4A3CK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3cK00
4MQ9A 3K7AC 4A3CK 4OIOA 5C44K 5M3MK 5IYDK 1TWFK 5M3FK 2B63K 3I4NC 4A93C 1WCMC 2WAQD 4LK0A 4A3BC 4A93K 1K83C 3M4OC 1Y1WC 3GTGC 4AYBL 4BBSC 4KN7A 5TMCA 2A6EA 4A3LC 5IYCK 3GTOK 4YFXA 5C4XC 1ZYRA 4A3KC 3HOUC 5M5WK 3S1NC 3S14K 4G7OA 1I3QK 4G7HA 3S17C 5IYBC 3RZDC 4BXXK 4X6AC 3HOWK 3FKIK 1YNJA 2NVQC 3S1MC 3HOVC 4GZYA 1I6HK 1SMYA 3CQZC 4AYBD 2E2HK 4BY7C 3HOYC 3GTJK 2PA8L 1R9TK 4XLNA 4A3FC 2Y0SD 5C44C 2E2JK 5C4JK 3GTMC 4A3GK 1WCMK 3S15C 1Y1WK 2NVYK 1I6VA 4JK1A 3S1RC 2VUMC 3GTGK 2R7ZK 5IP9K 2NVTK 2A68A 3HOZK 3GTKK 5FLMC 2JA8C 4A3GC 4OIRA 3K7AK 4A3CC 3PO2K 4A3KK 3HOUK 2Y0SL 3PO3C 2YU9C 2B63C 3HKZL 1BDFA 1TWHK 4A3EC 1Y1VC 4A3MC 1I3QC 4XLPA 3S17K 5IYBK 4BXXC 4X6AK 3GTLC 1IW7A 1I50C 4QJVB 5TMFA 4Q4ZA 1SFOK 2JA7K 4BY7K 4BBRC 3HOXK 3H3VL 5C4XK 5IYCC 1TWGK 2NVXC 2PMZL 4A3IC 3GTOC 3GTQK 3S1NK 5M5XK 4Y52C 5C4JC 2JA5K 3HKZD 4OIQA 3S2HK 3WODA 4YFKA 4G7ZA 4C3IK 4OINA 3S15K 1TWAK 3S2DK 3HOVK 4C3HK 3CQZK 4Q5SA 2VUMK 4LK1A 3DXJA 1R9TC 2BE5A 4MEXA 4A3FK 2JA8K 2WB1D 1YNNA 2E2JC 3PO3K 1XPPA 5IP7C 2YU9K 4A3DC 2A6HA 1TWHC 4Y7NK 1Y1VK 4QIWD 4A3EK 4A3MK 4A3JK 3S1QC 3EQLA 3GTLK 1I50K 2NVTC 3HOZC 2O5IA 5FLMK 3PO2C 2WB1L 4BY1C 3I4MK 2A69A 4Y52K 3GTPK 2JA5C 4NOIA 3M3YC 4QIWL 3S2HC 3S16C 3S2DC 2JA6C 1TWAC 4C2MK 4QJVA 1SFOC 2JA7C 3RZOC 4BBRK 3HOXC 4YG2A 2R92C 3H0GK 1TWGC 2NVXK 2O5JA 4A3IK 3GTQC 4XSZA 5IP7K 4Y7NC 4ZH4A 1K83K 4A3JC 5C3EK 3M4OK 3S1QK 1HQMA 1TWCK 5M5YK 2E2IK 4BBSK 2R93C 2CW0A 3H3VD 2PA8D 4C3JK 4YFNA 5FJ8K 4KN4A 4BY1K 5IYDC 3I4MC 1TWFC 3I4NK 4A3DK 3GTPC 3M3YK 4A3BK 2PPBA 3S16K 2JA6K 4XSXA 4OIPA 1I6HC 2E2HC 3RZOK 3HOYK 3GTJC 2PMZD 4A3LK 5D4DA 3S14C 2WAQL 4KMUA 3GTMK 3RZDK 4LLGA 3HOWC 3FKIC 2NVQK 5C3EC 3S1MK 2NVYC 4LJZA 4MEYA 3S1RK 1TWCC 2E2IC 2R7ZC 5IP9C 2R93K 2R92K 3H0GC 3GTKC
chains in the Genus database with same CATH superfamily
4MQ9A 3K7AC 4A3CK 1VGXA 1GE9A 1IS1A 5IYDK 2B63K 2WAQD 3ADAC 3M4OC 1Y1WC 5TMCA 3GTOK 3S1NC 3AQPA 3S14K 4G7HA 4BXXK 3S1MC 3HOVC 3GDZA 4AYBD 2E2HK 4BY7C 3HOYC 1R9TK 4KMHA 3N3YA 1WCMK 2GSUA 3AD8C 2NVYK 1DCHA 2NVYA 1G51A 1WOOA 1O29A 1BJTA 5CHPA 5IOQA 4A3KK 3HOUK 2Y0SL 2YU9C 2B63C 1XZPB 3HKZL 3S17K 4BLAA 3SZYA 1IW7A 1Y1WA 5IYCC 1TWGK 2V6TA 3S0XA 3S1NK 5M5XK 4Y52C 3S2DK 3HOVK 3CQZK 4P9SA 4WJ4A 3CQZA 1R9TC 2BE5A 4MEXA 2JA8K 1YNNA 2E2JC 1JVIA 3PO3K 5IP7C 4KMAA 1XXBA 1TWHC 1Y1VK 2FQOA 1ZXOA 3VA7A 1JOEA 5HL8A 3IPJA 3HOZC 2O5IA 1IBAA 5IORA 4BY1C 1JQWA 1DCOA 2A69A 2JA5C 4NOIA 2XCOA 2JA6C 2E2IA 3RZOC 5CJ9A 3H0GA 3MMLB 4BBRK 1TWGC 1WIHA 2EBBA 3GTQC 3CAGA 1PJ6A 1VJEA 1AB4A 4ZH4A 3GTGA 4A3JC 3S1QK 4C3HC 3N0BA 3OPFA 4GTEA 4YFNA 3I4MC 3I4NK 3GTPC 5E68A 5JVOA 1WQFA 3S16K 4OIPA 4FM9A 3GTJC 1WOSA 4A3LK 1VRQC 1F93A 3GTMK 3RZDK 3FKIC 4PABA 3V4GA 1BS2A 3S1RK 5IP9C 1SFOA 2R92K 1IE0A 3GTKC 4GTBA 4OIOA 5C44K 3GTQA 1XZQA 3AD7C 4A93C 1IQ0A 4A3BC 1EI6A 1YX2A 4BBSC 3GEIA 3GSIA 1ZYRA 5M5WK 3FHZA 4M1XA 1I3QK 5IYBC 4FZBA 1ISEA 3HOWK 1YNJA 4GZYA 3GTJK 3GTJA 4XLNA 3GTMC 3S15C 1O28A 1Y1WK 1I6VA 3GTGK 2VUMC 5IP9K 2NVTK 4KDDA 4A3GC 5EGEA 4OIRA 3K7AK 4A3CC 3PO2K 4RMFA 1X31C 1J98A 4A93K 1BDFA 4A3EC 3N0CA 4A3MC 2JA6A 4X6AK 1K83A 3GTLC 1I50C 1SFOK 4BY7K 4G0UA 1O2AA 1O26A 3GTOC 4A3IC 2GSOA 4GTLA 5C4JC 1F7VA 4OIQA 3S2HK 4G7ZA 4C3IK 1UV7A 1TWAK 4AH6A 4ILDA 2R93A 1WQGA 1J6WA 2XCQA 3TTGA 1C0AA 1DCPA 2YU9K 4A3DC 4Y7NK 2KWAA 3T01A 3PO2C 2WB1L 4QIWL 1ZBSA 3ERED 2R7ZA 1SFOC 1XXCA 4GFQA 2O5JA 2RH6A 4XSZA 3G4AA 4KB4A 5IP7K 1K83K 5C3EK 1WSRA 3L4JA 1TWCK 2R93C 2FQTA 4C3JK 2ZFZA 1L0WA 1PJ7A 4BKWA 1EQRA 2JA6K 1I6HC 4GT9A 2PMZD 3A8KA 3S14C 2WAQL 4PAAA 3S1MK 2VUMA 3TFHA 1O2FB 2R7ZC 2E2IC 3BP8C 2B63A 3NUHA 2V6UA 1Y1VA 1TWFK 5M3FK 1WCMC 1K83C 4G0WA 4AYBL 3G4CA 1B4BA 2A6EA 4KC6A 2NVXA 4C3JC 4A3LC 5C4XC 3GEEA 4YFXA 1XXAA 4KAWX 4G7OA 3Q3QA 3FKIK 2NVQC 5JFEA 1SMYA 1I6HK 4C45A 1YCLA 1J6VA 2E2HA 3FOFA 2Y0SD 5C44C 1V5VA 4JK1A 3S1RC 2A68A 3GTKK 5FLMC 3GTKA 3PO3C 2JA5A 4G0VA 1TWHK 3AH5A 1I3QC 2V6SA 4XLPA 4P5BA 4BXXC 4LQYA 3A8JA 3A8IA 4XCHA 4Q4ZA 2JA7K 1TWGA 3HOXK 1EFWA 3OEPA 3WODA 3S15K 4WILA 2VUMK 4LK1A 3DXJA 4GTFA 3GTPA 3LPXA 4QIWD 4A3MK 4KARA 3S1QC 3EQLA 3GTLK 2NVTC 1RU0A 4KMDA 5FLMK 3I4MK 2XCRB 1IL2A 4Y52K 3M3YC 3S2HC 3S16C 3S2DC 1TWAC 1TWCA 1F9NA 2JA7C 3HOXC 3H0GK 4DDQA 4A3IK 1WORA 4Y7NC 1WQHA 3M4OK 1HQMA 5M5YK 2CW0A 3H3VD 2P5MA 4BY1K 1B4AA 5IYDC 4A3DK 1O27A 4KM8A 2GAGC 2PPBA 1J6XA 1PJ5A 1TWHA 4A3BK 2JH3A 1DD5A 4LR2A 5IOTA 2E2HC 3RZOK 3QX3A 5IOSA 1HI9A 3HXAA 3AD9C 5D4DA 3GTMA 2RGRA 3JSTA 1BGWA 4LJZA 1XZPA 3H0GC 3LAJA 2R92A 2YU9A 5M3MK 3I4NC 4LK0A 4LOWA 1I50A 3GTGC 3T02A 1WOPA 4KN7A 5IYCK 4A3KC 3HOUC 1O2BA 5EGHA 3S17C 4X6AC 3RZDC 4BLBA 3CQZC 4O2DA 5TJ3A 1ZVUA 3TFJA 2PA8L 4A3FC 1EH1A 2E2JK 5C4JK 4P5AA 5L46A 2Y3PA 2R7ZK 3HOZK 2JA8C 2P8TA 4J3NA 1O25A 3BUEA 1Y1VC 3BP3A 5IYBK 1WCMA 4C2MC 4QJVB 5TMFA 4BBRC 4GTDA 3H3VL 2W7VA 5C4XK 2NVXC 2PMZL 3GTQK 4WJ3M 2JA5K 3HKZD 3OREA 4YFKA 4KATA 4OINA 4C3HK 4Q5SA 1VLOA 2CFAA 4A3FK 4KASA 2WB1D 1TWFA 1XPPA 2A6HA 4A3EK 4A3JK 2CFAB 1I50K 1KQ4A 2GSNA 3AQOA 4GTAA 2ZUFA 1ZQ1C 2ZUEA 2PHCB 2D6FC 3GTPK 3FKIA 4KM9A 1I3QA 4C3IC 4C2MK 1USOA 4QJVA 3GTLA 4YG2A 1WSVA 2R92C 2NVXK 4GTCA 1F7UA 3GTOA 3L4KA 3GEHA 3SZZA 2E2IK 4BBSK 1O24A 2PA8D 1R9TA 1USMA 3GIRA 5FJ8K 4KN4A 1TWFC 1XZQB 3FOEA 3M3YK 4XSXA 4KB2A 3T00A 3HOYK 3LAPA 1INNA 4KMUA 4LLGA 3TFIA 3HOWC 2NVQK 5C3EC 2GAHC 1EK8A 2NVYC 4MEYA 1TWCC 1TWAA 2R93K 2JA7A 1VH2A 4A3GK
chains in the Genus database with same CATH topology
4MQ9A 3K7AC 4A3CK 4OIOA 5C44K 5M3MK 5IYDK 1TWFK 5M3FK 2B63K 3I4NC 4A93C 1WCMC 2WAQD 4LK0A 4A3BC 4A93K 1K83C 3M4OC 1Y1WC 3GTGC 4AYBL 4BBSC 4KN7A 5TMCA 2A6EA 4A3LC 5IYCK 3GTOK 4YFXA 5C4XC 1ZYRA 4A3KC 3HOUC 5M5WK 3S1NC 3S14K 4G7OA 1I3QK 4G7HA 3S17C 5IYBC 3RZDC 4BXXK 4X6AC 3HOWK 3FKIK 1YNJA 2NVQC 3S1MC 3HOVC 4GZYA 1I6HK 1SMYA 3CQZC 4AYBD 2E2HK 4BY7C 3HOYC 3GTJK 2PA8L 1R9TK 4XLNA 4A3FC 2Y0SD 5C44C 2E2JK 5C4JK 3GTMC 4A3GK 1WCMK 3S15C 1Y1WK 2NVYK 1I6VA 4JK1A 3S1RC 2VUMC 3GTGK 2R7ZK 5IP9K 2NVTK 2A68A 3HOZK 3GTKK 5FLMC 2JA8C 4A3GC 4OIRA 3K7AK 4A3CC 3PO2K 4A3KK 3HOUK 2Y0SL 3PO3C 2YU9C 2B63C 3HKZL 1BDFA 1TWHK 4A3EC 1Y1VC 4A3MC 1I3QC 4XLPA 3S17K 5IYBK 4BXXC 4X6AK 3GTLC 1IW7A 1I50C 4QJVB 5TMFA 4Q4ZA 1SFOK 2JA7K 4BY7K 4BBRC 3HOXK 3H3VL 5C4XK 5IYCC 1TWGK 2NVXC 2PMZL 4A3IC 3GTOC 3GTQK 3S1NK 5M5XK 4Y52C 5C4JC 2JA5K 3HKZD 4OIQA 3S2HK 3WODA 4YFKA 4G7ZA 4C3IK 4OINA 3S15K 1TWAK 3S2DK 3HOVK 4C3HK 3CQZK 4Q5SA 2VUMK 4LK1A 3DXJA 1R9TC 2BE5A 4MEXA 4A3FK 2JA8K 2WB1D 1YNNA 2E2JC 3PO3K 1XPPA 5IP7C 2YU9K 4A3DC 2A6HA 1TWHC 4Y7NK 1Y1VK 4QIWD 4A3EK 4A3MK 4A3JK 3S1QC 3EQLA 3GTLK 1I50K 2NVTC 3HOZC 2O5IA 5FLMK 3PO2C 2WB1L 4BY1C 3I4MK 2A69A 4Y52K 3GTPK 2JA5C 4NOIA 3M3YC 4QIWL 3S2HC 3S16C 3S2DC 2JA6C 1TWAC 4C2MK 4QJVA 1SFOC 2JA7C 3RZOC 4BBRK 3HOXC 4YG2A 2R92C 3H0GK 1TWGC 2NVXK 2O5JA 4A3IK 3GTQC 4XSZA 5IP7K 4Y7NC 4ZH4A 1K83K 4A3JC 5C3EK 3M4OK 3S1QK 1HQMA 1TWCK 5M5YK 2E2IK 4BBSK 2R93C 2CW0A 3H3VD 2PA8D 4C3JK 4YFNA 5FJ8K 4KN4A 4BY1K 5IYDC 3I4MC 1TWFC 3I4NK 4A3DK 3GTPC 3M3YK 4A3BK 2PPBA 3S16K 2JA6K 4XSXA 4OIPA 1I6HC 2E2HC 3RZOK 3HOYK 3GTJC 2PMZD 4A3LK 5D4DA 3S14C 2WAQL 4KMUA 3GTMK 3RZDK 4LLGA 3HOWC 3FKIC 2NVQK 5C3EC 3S1MK 2NVYC 4LJZA 4MEYA 3S1RK 1TWCC 2E2IC 2R7ZC 5IP9C 2R93K 2R92K 3H0GC 3GTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ9 A;  3K7A C;  4A3C K;  4OIO A;  5C44 K;  5M3M K;  5IYD K;  1TWF K;  5M3F K;  2B63 K;  3I4N C;  4A93 C;  1WCM C;  2WAQ D;  4LK0 A;  4A3B C;  4A93 K;  1K83 C;  3M4O C;  1Y1W C;  3GTG C;  4AYB L;  4BBS C;  4KN7 A;  5TMC A;  2A6E A;  4A3L C;  5IYC K;  3GTO K;  4YFX A;  5C4X C;  1ZYR A;  4A3K C;  3HOU C;  5M5W K;  3S1N C;  3S14 K;  4G7O A;  1I3Q K;  4G7H A;  3S17 C;  5IYB C;  3RZD C;  4BXX K;  4X6A C;  3HOW K;  3FKI K;  1YNJ A;  2NVQ C;  3S1M C;  3HOV C;  4GZY A;  1I6H K;  1SMY A;  3CQZ C;  4AYB D;  2E2H K;  4BY7 C;  3HOY C;  3GTJ K;  2PA8 L;  1R9T K;  4XLN A;  4A3F C;  2Y0S D;  5C44 C;  2E2J K;  5C4J K;  3GTM C;  4A3G K;  1WCM K;  3S15 C;  1Y1W K;  2NVY K;  1I6V A;  4JK1 A;  3S1R C;  2VUM C;  3GTG K;  2R7Z K;  5IP9 K;  2NVT K;  2A68 A;  3HOZ K;  3GTK K;  5FLM C;  2JA8 C;  4A3G C;  4OIR A;  3K7A K;  4A3C C;  3PO2 K;  4A3K K;  3HOU K;  2Y0S L;  3PO3 C;  2YU9 C;  2B63 C;  3HKZ L;  1BDF A;  1TWH K;  4A3E C;  1Y1V C;  4A3M C;  1I3Q C;  4XLP A;  3S17 K;  5IYB K;  4BXX C;  4X6A K;  3GTL C;  1IW7 A;  1I50 C;  4QJV B;  5TMF A;  4Q4Z A;  1SFO K;  2JA7 K;  4BY7 K;  4BBR C;  3HOX K;  3H3V L;  5C4X K;  5IYC C;  1TWG K;  2NVX C;  2PMZ L;  4A3I C;  3GTO C;  3GTQ K;  3S1N K;  5M5X K;  4Y52 C;  5C4J C;  2JA5 K;  3HKZ D;  4OIQ A;  3S2H K;  3WOD A;  4YFK A;  4G7Z A;  4C3I K;  4OIN A;  3S15 K;  1TWA K;  3S2D K;  3HOV K;  4C3H K;  3CQZ K;  4Q5S A;  2VUM K;  4LK1 A;  3DXJ A;  1R9T C;  2BE5 A;  4MEX A;  4A3F K;  2JA8 K;  2WB1 D;  1YNN A;  2E2J C;  3PO3 K;  1XPP A;  5IP7 C;  2YU9 K;  4A3D C;  2A6H A;  1TWH C;  4Y7N K;  1Y1V K;  4QIW D;  4A3E K;  4A3M K;  4A3J K;  3S1Q C;  3EQL A;  3GTL K;  1I50 K;  2NVT C;  3HOZ C;  2O5I A;  5FLM K;  3PO2 C;  2WB1 L;  4BY1 C;  3I4M K;  2A69 A;  4Y52 K;  3GTP K;  2JA5 C;  4NOI A;  3M3Y C;  4QIW L;  3S2H C;  3S16 C;  3S2D C;  2JA6 C;  1TWA C;  4C2M K;  4QJV A;  1SFO C;  2JA7 C;  3RZO C;  4BBR K;  3HOX C;  4YG2 A;  2R92 C;  3H0G K;  1TWG C;  2NVX K;  2O5J A;  4A3I K;  3GTQ C;  4XSZ A;  5IP7 K;  4Y7N C;  4ZH4 A;  1K83 K;  4A3J C;  5C3E K;  3M4O K;  3S1Q K;  1HQM A;  1TWC K;  5M5Y K;  2E2I K;  4BBS K;  2R93 C;  2CW0 A;  3H3V D;  2PA8 D;  4C3J K;  4YFN A;  5FJ8 K;  4KN4 A;  4BY1 K;  5IYD C;  3I4M C;  1TWF C;  3I4N K;  4A3D K;  3GTP C;  3M3Y K;  4A3B K;  2PPB A;  3S16 K;  2JA6 K;  4XSX A;  4OIP A;  1I6H C;  2E2H C;  3RZO K;  3HOY K;  3GTJ C;  2PMZ D;  4A3L K;  5D4D A;  3S14 C;  2WAQ L;  4KMU A;  3GTM K;  3RZD K;  4LLG A;  3HOW C;  3FKI C;  2NVQ K;  5C3E C;  3S1M K;  2NVY C;  4LJZ A;  4MEY A;  3S1R K;  1TWC C;  2E2I C;  2R7Z C;  5IP9 C;  2R93 K;  2R92 K;  3H0G C;  3GTK C; 
#chains in the Genus database with same CATH topology
 4MQ9 A;  3K7A C;  4A3C K;  1VGX A;  1GE9 A;  1IS1 A;  5IYD K;  2B63 K;  2WAQ D;  3ADA C;  3M4O C;  1Y1W C;  5TMC A;  3GTO K;  3S1N C;  3AQP A;  3S14 K;  4G7H A;  4BXX K;  3S1M C;  3HOV C;  3GDZ A;  4AYB D;  2E2H K;  4BY7 C;  3HOY C;  1R9T K;  4KMH A;  3N3Y A;  1WCM K;  2GSU A;  3AD8 C;  2NVY K;  1DCH A;  2NVY A;  1G51 A;  1WOO A;  1O29 A;  1BJT A;  5CHP A;  5IOQ A;  4A3K K;  3HOU K;  2Y0S L;  2YU9 C;  2B63 C;  1XZP B;  3HKZ L;  3S17 K;  4BLA A;  3SZY A;  1IW7 A;  1Y1W A;  5IYC C;  1TWG K;  2V6T A;  3S0X A;  3S1N K;  5M5X K;  4Y52 C;  3S2D K;  3HOV K;  3CQZ K;  4P9S A;  4WJ4 A;  3CQZ A;  1R9T C;  2BE5 A;  4MEX A;  2JA8 K;  1YNN A;  2E2J C;  1JVI A;  3PO3 K;  5IP7 C;  4KMA A;  1XXB A;  1TWH C;  1Y1V K;  2FQO A;  1ZXO A;  3VA7 A;  1JOE A;  5HL8 A;  3IPJ A;  3HOZ C;  2O5I A;  1IBA A;  5IOR A;  4BY1 C;  1JQW A;  1DCO A;  2A69 A;  2JA5 C;  4NOI A;  2XCO A;  2JA6 C;  2E2I A;  3RZO C;  5CJ9 A;  3H0G A;  3MML B;  4BBR K;  1TWG C;  1WIH A;  2EBB A;  3GTQ C;  3CAG A;  1PJ6 A;  1VJE A;  1AB4 A;  4ZH4 A;  3GTG A;  4A3J C;  3S1Q K;  4C3H C;  3N0B A;  3OPF A;  4GTE A;  4YFN A;  3I4M C;  3I4N K;  3GTP C;  5E68 A;  5JVO A;  1WQF A;  3S16 K;  4OIP A;  4FM9 A;  3GTJ C;  1WOS A;  4A3L K;  1VRQ C;  1F93 A;  3GTM K;  3RZD K;  3FKI C;  4PAB A;  3V4G A;  1BS2 A;  3S1R K;  5IP9 C;  1SFO A;  2R92 K;  1IE0 A;  3GTK C;  4GTB A;  4OIO A;  5C44 K;  3GTQ A;  1XZQ A;  3AD7 C;  4A93 C;  1IQ0 A;  4A3B C;  1EI6 A;  1YX2 A;  4BBS C;  3GEI A;  3GSI A;  1ZYR A;  5M5W K;  3FHZ A;  4M1X A;  1I3Q K;  5IYB C;  4FZB A;  1ISE A;  3HOW K;  1YNJ A;  4GZY A;  3GTJ K;  3GTJ A;  4XLN A;  3GTM C;  3S15 C;  1O28 A;  1Y1W K;  1I6V A;  3GTG K;  2VUM C;  5IP9 K;  2NVT K;  4KDD A;  4A3G C;  5EGE A;  4OIR A;  3K7A K;  4A3C C;  3PO2 K;  4RMF A;  1X31 C;  1J98 A;  4A93 K;  1BDF A;  4A3E C;  3N0C A;  4A3M C;  2JA6 A;  4X6A K;  1K83 A;  3GTL C;  1I50 C;  1SFO K;  4BY7 K;  4G0U A;  1O2A A;  1O26 A;  3GTO C;  4A3I C;  2GSO A;  4GTL A;  5C4J C;  1F7V A;  4OIQ A;  3S2H K;  4G7Z A;  4C3I K;  1UV7 A;  1TWA K;  4AH6 A;  4ILD A;  2R93 A;  1WQG A;  1J6W A;  2XCQ A;  3TTG A;  1C0A A;  1DCP A;  2YU9 K;  4A3D C;  4Y7N K;  2KWA A;  3T01 A;  3PO2 C;  2WB1 L;  4QIW L;  1ZBS A;  3ERE D;  2R7Z A;  1SFO C;  1XXC A;  4GFQ A;  2O5J A;  2RH6 A;  4XSZ A;  3G4A A;  4KB4 A;  5IP7 K;  1K83 K;  5C3E K;  1WSR A;  3L4J A;  1TWC K;  2R93 C;  2FQT A;  4C3J K;  2ZFZ A;  1L0W A;  1PJ7 A;  4BKW A;  1EQR A;  2JA6 K;  1I6H C;  4GT9 A;  2PMZ D;  3A8K A;  3S14 C;  2WAQ L;  4PAA A;  3S1M K;  2VUM A;  3TFH A;  1O2F B;  2R7Z C;  2E2I C;  3BP8 C;  2B63 A;  3NUH A;  2V6U A;  1Y1V A;  1TWF K;  5M3F K;  1WCM C;  1K83 C;  4G0W A;  4AYB L;  3G4C A;  1B4B A;  2A6E A;  4KC6 A;  2NVX A;  4C3J C;  4A3L C;  5C4X C;  3GEE A;  4YFX A;  1XXA A;  4KAW X;  4G7O A;  3Q3Q A;  3FKI K;  2NVQ C;  5JFE A;  1SMY A;  1I6H K;  4C45 A;  1YCL A;  1J6V A;  2E2H A;  3FOF A;  2Y0S D;  5C44 C;  1V5V A;  4JK1 A;  3S1R C;  2A68 A;  3GTK K;  5FLM C;  3GTK A;  3PO3 C;  2JA5 A;  4G0V A;  1TWH K;  3AH5 A;  1I3Q C;  2V6S A;  4XLP A;  4P5B A;  4BXX C;  4LQY A;  3A8J A;  3A8I A;  4XCH A;  4Q4Z A;  2JA7 K;  1TWG A;  3HOX K;  1EFW A;  3OEP A;  3WOD A;  3S15 K;  4WIL A;  2VUM K;  4LK1 A;  3DXJ A;  4GTF A;  3GTP A;  3LPX A;  4QIW D;  4A3M K;  4KAR A;  3S1Q C;  3EQL A;  3GTL K;  2NVT C;  1RU0 A;  4KMD A;  5FLM K;  3I4M K;  2XCR B;  1IL2 A;  4Y52 K;  3M3Y C;  3S2H C;  3S16 C;  3S2D C;  1TWA C;  1TWC A;  1F9N A;  2JA7 C;  3HOX C;  3H0G K;  4DDQ A;  4A3I K;  1WOR A;  4Y7N C;  1WQH A;  3M4O K;  1HQM A;  5M5Y K;  2CW0 A;  3H3V D;  2P5M A;  4BY1 K;  1B4A A;  5IYD C;  4A3D K;  1O27 A;  4KM8 A;  2GAG C;  2PPB A;  1J6X A;  1PJ5 A;  1TWH A;  4A3B K;  2JH3 A;  1DD5 A;  4LR2 A;  5IOT A;  2E2H C;  3RZO K;  3QX3 A;  5IOS A;  1HI9 A;  3HXA A;  3AD9 C;  5D4D A;  3GTM A;  2RGR A;  3JST A;  1BGW A;  4LJZ A;  1XZP A;  3H0G C;  3LAJ A;  2R92 A;  2YU9 A;  5M3M K;  3I4N C;  4LK0 A;  4LOW A;  1I50 A;  3GTG C;  3T02 A;  1WOP A;  4KN7 A;  5IYC K;  4A3K C;  3HOU C;  1O2B A;  5EGH A;  3S17 C;  4X6A C;  3RZD C;  4BLB A;  3CQZ C;  4O2D A;  5TJ3 A;  1ZVU A;  3TFJ A;  2PA8 L;  4A3F C;  1EH1 A;  2E2J K;  5C4J K;  4P5A A;  5L46 A;  2Y3P A;  2R7Z K;  3HOZ K;  2JA8 C;  2P8T A;  4J3N A;  1O25 A;  3BUE A;  1Y1V C;  3BP3 A;  5IYB K;  1WCM A;  4C2M C;  4QJV B;  5TMF A;  4BBR C;  4GTD A;  3H3V L;  2W7V A;  5C4X K;  2NVX C;  2PMZ L;  3GTQ K;  4WJ3 M;  2JA5 K;  3HKZ D;  3ORE A;  4YFK A;  4KAT A;  4OIN A;  4C3H K;  4Q5S A;  1VLO A;  2CFA A;  4A3F K;  4KAS A;  2WB1 D;  1TWF A;  1XPP A;  2A6H A;  4A3E K;  4A3J K;  2CFA B;  1I50 K;  1KQ4 A;  2GSN A;  3AQO A;  4GTA A;  2ZUF A;  1ZQ1 C;  2ZUE A;  2PHC B;  2D6F C;  3GTP K;  3FKI A;  4KM9 A;  1I3Q A;  4C3I C;  4C2M K;  1USO A;  4QJV A;  3GTL A;  4YG2 A;  1WSV A;  2R92 C;  2NVX K;  4GTC A;  1F7U A;  3GTO A;  3L4K A;  3GEH A;  3SZZ A;  2E2I K;  4BBS K;  1O24 A;  2PA8 D;  1R9T A;  1USM A;  3GIR A;  5FJ8 K;  4KN4 A;  1TWF C;  1XZQ B;  3FOE A;  3M3Y K;  4XSX A;  4KB2 A;  3T00 A;  3HOY K;  3LAP A;  1INN A;  4KMU A;  4LLG A;  3TFI A;  3HOW C;  2NVQ K;  5C3E C;  2GAH C;  1EK8 A;  2NVY C;  4MEY A;  1TWC C;  1TWA A;  2R93 K;  2JA7 A;  1VH2 A;  4A3G K; 
#chains in the Genus database with same CATH homology
 4MQ9 A;  3K7A C;  4A3C K;  4OIO A;  5C44 K;  5M3M K;  5IYD K;  1TWF K;  5M3F K;  2B63 K;  3I4N C;  4A93 C;  1WCM C;  2WAQ D;  4LK0 A;  4A3B C;  4A93 K;  1K83 C;  3M4O C;  1Y1W C;  3GTG C;  4AYB L;  4BBS C;  4KN7 A;  5TMC A;  2A6E A;  4A3L C;  5IYC K;  3GTO K;  4YFX A;  5C4X C;  1ZYR A;  4A3K C;  3HOU C;  5M5W K;  3S1N C;  3S14 K;  4G7O A;  1I3Q K;  4G7H A;  3S17 C;  5IYB C;  3RZD C;  4BXX K;  4X6A C;  3HOW K;  3FKI K;  1YNJ A;  2NVQ C;  3S1M C;  3HOV C;  4GZY A;  1I6H K;  1SMY A;  3CQZ C;  4AYB D;  2E2H K;  4BY7 C;  3HOY C;  3GTJ K;  2PA8 L;  1R9T K;  4XLN A;  4A3F C;  2Y0S D;  5C44 C;  2E2J K;  5C4J K;  3GTM C;  4A3G K;  1WCM K;  3S15 C;  1Y1W K;  2NVY K;  1I6V A;  4JK1 A;  3S1R C;  2VUM C;  3GTG K;  2R7Z K;  5IP9 K;  2NVT K;  2A68 A;  3HOZ K;  3GTK K;  5FLM C;  2JA8 C;  4A3G C;  4OIR A;  3K7A K;  4A3C C;  3PO2 K;  4A3K K;  3HOU K;  2Y0S L;  3PO3 C;  2YU9 C;  2B63 C;  3HKZ L;  1BDF A;  1TWH K;  4A3E C;  1Y1V C;  4A3M C;  1I3Q C;  4XLP A;  3S17 K;  5IYB K;  4BXX C;  4X6A K;  3GTL C;  1IW7 A;  1I50 C;  4QJV B;  5TMF A;  4Q4Z A;  1SFO K;  2JA7 K;  4BY7 K;  4BBR C;  3HOX K;  3H3V L;  5C4X K;  5IYC C;  1TWG K;  2NVX C;  2PMZ L;  4A3I C;  3GTO C;  3GTQ K;  3S1N K;  5M5X K;  4Y52 C;  5C4J C;  2JA5 K;  3HKZ D;  4OIQ A;  3S2H K;  3WOD A;  4YFK A;  4G7Z A;  4C3I K;  4OIN A;  3S15 K;  1TWA K;  3S2D K;  3HOV K;  4C3H K;  3CQZ K;  4Q5S A;  2VUM K;  4LK1 A;  3DXJ A;  1R9T C;  2BE5 A;  4MEX A;  4A3F K;  2JA8 K;  2WB1 D;  1YNN A;  2E2J C;  3PO3 K;  1XPP A;  5IP7 C;  2YU9 K;  4A3D C;  2A6H A;  1TWH C;  4Y7N K;  1Y1V K;  4QIW D;  4A3E K;  4A3M K;  4A3J K;  3S1Q C;  3EQL A;  3GTL K;  1I50 K;  2NVT C;  3HOZ C;  2O5I A;  5FLM K;  3PO2 C;  2WB1 L;  4BY1 C;  3I4M K;  2A69 A;  4Y52 K;  3GTP K;  2JA5 C;  4NOI A;  3M3Y C;  4QIW L;  3S2H C;  3S16 C;  3S2D C;  2JA6 C;  1TWA C;  4C2M K;  4QJV A;  1SFO C;  2JA7 C;  3RZO C;  4BBR K;  3HOX C;  4YG2 A;  2R92 C;  3H0G K;  1TWG C;  2NVX K;  2O5J A;  4A3I K;  3GTQ C;  4XSZ A;  5IP7 K;  4Y7N C;  4ZH4 A;  1K83 K;  4A3J C;  5C3E K;  3M4O K;  3S1Q K;  1HQM A;  1TWC K;  5M5Y K;  2E2I K;  4BBS K;  2R93 C;  2CW0 A;  3H3V D;  2PA8 D;  4C3J K;  4YFN A;  5FJ8 K;  4KN4 A;  4BY1 K;  5IYD C;  3I4M C;  1TWF C;  3I4N K;  4A3D K;  3GTP C;  3M3Y K;  4A3B K;  2PPB A;  3S16 K;  2JA6 K;  4XSX A;  4OIP A;  1I6H C;  2E2H C;  3RZO K;  3HOY K;  3GTJ C;  2PMZ D;  4A3L K;  5D4D A;  3S14 C;  2WAQ L;  4KMU A;  3GTM K;  3RZD K;  4LLG A;  3HOW C;  3FKI C;  2NVQ K;  5C3E C;  3S1M K;  2NVY C;  4LJZ A;  4MEY A;  3S1R K;  1TWC C;  2E2I C;  2R7Z C;  5IP9 C;  2R93 K;  2R92 K;  3H0G C;  3GTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...