK 5IYCK 1TWFA 1WOSA 4PAAA 4OINA 4KMHA 4LK1A 3AD7C 5JVOA 2E2HK 1J98A 3AD9C 4X6AC 3T02A 3S1MC 4LQYA 5IYDK 3OEPA 4GZYA 4BKWA 1WQGA 1YX2A 1R9TA 2R7ZK 4A3LK 4A3BK 4KMDA 3EQLA 3S1RC 1K83K 5IYCC 5L46A 3QX3A 1WSVA 1Y1VK 1DCPA 1WOOA 2D6FC 5IP7K 2E2HC 2WB1D 3L4KA 5M3MK 4A3EK 1BJTA 1L0WA 3HOVC 2PMZL 3OPFA 4LLGA 4WILA 4XLPA 2R7ZC 4A3LC 3GTQK 4A3BC 3FOEA 3GSIA 1K83C 1TWFK 1AB4A 3A8KA 2PPBA 4KB2A 3HOZK 2O5JA 1BS2A 1G51A 3N3YA 1ZVUA 3S14K 1TWAA 1WORA 4A3EC 4WJ3M 3FHZA 1R9TK 5EGHA 3PO3K 4MEYA 3AH5A 1TWFC 4OIRA 1SMYA 1JQWA 2YU9A 2PMZD 1XZQA 3SZZA 3HOZC 4KM9A 1I50A 4GTAA 3PO2K 3S1NK 2JA8C 2B63C 1R9TC 3M3YK 4BXXK 3PO3C 2NVTK 1BDFA 1O2FB 5C4XC 4GTLA 3ADAC 4A3FK 3S2DC 4P5AA 3GTOA 1TWHA 4KN7A 4J3NA 5CHPA 1TWCC 1TWAK 1VRQC 2Y0SL 1O29A 1J6WA 2NVXA 3TFJA 1EI6A 3PO2C 4A3MK 3M4OK 3S1NC 1XZQB 2WAQL 4GTEA 3LAPA 4A3GK 4BXXC 2NVTC 3HOYC 1KQ4A 3A8JA 2YU9K 5C44K 4G0VA 5FJ8K 3GTKA 1I50K 4ZH4A 4KB4A 5CJ9A 1J6XA 1F7VA 3DXJA 1YCLA 4A3MC 5IOSA 3M4OC 4Y52K 4A3GC 3JSTA 4GT9A 3GTLA 2Y0SD 5C3EK 3GTOK 1ZQ1C 1TWHK 3GTPA 2XCQA 3H0GA 2WAQD 4G0UA 3GEIA 2NVXK 1XZPB 3G4AA 3CQZA 1IBAA 4Y52C 3TFHA 1B4AA 4GFQA 3I4MK 4KM8A 5C3EC 3GTOC 1TWHC 1V5VA 3GTKK 4KN4A 1I6HK 4RMFA 4MEXA 2NVXC 4XLNA 3HOVK 4A3JK 4C2MC 3GEHA 1VGXA 1EQRA 2FQOA 2B63A 5D4DA 3GTGA 4A3IC 3GTLK 3I4MC 4A3CC 3GTPK 2V6SA 3GTKC 1F9NA 1O24A 1DCOA 3H0GK 5IP9K 1I6HC 2GSUA 5M5YK 1DCHA 1TWCA 3Q3QA 1EK8A 2O5IA 4A3JC 3AQPA 3CQZK 1USMA 3LAJA 1RU0A 4P5BA 1EFWA 2R92C 2GSOA 2NVYA 3GTLC 3FKIC 3HOWC 1I6VA 4KDDA 3GTPC 4Q5SA 1EH1A 1IE0A 4BBSC 3T01A 5IP9C 3H0GC 3BUEA 4YFKA 4BY7K 1USOA 4O2DA 2JA7A 4GTCA 1WOPA 1IL2A 1PJ5A 3AD8C 4C3HC 2JA8K 3CQZC 2B63K 2V6UA 5IORA 3GDZA 3GEEA 3GTGK 3MMLB 2GAHC 5C4XK 3S2DK 4BY7C 3WODA 2R93A 2VUMC 1TWCK 1XPPA 1WQFA 1JOEA 3HKZL 1WIHA 1PJ6A 2PHCB 2NVYK 4A93K 1B4BA 3GTGC 3HOYK 2PA8L 4M1XA 3A8IA 2JA5A 4QJVA 4LK0A 5TJ3A 4C3IK 4XCHA 2GSNA 4AH6A 3HOXK 2JA7K 2XCRB 2JH3A 3RZDK 5M3FK 2A68A 2E2IA 4QIWL 2NVYC 4KASA 1WCMA 4FZBA 4KAWX 3S1QC 4A93C 1F7UA 3S15K 3CAGA 3VA7A 3HKZD 1I3QA 2ZUEA 1O25A 2R93K 4C3IC 3OREA 3HOXC 2JA7C 2PA8D 4GTDA 5E68A 3GTMA 2CFAA 3RZDC 1PJ7A 4PABA 2R92A 2A6EA 4G0WA 4KMUA 2JA5K 3SZYA 2NVQK 5FLMK 3S15C 1VJEA 3FKIA 3LPXA 1O26A 1UV7A 3TTGA 2E2JK 4FM9A 2R93C 3N0BA 4QIWD 4WJ4A 1ZXOA 3GTJA 2E2IK 1WSRA 4C2MK 3RZOK 2RGRA 4OIQA 1WCMK 1HQMA 2P5MA 4KATA 4A3IK 3I4NK 2JA5C 2NVQC 5FLMC 4A3CK 1I3QK 2XCOA 1XXCA 2E2JC 3G4CA 2VUMA 2ZFZA 3GTMK 4Y7NC 2V6TA 2CW0A 5C4JK 3GIRA 2E2IC 1WQHA 4Q4ZA 3ERED 3RZOC 2R92K 1WCMC 1YNNA 4BY1K 1O2BA 2JA6A 5IYBK 3I4NC 3FKIK 1SFOC 3HOWK 4OIOA 1I3QC 4BBSK 1O2AA 3H3VL 3GTJK 3GTMC 5C4JC 4C3HK 4GTBA 4KC6A 4KMAA 2P8TA 1O27A 4BY1C 2FQTA 4NOIA 4XSXA 5IYBC 3S17K 3S2HC 4KARA 4JK1A 2A69A 1IQ0A 4YFXA 2VUMK 3GTJC 5EGEA 3HOUK 1X31C 5M5WK 5IYDC 3TFIA 2JA6K 3H3VD 3S17C 4BBRK 2KWAA 1C0AA 1Y1VC 1TWGA 4BLBA 3K7AK 3IPJA 5IP7C 1BGWA 1YNJA 3HOUC 4AYBL 3S16K 3T00A 2JA6C 3S1QK 2ZUFA 2W7VA 4LJZA 1F93A 3GTQC 4BBRC 4DDQA 3K7AC 1Y1WA 1HI9A 3S14C 3S0XA 3S16C 4C3JK 4OIPA 4G7HA 1IS1A 1XXBA 1VH2A 3L4JA 2A6HA 3AQOA 1SFOA 5IOTA 2BE5A 4YG2A 1TWGK 4AYBD 5IOQA 4C45A 3NUHA 4QJVB 4A3KK 4A3DK 4YFNA 4C3JC
chains in the Genus database with same CATH topology
3LAJA 4P5BA 2GSOA 3G4CA 2NVYA 4KM9A 1I50A 2VUMA 2ZFZA 3V4GA 4GTAA 1WQHA 1ZBSA 4KDDA 3ERED 1EH1A 1GE9A 3BUEA 1O2BA 5JFEA 2JA6A 2E2HA 4GTLA 2JA7A 4GTCA 4C3HC 4GTFA 4P5AA 3GTOA 1TWHA 5IORA 1O2AA 3MMLB 4J3NA 2RH6A 2R7ZA 5CHPA 2CFAB 1O29A 1K83A 2NVXA 3N0CA 4GTBA 1Y1VA 4KC6A 4KMAA 4LR2A 1O27A 4GTEA 3LAPA 2R93A 4BLAA 1DD5A 1WQFA 1KQ4A 4KARA 4ILDA 1XXAA 4G0VA 1O28A 3FOFA 1WIHA 2PHCB 3GTKA 1B4BA 4KB4A 1ISEA 5CJ9A 2Y3PA 4M1XA 5EGEA 3GTQA 2JA5A 1TWFA 5TJ3A 4KMHA 5IOSA 5JVOA 2GSNA 4GT9A 2XCRB 2KWAA 2JH3A 3GTLA 2E2IA 4LQYA 3GTPA 1TWGA 3OEPA 4BLBA 4BKWA 2XCQA 1WCMA 1WQGA 3H0GA 4FZBA 4KAWX 4KASA 1R9TA 4G0UA 1BGWA 4KMDA 3CAGA 3G4AA 3QX3A 3VA7A 1I3QA 1O25A 3CQZA 4C3IC 3OREA 3L4KA 4GTDA 3GTMA 1B4AA 4GFQA 2CFAA 4DDQA 1BJTA 4KM8A 3OPFA 2R92A 1Y1WA 4G0WA 3FOEA 3FKIA 3LPXA 1O26A 1AB4A 3S0XA 4C2MC 4KB2A 2B63A 4FM9A 3N0BA 1IS1A 1XXBA 3N3YA 3GTGA 3L4JA 1ZXOA 1ZVUA 3AQOA 3GTJA 1TWAA 1SFOA 5IOTA 5IOQA 1F9NA 2RGRA 1O24A 3NUHA 3FHZA 5EGHA 2GSUA 2P5MA 4KATA 1TWCA 3AH5A 3Q3QA 1EK8A 3AQPA 2XCOA 2YU9A 1XXCA 4C3JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAJ A;  4G0W A;  2XCR B;  2KWA A;  3FOE A;  4KC6 A;  3LPX A;  2ZFZ A;  3LAP A;  1AB4 A;  3V4G A;  3OEP A;  1DD5 A;  2XCQ A;  4KB2 A;  1WQG A;  4KAW X;  1WQH A;  4KDD A;  4G0U A;  1WQF A;  3ERE D;  4FM9 A;  1BGW A;  1EH1 A;  1IS1 A;  1XXB A;  1XXA A;  3CAG A;  3BUE A;  4G0V A;  1GE9 A;  3FOF A;  1WIH A;  3L4J A;  1ZVU A;  2PHC B;  3QX3 A;  3VA7 A;  1B4B A;  4KB4 A;  1ISE A;  5CJ9 A;  2Y3P A;  1F9N A;  2RGR A;  3ORE A;  3NUH A;  3FHZ A;  3L4K A;  1B4A A;  2P5M A;  4GFQ A;  4DDQ A;  1BJT A;  5JVO A;  3MML B;  4J3N A;  1EK8 A;  3OPF A;  2XCO A;  1XXC A; 
#chains in the Genus database with same CATH topology
 3M3Y C;  1ZYR A;  3V4G A;  5TMC A;  4G7Z A;  1XZP A;  1J6V A;  1ZBS A;  4A3F C;  1TWG C;  5M5X K;  1GE9 A;  5HL8 A;  1INN A;  1JVI A;  5JFE A;  1Y1W K;  2GAG C;  3BP3 A;  4Y7N K;  2E2H A;  1TWA C;  4A3K C;  3HXA A;  4A3D C;  5TMF A;  4GTF A;  1IW7 A;  3BP8 C;  4G7O A;  2RH6 A;  2R7Z A;  4P9S A;  1SFO K;  2CFA B;  1K83 A;  3N0C A;  2YU9 C;  5C44 C;  4LOW A;  4MQ9 A;  1Y1V A;  4LR2 A;  1Y1W C;  1I50 C;  4BLA A;  1DD5 A;  4X6A K;  2EBB A;  4ILD A;  3S1M K;  1XXA A;  1VLO A;  1O28 A;  3FOF A;  2WB1 L;  3S2H K;  1ISE A;  4XSZ A;  2Y3P A;  3GTQ A;  3S1R K;  5IYC K;  1TWF A;  1WOS A;  4PAA A;  4OIN A;  4KMH A;  4LK1 A;  3AD7 C;  5JVO A;  2E2H K;  1J98 A;  3AD9 C;  4X6A C;  3T02 A;  3S1M C;  4LQY A;  5IYD K;  3OEP A;  4GZY A;  4BKW A;  1WQG A;  1YX2 A;  1R9T A;  2R7Z K;  4A3L K;  4A3B K;  4KMD A;  3EQL A;  3S1R C;  1K83 K;  5IYC C;  5L46 A;  3QX3 A;  1WSV A;  1Y1V K;  1DCP A;  1WOO A;  2D6F C;  5IP7 K;  2E2H C;  2WB1 D;  3L4K A;  5M3M K;  4A3E K;  1BJT A;  1L0W A;  3HOV C;  2PMZ L;  3OPF A;  4LLG A;  4WIL A;  4XLP A;  2R7Z C;  4A3L C;  3GTQ K;  4A3B C;  3FOE A;  3GSI A;  1K83 C;  1TWF K;  1AB4 A;  3A8K A;  2PPB A;  4KB2 A;  3HOZ K;  2O5J A;  1BS2 A;  1G51 A;  3N3Y A;  1ZVU A;  3S14 K;  1TWA A;  1WOR A;  4A3E C;  4WJ3 M;  3FHZ A;  1R9T K;  5EGH A;  3PO3 K;  4MEY A;  3AH5 A;  1TWF C;  4OIR A;  1SMY A;  1JQW A;  2YU9 A;  2PMZ D;  1XZQ A;  3SZZ A;  3HOZ C;  4KM9 A;  1I50 A;  4GTA A;  3PO2 K;  3S1N K;  2JA8 C;  2B63 C;  1R9T C;  3M3Y K;  4BXX K;  3PO3 C;  2NVT K;  1BDF A;  1O2F B;  5C4X C;  4GTL A;  3ADA C;  4A3F K;  3S2D C;  4P5A A;  3GTO A;  1TWH A;  4KN7 A;  4J3N A;  5CHP A;  1TWC C;  1TWA K;  1VRQ C;  2Y0S L;  1O29 A;  1J6W A;  2NVX A;  3TFJ A;  1EI6 A;  3PO2 C;  4A3M K;  3M4O K;  3S1N C;  1XZQ B;  2WAQ L;  4GTE A;  3LAP A;  4A3G K;  4BXX C;  2NVT C;  3HOY C;  1KQ4 A;  3A8J A;  2YU9 K;  5C44 K;  4G0V A;  5FJ8 K;  3GTK A;  1I50 K;  4ZH4 A;  4KB4 A;  5CJ9 A;  1J6X A;  1F7V A;  3DXJ A;  1YCL A;  4A3M C;  5IOS A;  3M4O C;  4Y52 K;  4A3G C;  3JST A;  4GT9 A;  3GTL A;  2Y0S D;  5C3E K;  3GTO K;  1ZQ1 C;  1TWH K;  3GTP A;  2XCQ A;  3H0G A;  2WAQ D;  4G0U A;  3GEI A;  2NVX K;  1XZP B;  3G4A A;  3CQZ A;  1IBA A;  4Y52 C;  3TFH A;  1B4A A;  4GFQ A;  3I4M K;  4KM8 A;  5C3E C;  3GTO C;  1TWH C;  1V5V A;  3GTK K;  4KN4 A;  1I6H K;  4RMF A;  4MEX A;  2NVX C;  4XLN A;  3HOV K;  4A3J K;  4C2M C;  3GEH A;  1VGX A;  1EQR A;  2FQO A;  2B63 A;  5D4D A;  3GTG A;  4A3I C;  3GTL K;  3I4M C;  4A3C C;  3GTP K;  2V6S A;  3GTK C;  1F9N A;  1O24 A;  1DCO A;  3H0G K;  5IP9 K;  1I6H C;  2GSU A;  5M5Y K;  1DCH A;  1TWC A;  3Q3Q A;  1EK8 A;  2O5I A;  4A3J C;  3AQP A;  3CQZ K;  1USM A;  3LAJ A;  1RU0 A;  4P5B A;  1EFW A;  2R92 C;  2GSO A;  2NVY A;  3GTL C;  3FKI C;  3HOW C;  1I6V A;  4KDD A;  3GTP C;  4Q5S A;  1EH1 A;  1IE0 A;  4BBS C;  3T01 A;  5IP9 C;  3H0G C;  3BUE A;  4YFK A;  4BY7 K;  1USO A;  4O2D A;  2JA7 A;  4GTC A;  1WOP A;  1IL2 A;  1PJ5 A;  3AD8 C;  4C3H C;  2JA8 K;  3CQZ C;  2B63 K;  2V6U A;  5IOR A;  3GDZ A;  3GEE A;  3GTG K;  3MML B;  2GAH C;  5C4X K;  3S2D K;  4BY7 C;  3WOD A;  2R93 A;  2VUM C;  1TWC K;  1XPP A;  1WQF A;  1JOE A;  3HKZ L;  1WIH A;  1PJ6 A;  2PHC B;  2NVY K;  4A93 K;  1B4B A;  3GTG C;  3HOY K;  2PA8 L;  4M1X A;  3A8I A;  2JA5 A;  4QJV A;  4LK0 A;  5TJ3 A;  4C3I K;  4XCH A;  2GSN A;  4AH6 A;  3HOX K;  2JA7 K;  2XCR B;  2JH3 A;  3RZD K;  5M3F K;  2A68 A;  2E2I A;  4QIW L;  2NVY C;  4KAS A;  1WCM A;  4FZB A;  4KAW X;  3S1Q C;  4A93 C;  1F7U A;  3S15 K;  3CAG A;  3VA7 A;  3HKZ D;  1I3Q A;  2ZUE A;  1O25 A;  2R93 K;  4C3I C;  3ORE A;  3HOX C;  2JA7 C;  2PA8 D;  4GTD A;  5E68 A;  3GTM A;  2CFA A;  3RZD C;  1PJ7 A;  4PAB A;  2R92 A;  2A6E A;  4G0W A;  4KMU A;  2JA5 K;  3SZY A;  2NVQ K;  5FLM K;  3S15 C;  1VJE A;  3FKI A;  3LPX A;  1O26 A;  1UV7 A;  3TTG A;  2E2J K;  4FM9 A;  2R93 C;  3N0B A;  4QIW D;  4WJ4 A;  1ZXO A;  3GTJ A;  2E2I K;  1WSR A;  4C2M K;  3RZO K;  2RGR A;  4OIQ A;  1WCM K;  1HQM A;  2P5M A;  4KAT A;  4A3I K;  3I4N K;  2JA5 C;  2NVQ C;  5FLM C;  4A3C K;  1I3Q K;  2XCO A;  1XXC A;  2E2J C;  3G4C A;  2VUM A;  2ZFZ A;  3GTM K;  4Y7N C;  2V6T A;  2CW0 A;  5C4J K;  3GIR A;  2E2I C;  1WQH A;  4Q4Z A;  3ERE D;  3RZO C;  2R92 K;  1WCM C;  1YNN A;  4BY1 K;  1O2B A;  2JA6 A;  5IYB K;  3I4N C;  3FKI K;  1SFO C;  3HOW K;  4OIO A;  1I3Q C;  4BBS K;  1O2A A;  3H3V L;  3GTJ K;  3GTM C;  5C4J C;  4C3H K;  4GTB A;  4KC6 A;  4KMA A;  2P8T A;  1O27 A;  4BY1 C;  2FQT A;  4NOI A;  4XSX A;  5IYB C;  3S17 K;  3S2H C;  4KAR A;  4JK1 A;  2A69 A;  1IQ0 A;  4YFX A;  2VUM K;  3GTJ C;  5EGE A;  3HOU K;  1X31 C;  5M5W K;  5IYD C;  3TFI A;  2JA6 K;  3H3V D;  3S17 C;  4BBR K;  2KWA A;  1C0A A;  1Y1V C;  1TWG A;  4BLB A;  3K7A K;  3IPJ A;  5IP7 C;  1BGW A;  1YNJ A;  3HOU C;  4AYB L;  3S16 K;  3T00 A;  2JA6 C;  3S1Q K;  2ZUF A;  2W7V A;  4LJZ A;  1F93 A;  3GTQ C;  4BBR C;  4DDQ A;  3K7A C;  1Y1W A;  1HI9 A;  3S14 C;  3S0X A;  3S16 C;  4C3J K;  4OIP A;  4G7H A;  1IS1 A;  1XXB A;  1VH2 A;  3L4J A;  2A6H A;  3AQO A;  1SFO A;  5IOT A;  2BE5 A;  4YG2 A;  1TWG K;  4AYB D;  5IOQ A;  4C45 A;  3NUH A;  4QJV B;  4A3K K;  4A3D K;  4YFN A;  4C3J C; 
#chains in the Genus database with same CATH homology
 3LAJ A;  4P5B A;  2GSO A;  3G4C A;  2NVY A;  4KM9 A;  1I50 A;  2VUM A;  2ZFZ A;  3V4G A;  4GTA A;  1WQH A;  1ZBS A;  4KDD A;  3ERE D;  1EH1 A;  1GE9 A;  3BUE A;  1O2B A;  5JFE A;  2JA6 A;  2E2H A;  4GTL A;  2JA7 A;  4GTC A;  4C3H C;  4GTF A;  4P5A A;  3GTO A;  1TWH A;  5IOR A;  1O2A A;  3MML B;  4J3N A;  2RH6 A;  2R7Z A;  5CHP A;  2CFA B;  1O29 A;  1K83 A;  2NVX A;  3N0C A;  4GTB A;  1Y1V A;  4KC6 A;  4KMA A;  4LR2 A;  1O27 A;  4GTE A;  3LAP A;  2R93 A;  4BLA A;  1DD5 A;  1WQF A;  1KQ4 A;  4KAR A;  4ILD A;  1XXA A;  4G0V A;  1O28 A;  3FOF A;  1WIH A;  2PHC B;  3GTK A;  1B4B A;  4KB4 A;  1ISE A;  5CJ9 A;  2Y3P A;  4M1X A;  5EGE A;  3GTQ A;  2JA5 A;  1TWF A;  5TJ3 A;  4KMH A;  5IOS A;  5JVO A;  2GSN A;  4GT9 A;  2XCR B;  2KWA A;  2JH3 A;  3GTL A;  2E2I A;  4LQY A;  3GTP A;  1TWG A;  3OEP A;  4BLB A;  4BKW A;  2XCQ A;  1WCM A;  1WQG A;  3H0G A;  4FZB A;  4KAW X;  4KAS A;  1R9T A;  4G0U A;  1BGW A;  4KMD A;  3CAG A;  3G4A A;  3QX3 A;  3VA7 A;  1I3Q A;  1O25 A;  3CQZ A;  4C3I C;  3ORE A;  3L4K A;  4GTD A;  3GTM A;  1B4A A;  4GFQ A;  2CFA A;  4DDQ A;  1BJT A;  4KM8 A;  3OPF A;  2R92 A;  1Y1W A;  4G0W A;  3FOE A;  3FKI A;  3LPX A;  1O26 A;  1AB4 A;  3S0X A;  4C2M C;  4KB2 A;  2B63 A;  4FM9 A;  3N0B A;  1IS1 A;  1XXB A;  3N3Y A;  3GTG A;  3L4J A;  1ZXO A;  1ZVU A;  3AQO A;  3GTJ A;  1TWA A;  1SFO A;  5IOT A;  5IOQ A;  1F9N A;  2RGR A;  1O24 A;  3NUH A;  3FHZ A;  5EGH A;  2GSU A;  2P5M A;  4KAT A;  1TWC A;  3AH5 A;  3Q3Q A;  1EK8 A;  3AQP A;  2XCO A;  2YU9 A;  1XXC A;  4C3J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...