4A3CK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3cK00
3H0GC 3GTGK 2B63K 1K83C 4LK1A 3M4OC 4Y52K 1SMYA 5IYDK 3S1RK 1Y1WC 1I3QC 5IYCK 1SFOK 3GTQK 1WCMC 4MQ9A 3GTKC 2BE5A 1I50C 2JA8K 4C3JK 3M4OK 1Y1WK 1I3QK 2JA5C 1WCMK 4BY7C 5C44C 1I50K 5M5YK 4A3EC 3I4MK 3S15C 4KN7A 2JA7C 3S17C 2A6HA 4MEXA 3HOWC 3RZOC 2JA5K 3PO2C 5C44K 3S15K 3HOUC 3S17K 1ZYRA 1Y1VK 4XSZA 3HOWK 4A3LK 3RZOK 2A68A 2NVYC 3PO2K 4LK0A 2WAQD 3HOUK 3S1QK 1TWFC 4KN4A 5FLMK 4Y7NK 4BY1K 3GTMK 3I4NC 4G7HA 3GTLK 2Y0SL 3S2DC 4X6AC 2NVYK 5C4JC 4A3BC 4BXXC 1TWFK 1YNJA 2PMZL 4XLPA 3S2DK 4Q4ZA 3I4NK 4X6AK 4AYBD 4XLNA 5C4JK 2R7ZC 5C4XC 4LLGA 4A3BK 3HOXC 3H0GK 2YU9C 3HKZD 1K83K 4LJZA 2R7ZK 5C4XK 3HOXK 4XSXA 1XPPA 3RZDC 2E2HC 2WB1D 3GTKK 1HQMA 5IP7C 1YNNA 2O5JA 3RZDK 2E2HK 3GTOC 4BY7K 4C3IK 4A3EK 2PA8L 5IP7K 2JA7K 4A3JC 4G7OA 3GTOK 4NOIA 2JA6C 4OIPA 2A6EA 4QIWD 3DXJA 3HOVC 3S1MC 4A3JK 3M3YC 2R92C 4C2MK 1TWAC 5D4DA 2JA6K 3GTPK 3H3VL 4GZYA 3HOVK 4OINA 3EQLA 5TMCA 4A3KC 3M3YK 4A93C 1I6VA 4QJVB 1I6HC 4YFNA 2R93C 4BXXK 3S16C 4BBRC 1R9TC 3S14C 3PO3C 3S2HC 4A93K 1I6HK 4A3IC 2NVTC 3S16K 5TMFA 4BBRK 2NVQC 3S14K 3S1NC 3PO3K 3S2HK 4OIQA 2YU9K 2VUMC 5IP9C 2NVTK 3S1NK 1TWCC 1BDFA 4YFXA 2NVXC 2O5IA 3GTPC 2WB1L 2PMZD 4KMUA 5IP9K 3CQZC 5IYBC 2PPBA 1TWCK 4A3FC 4Q5SA 2NVXK 4A3MC 1SFOC 4OIRA 5IYCC 4A3CC 4C3HK 5M3FK 3CQZK 1TWHC 4MEYA 5IYBK 2JA8C 4A3FK 4A3MK 4BBSC 2A69A 2WAQL 4A3CK 4QIWL 3WODA 3S1MK 1TWHK 1TWGC 4JK1A 3I4MC 3HOYC 2R92K 4G7ZA 4OIOA 3HOZC 1TWAK 4BBSK 3K7AC 3GTQC 5C3EC 3GTJC 1TWGK 4A3KK 2PA8D 3HOYK 4YFKA 2R93K 3HOZK 4AYBL 4A3DC 1Y1VC 4QJVA 1IW7A 3K7AK 2E2IC 1R9TK 5C3EK 5FJ8K 4A3LC 4A3GC 3GTJK 3S1QC 2E2JC 5FLMC 3HKZL 4Y7NC 4A3IK 4BY1C 3GTMC 2E2IK 4A3DK 2Y0SD 2NVQK 3GTLC 4A3GK 5M5WK 3FKIC 5M5XK 2VUMK 2E2JK 3GTGC 4YG2A 3H3VD 2CW0A 2B63C 4Y52C 5M3MK 5IYDC 4ZH4A 3S1RC 3FKIK
chains in the Genus database with same CATH superfamily
3H0GC 4KARA 2B63K 1USMA 4KAWX 4Y52K 1SMYA 3VA7A 1XZPB 1O28A 3A8KA 1KQ4A 3S15C 5M5YK 2A6HA 5EGHA 3IPJA 5C44K 4ILDA 1ZYRA 1VH2A 3HOWK 4A3LK 3RZOK 2YU9A 2NVYC 4C2MC 1J6VA 3FOFA 3GTMK 3S2DC 3I4NC 4X6AC 1O29A 1TWCA 4XLPA 2NVXA 3TTGA 4Q4ZA 4GT9A 5C4XC 3CQZA 2YU9C 1O27A 3HKZD 1K83K 4XSXA 1TWHA 1UV7A 3GEIA 4AH6A 2WB1D 4C3IC 1TWAA 5IOTA 2O5JA 2R93A 4BY7K 4A3EK 2PA8L 2JA7K 4J3NA 4BLAA 3GTOK 4NOIA 2JA6C 3HOVC 1YCLA 3JSTA 4A3JK 4KMHA 1TWAC 5D4DA 3FOEA 4P5AA 3H3VL 3M3YK 1ZVUA 3A8JA 3TFJA 2R93C 1ISEA 3PO3C 1I6HK 1SFOA 3S16K 4OIQA 1PJ5A 1I3QA 4LQYA 2NVTK 3S1NK 3SZZA 1GE9A 4GTAA 4KMUA 1DD5A 4FZBA 2XCRB 2PPBA 4Q5SA 1SFOC 4OIRA 5IYCC 1Y1VA 2JA7A 3N3YA 3GSIA 4C3HK 1F93A 2A69A 4G0WA 3HOYC 2R92K 4O2DA 4BBSK 3K7AC 1F9NA 3CAGA 5C3EC 3GTJC 4A3KK 3HOZK 1IQ0A 1Y1VC 5FJ8K 4PAAA 4BY1C 4A3IK 3BUEA 2NVQK 3GTKA 4A3GK 5M5WK 3FKIC 2E2JK 3GTGC 1J98A 2CW0A 4KMDA 4ZH4A 3S1RC 2V6UA 3LAPA 4LK1A 3M4OC 5IYDK 1L0WA 3GTQK 1Y1WC 1XXAA 1WCMC 3GTKC 1I50C 3L4KA 2JA8K 2JA5C 4FM9A 3I4MK 1IS1A 4MEXA 1ZBSA 1HI9A 2Y3PA 1DCPA 1B4BA 3S15K 1JQWA 4XSZA 2A68A 4M1XA 2WAQD 3S1QK 1TWFC 4Y7NK 4G7HA 1F7UA 4BLBA 2NVYK 5C4JC 4BXXC 1B4AA 3S2DK 1BGWA 3I4NK 4X6AK 4AYBD 2R7ZC 4LLGA 3HOXC 1F7VA 2EBBA 4KB2A 4P9SA 4LJZA 2XCOA 5C4XK 1DCOA 1JOEA 2E2HC 1O2AA 5IP7C 4GTBA 1TWGA 4C3IK 3S0XA 1R9TA 4G7OA 2GSOA 5JVOA 3ERED 2E2IA 3N0CA 1WORA 2JA6K 1XZQB 3HOVK 5TMCA 1RU0A 4GTFA 1PJ6A 4BBRC 1R9TC 3S14C 2B63A 1PJ7A 1WQGA 2XCQA 3PO3K 4KASA 2GAHC 2ZUEA 1TWCC 2NVXC 1EFWA 2WB1L 3T00A 3CQZC 3LPXA 5IYBC 4A3MC 4XCHA 4KC6A 5EGEA 1TWHC 2V6TA 3GTMA 3WODA 3S1MK 4JK1A 4G7ZA 4OIOA 1WSVA 3N0BA 5E68A 2PA8D 3HOYK 4QJVA 1IW7A 3K7AK 3Q3QA 2CFAA 5C3EK 4A3LC 1WQFA 3GTJK 1K83A 3T02A 3GTMC 2Y0SD 1O24A 3AD9C 3H3VD 2VUMK 1WOOA 1IBAA 5M3MK 3GTPK 3FKIK 3GTGK 3GTOA 1K83C 2P5MA 3S1RK 1I3QC 3AD7C 5CJ9A 2BE5A 4C3JK 3M4OK 1Y1WK 3AQPA 1WCMK 4BY7C 3NUHA 1I50K 4A3EC 4KM8A 4KN7A 2JA7C 3S17C 2JA5K 4KB4A 3PO2C 3HOUC 4DDQA 3TFIA 1O26A 2FQTA 1IL2A 4LK0A 1ZQ1C 5FLMK 2V6SA 4GTLA 3GTLK 1XXBA 5IOSA 4A3BC 3MMLB 1EI6A 1TWFK 2PMZL 5C4JK 2CFAB 4KMAA 1AB4A 2KWAA 3H0GK 3ADAC 2GSUA 2R7ZK 3OREA 3AD8C 3HOXK 1XPPA 1XZPA 3RZDC 2R92A 1HQMA 2ZUFA 4GFQA 3G4AA 2E2HK 2GSNA 5TJ3A 5IP7K 3HXAA 1WIHA 2W7VA 1V5VA 4OIPA 4QIWD 4GTEA 2R92C 4C2MK 4GZYA 3EQLA 4A3KC 4A93C 1I6VA 3GDZA 4GTCA 2D6FC 3S2HC 3GTQA 4RMFA 4A3IC 2RH6A 3H0GA 5TMFA 4BBRK 2NVQC 3S14K 2YU9K 5IP9C 4YFXA 5CHPA 1VRQC 4LR2A 1TWCK 4A3FC 2NVXK 1ZXOA 4A3CC 5M3FK 3CQZK 5IYBK 2JA8C 4A3MK 1TWHK 1TWGC 2NVYA 4PABA 3I4MC 3V4GA 1TWAK 1DCHA 1INNA 1WOPA 2R93K 4YFKA 4A3DC 2ZFZA 2E2IC 5JFEA 3OEPA 3S1QC 4Y7NC 3HKZL 1EK8A 1IE0A 3T01A 2B63C 4G0UA 5HL8A 4Y52C 3FHZA 2JH3A 4WJ4A 3AQOA 3L4JA 1C0AA 1SFOK 1O2BA 4P5BA 5IYCK 4MQ9A 2JA6A 1I3QK 5C44C 2GAGC 3HOWC 1EH1A 3RZOC 1G51A 1VJEA 1WSRA 3S17K 1Y1VK 3G4CA 3QX3A 3PO2K 3OPFA 3HOUK 4KN4A 4BY1K 3GIRA 2Y0SL 4WILA 2RGRA 1YNJA 5L46A 4XLNA 4A3BK 1BS2A 3GEHA 3A8IA 3BP8C 3GTKK 5IOQA 5IORA 1YNNA 4GTDA 3LAJA 3RZDK 3GTOC 2PHCB 1J6XA 4A3JC 1J6WA 3GTJA 1X31C 1YX2A 2A6EA 3DXJA 3S1MC 3M3YC 2VUMA 4KATA 4OINA 1VGXA 1I6HC 4QJVB 3GTPA 4YFNA 3FKIA 3GTGA 3S16C 4BXXK 4A93K 3GEEA 1BJTA 3TFHA 2NVTC 3S1NC 1JVIA 3S2HK 1EQRA 2VUMC 1Y1WA 1WCMA 3BP3A 2O5IA 1BDFA 1I50A 3AH5A 3GTPC 2PMZD 4C3HC 1WQHA 5IP9K 2JA5A 4C45A 1WOSA 3SZYA 4MEYA 1O2FB 4C3JC 4A3FK 4KDDA 2P8TA 4BBSC 2WAQL 4A3CK 4QIWL 3GTLA 3HOZC 1VLOA 1TWFA 1XZQA 1TWGK 4KM9A 4AYBL 1R9TK 4A3GC 2R7ZA 1USOA 2E2JC 1XXCA 5FLMC 4A3DK 2E2IK 3GTLC 2FQOA 4LOWA 4WJ3M 5M5XK 4G0VA 1O25A 4YG2A 2E2HA 4BKWA 5IYDC 3GTQC
chains in the Genus database with same CATH topology
3H0GC 3GTGK 2B63K 1K83C 4LK1A 3M4OC 4Y52K 1SMYA 5IYDK 3S1RK 1Y1WC 1I3QC 5IYCK 1SFOK 3GTQK 1WCMC 4MQ9A 3GTKC 2BE5A 1I50C 2JA8K 4C3JK 3M4OK 1Y1WK 1I3QK 2JA5C 1WCMK 4BY7C 5C44C 1I50K 5M5YK 4A3EC 3I4MK 3S15C 4KN7A 2JA7C 3S17C 2A6HA 4MEXA 3HOWC 3RZOC 2JA5K 3PO2C 5C44K 3S15K 3HOUC 3S17K 1ZYRA 1Y1VK 4XSZA 3HOWK 4A3LK 3RZOK 2A68A 2NVYC 3PO2K 4LK0A 2WAQD 3HOUK 3S1QK 1TWFC 4KN4A 5FLMK 4Y7NK 4BY1K 3GTMK 3I4NC 4G7HA 3GTLK 2Y0SL 3S2DC 4X6AC 2NVYK 5C4JC 4A3BC 4BXXC 1TWFK 1YNJA 2PMZL 4XLPA 3S2DK 4Q4ZA 3I4NK 4X6AK 4AYBD 4XLNA 5C4JK 2R7ZC 5C4XC 4LLGA 4A3BK 3HOXC 3H0GK 2YU9C 3HKZD 1K83K 4LJZA 2R7ZK 5C4XK 3HOXK 4XSXA 1XPPA 3RZDC 2E2HC 2WB1D 3GTKK 1HQMA 5IP7C 1YNNA 2O5JA 3RZDK 2E2HK 3GTOC 4BY7K 4C3IK 4A3EK 2PA8L 5IP7K 2JA7K 4A3JC 4G7OA 3GTOK 4NOIA 2JA6C 4OIPA 2A6EA 4QIWD 3DXJA 3HOVC 3S1MC 4A3JK 3M3YC 2R92C 4C2MK 1TWAC 5D4DA 2JA6K 3GTPK 3H3VL 4GZYA 3HOVK 4OINA 3EQLA 5TMCA 4A3KC 3M3YK 4A93C 1I6VA 4QJVB 1I6HC 4YFNA 2R93C 4BXXK 3S16C 4BBRC 1R9TC 3S14C 3PO3C 3S2HC 4A93K 1I6HK 4A3IC 2NVTC 3S16K 5TMFA 4BBRK 2NVQC 3S14K 3S1NC 3PO3K 3S2HK 4OIQA 2YU9K 2VUMC 5IP9C 2NVTK 3S1NK 1TWCC 1BDFA 4YFXA 2NVXC 2O5IA 3GTPC 2WB1L 2PMZD 4KMUA 5IP9K 3CQZC 5IYBC 2PPBA 1TWCK 4A3FC 4Q5SA 2NVXK 4A3MC 1SFOC 4OIRA 5IYCC 4A3CC 4C3HK 5M3FK 3CQZK 1TWHC 4MEYA 5IYBK 2JA8C 4A3FK 4A3MK 4BBSC 2A69A 2WAQL 4A3CK 4QIWL 3WODA 3S1MK 1TWHK 1TWGC 4JK1A 3I4MC 3HOYC 2R92K 4G7ZA 4OIOA 3HOZC 1TWAK 4BBSK 3K7AC 3GTQC 5C3EC 3GTJC 1TWGK 4A3KK 2PA8D 3HOYK 4YFKA 2R93K 3HOZK 4AYBL 4A3DC 1Y1VC 4QJVA 1IW7A 3K7AK 2E2IC 1R9TK 5C3EK 5FJ8K 4A3LC 4A3GC 3GTJK 3S1QC 2E2JC 5FLMC 3HKZL 4Y7NC 4A3IK 4BY1C 3GTMC 2E2IK 4A3DK 2Y0SD 2NVQK 3GTLC 4A3GK 5M5WK 3FKIC 5M5XK 2VUMK 2E2JK 3GTGC 4YG2A 3H3VD 2CW0A 2B63C 4Y52C 5M3MK 5IYDC 4ZH4A 3S1RC 3FKIK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G C;  3GTG K;  2B63 K;  1K83 C;  4LK1 A;  3M4O C;  4Y52 K;  1SMY A;  5IYD K;  3S1R K;  1Y1W C;  1I3Q C;  5IYC K;  1SFO K;  3GTQ K;  1WCM C;  4MQ9 A;  3GTK C;  2BE5 A;  1I50 C;  2JA8 K;  4C3J K;  3M4O K;  1Y1W K;  1I3Q K;  2JA5 C;  1WCM K;  4BY7 C;  5C44 C;  1I50 K;  5M5Y K;  4A3E C;  3I4M K;  3S15 C;  4KN7 A;  2JA7 C;  3S17 C;  2A6H A;  4MEX A;  3HOW C;  3RZO C;  2JA5 K;  3PO2 C;  5C44 K;  3S15 K;  3HOU C;  3S17 K;  1ZYR A;  1Y1V K;  4XSZ A;  3HOW K;  4A3L K;  3RZO K;  2A68 A;  2NVY C;  3PO2 K;  4LK0 A;  2WAQ D;  3HOU K;  3S1Q K;  1TWF C;  4KN4 A;  5FLM K;  4Y7N K;  4BY1 K;  3GTM K;  3I4N C;  4G7H A;  3GTL K;  2Y0S L;  3S2D C;  4X6A C;  2NVY K;  5C4J C;  4A3B C;  4BXX C;  1TWF K;  1YNJ A;  2PMZ L;  4XLP A;  3S2D K;  4Q4Z A;  3I4N K;  4X6A K;  4AYB D;  4XLN A;  5C4J K;  2R7Z C;  5C4X C;  4LLG A;  4A3B K;  3HOX C;  3H0G K;  2YU9 C;  3HKZ D;  1K83 K;  4LJZ A;  2R7Z K;  5C4X K;  3HOX K;  4XSX A;  1XPP A;  3RZD C;  2E2H C;  2WB1 D;  3GTK K;  1HQM A;  5IP7 C;  1YNN A;  2O5J A;  3RZD K;  2E2H K;  3GTO C;  4BY7 K;  4C3I K;  4A3E K;  2PA8 L;  5IP7 K;  2JA7 K;  4A3J C;  4G7O A;  3GTO K;  4NOI A;  2JA6 C;  4OIP A;  2A6E A;  4QIW D;  3DXJ A;  3HOV C;  3S1M C;  4A3J K;  3M3Y C;  2R92 C;  4C2M K;  1TWA C;  5D4D A;  2JA6 K;  3GTP K;  3H3V L;  4GZY A;  3HOV K;  4OIN A;  3EQL A;  5TMC A;  4A3K C;  3M3Y K;  4A93 C;  1I6V A;  4QJV B;  1I6H C;  4YFN A;  2R93 C;  4BXX K;  3S16 C;  4BBR C;  1R9T C;  3S14 C;  3PO3 C;  3S2H C;  4A93 K;  1I6H K;  4A3I C;  2NVT C;  3S16 K;  5TMF A;  4BBR K;  2NVQ C;  3S14 K;  3S1N C;  3PO3 K;  3S2H K;  4OIQ A;  2YU9 K;  2VUM C;  5IP9 C;  2NVT K;  3S1N K;  1TWC C;  1BDF A;  4YFX A;  2NVX C;  2O5I A;  3GTP C;  2WB1 L;  2PMZ D;  4KMU A;  5IP9 K;  3CQZ C;  5IYB C;  2PPB A;  1TWC K;  4A3F C;  4Q5S A;  2NVX K;  4A3M C;  1SFO C;  4OIR A;  5IYC C;  4A3C C;  4C3H K;  5M3F K;  3CQZ K;  1TWH C;  4MEY A;  5IYB K;  2JA8 C;  4A3F K;  4A3M K;  4BBS C;  2A69 A;  2WAQ L;  4A3C K;  4QIW L;  3WOD A;  3S1M K;  1TWH K;  1TWG C;  4JK1 A;  3I4M C;  3HOY C;  2R92 K;  4G7Z A;  4OIO A;  3HOZ C;  1TWA K;  4BBS K;  3K7A C;  3GTQ C;  5C3E C;  3GTJ C;  1TWG K;  4A3K K;  2PA8 D;  3HOY K;  4YFK A;  2R93 K;  3HOZ K;  4AYB L;  4A3D C;  1Y1V C;  4QJV A;  1IW7 A;  3K7A K;  2E2I C;  1R9T K;  5C3E K;  5FJ8 K;  4A3L C;  4A3G C;  3GTJ K;  3S1Q C;  2E2J C;  5FLM C;  3HKZ L;  4Y7N C;  4A3I K;  4BY1 C;  3GTM C;  2E2I K;  4A3D K;  2Y0S D;  2NVQ K;  3GTL C;  4A3G K;  5M5W K;  3FKI C;  5M5X K;  2VUM K;  2E2J K;  3GTG C;  4YG2 A;  3H3V D;  2CW0 A;  2B63 C;  4Y52 C;  5M3M K;  5IYD C;  4ZH4 A;  3S1R C;  3FKI K; 
#chains in the Genus database with same CATH topology
 3H0G C;  4KAR A;  2B63 K;  1USM A;  4KAW X;  4Y52 K;  1SMY A;  3VA7 A;  1XZP B;  1O28 A;  3A8K A;  1KQ4 A;  3S15 C;  5M5Y K;  2A6H A;  5EGH A;  3IPJ A;  5C44 K;  4ILD A;  1ZYR A;  1VH2 A;  3HOW K;  4A3L K;  3RZO K;  2YU9 A;  2NVY C;  4C2M C;  1J6V A;  3FOF A;  3GTM K;  3S2D C;  3I4N C;  4X6A C;  1O29 A;  1TWC A;  4XLP A;  2NVX A;  3TTG A;  4Q4Z A;  4GT9 A;  5C4X C;  3CQZ A;  2YU9 C;  1O27 A;  3HKZ D;  1K83 K;  4XSX A;  1TWH A;  1UV7 A;  3GEI A;  4AH6 A;  2WB1 D;  4C3I C;  1TWA A;  5IOT A;  2O5J A;  2R93 A;  4BY7 K;  4A3E K;  2PA8 L;  2JA7 K;  4J3N A;  4BLA A;  3GTO K;  4NOI A;  2JA6 C;  3HOV C;  1YCL A;  3JST A;  4A3J K;  4KMH A;  1TWA C;  5D4D A;  3FOE A;  4P5A A;  3H3V L;  3M3Y K;  1ZVU A;  3A8J A;  3TFJ A;  2R93 C;  1ISE A;  3PO3 C;  1I6H K;  1SFO A;  3S16 K;  4OIQ A;  1PJ5 A;  1I3Q A;  4LQY A;  2NVT K;  3S1N K;  3SZZ A;  1GE9 A;  4GTA A;  4KMU A;  1DD5 A;  4FZB A;  2XCR B;  2PPB A;  4Q5S A;  1SFO C;  4OIR A;  5IYC C;  1Y1V A;  2JA7 A;  3N3Y A;  3GSI A;  4C3H K;  1F93 A;  2A69 A;  4G0W A;  3HOY C;  2R92 K;  4O2D A;  4BBS K;  3K7A C;  1F9N A;  3CAG A;  5C3E C;  3GTJ C;  4A3K K;  3HOZ K;  1IQ0 A;  1Y1V C;  5FJ8 K;  4PAA A;  4BY1 C;  4A3I K;  3BUE A;  2NVQ K;  3GTK A;  4A3G K;  5M5W K;  3FKI C;  2E2J K;  3GTG C;  1J98 A;  2CW0 A;  4KMD A;  4ZH4 A;  3S1R C;  2V6U A;  3LAP A;  4LK1 A;  3M4O C;  5IYD K;  1L0W A;  3GTQ K;  1Y1W C;  1XXA A;  1WCM C;  3GTK C;  1I50 C;  3L4K A;  2JA8 K;  2JA5 C;  4FM9 A;  3I4M K;  1IS1 A;  4MEX A;  1ZBS A;  1HI9 A;  2Y3P A;  1DCP A;  1B4B A;  3S15 K;  1JQW A;  4XSZ A;  2A68 A;  4M1X A;  2WAQ D;  3S1Q K;  1TWF C;  4Y7N K;  4G7H A;  1F7U A;  4BLB A;  2NVY K;  5C4J C;  4BXX C;  1B4A A;  3S2D K;  1BGW A;  3I4N K;  4X6A K;  4AYB D;  2R7Z C;  4LLG A;  3HOX C;  1F7V A;  2EBB A;  4KB2 A;  4P9S A;  4LJZ A;  2XCO A;  5C4X K;  1DCO A;  1JOE A;  2E2H C;  1O2A A;  5IP7 C;  4GTB A;  1TWG A;  4C3I K;  3S0X A;  1R9T A;  4G7O A;  2GSO A;  5JVO A;  3ERE D;  2E2I A;  3N0C A;  1WOR A;  2JA6 K;  1XZQ B;  3HOV K;  5TMC A;  1RU0 A;  4GTF A;  1PJ6 A;  4BBR C;  1R9T C;  3S14 C;  2B63 A;  1PJ7 A;  1WQG A;  2XCQ A;  3PO3 K;  4KAS A;  2GAH C;  2ZUE A;  1TWC C;  2NVX C;  1EFW A;  2WB1 L;  3T00 A;  3CQZ C;  3LPX A;  5IYB C;  4A3M C;  4XCH A;  4KC6 A;  5EGE A;  1TWH C;  2V6T A;  3GTM A;  3WOD A;  3S1M K;  4JK1 A;  4G7Z A;  4OIO A;  1WSV A;  3N0B A;  5E68 A;  2PA8 D;  3HOY K;  4QJV A;  1IW7 A;  3K7A K;  3Q3Q A;  2CFA A;  5C3E K;  4A3L C;  1WQF A;  3GTJ K;  1K83 A;  3T02 A;  3GTM C;  2Y0S D;  1O24 A;  3AD9 C;  3H3V D;  2VUM K;  1WOO A;  1IBA A;  5M3M K;  3GTP K;  3FKI K;  3GTG K;  3GTO A;  1K83 C;  2P5M A;  3S1R K;  1I3Q C;  3AD7 C;  5CJ9 A;  2BE5 A;  4C3J K;  3M4O K;  1Y1W K;  3AQP A;  1WCM K;  4BY7 C;  3NUH A;  1I50 K;  4A3E C;  4KM8 A;  4KN7 A;  2JA7 C;  3S17 C;  2JA5 K;  4KB4 A;  3PO2 C;  3HOU C;  4DDQ A;  3TFI A;  1O26 A;  2FQT A;  1IL2 A;  4LK0 A;  1ZQ1 C;  5FLM K;  2V6S A;  4GTL A;  3GTL K;  1XXB A;  5IOS A;  4A3B C;  3MML B;  1EI6 A;  1TWF K;  2PMZ L;  5C4J K;  2CFA B;  4KMA A;  1AB4 A;  2KWA A;  3H0G K;  3ADA C;  2GSU A;  2R7Z K;  3ORE A;  3AD8 C;  3HOX K;  1XPP A;  1XZP A;  3RZD C;  2R92 A;  1HQM A;  2ZUF A;  4GFQ A;  3G4A A;  2E2H K;  2GSN A;  5TJ3 A;  5IP7 K;  3HXA A;  1WIH A;  2W7V A;  1V5V A;  4OIP A;  4QIW D;  4GTE A;  2R92 C;  4C2M K;  4GZY A;  3EQL A;  4A3K C;  4A93 C;  1I6V A;  3GDZ A;  4GTC A;  2D6F C;  3S2H C;  3GTQ A;  4RMF A;  4A3I C;  2RH6 A;  3H0G A;  5TMF A;  4BBR K;  2NVQ C;  3S14 K;  2YU9 K;  5IP9 C;  4YFX A;  5CHP A;  1VRQ C;  4LR2 A;  1TWC K;  4A3F C;  2NVX K;  1ZXO A;  4A3C C;  5M3F K;  3CQZ K;  5IYB K;  2JA8 C;  4A3M K;  1TWH K;  1TWG C;  2NVY A;  4PAB A;  3I4M C;  3V4G A;  1TWA K;  1DCH A;  1INN A;  1WOP A;  2R93 K;  4YFK A;  4A3D C;  2ZFZ A;  2E2I C;  5JFE A;  3OEP A;  3S1Q C;  4Y7N C;  3HKZ L;  1EK8 A;  1IE0 A;  3T01 A;  2B63 C;  4G0U A;  5HL8 A;  4Y52 C;  3FHZ A;  2JH3 A;  4WJ4 A;  3AQO A;  3L4J A;  1C0A A;  1SFO K;  1O2B A;  4P5B A;  5IYC K;  4MQ9 A;  2JA6 A;  1I3Q K;  5C44 C;  2GAG C;  3HOW C;  1EH1 A;  3RZO C;  1G51 A;  1VJE A;  1WSR A;  3S17 K;  1Y1V K;  3G4C A;  3QX3 A;  3PO2 K;  3OPF A;  3HOU K;  4KN4 A;  4BY1 K;  3GIR A;  2Y0S L;  4WIL A;  2RGR A;  1YNJ A;  5L46 A;  4XLN A;  4A3B K;  1BS2 A;  3GEH A;  3A8I A;  3BP8 C;  3GTK K;  5IOQ A;  5IOR A;  1YNN A;  4GTD A;  3LAJ A;  3RZD K;  3GTO C;  2PHC B;  1J6X A;  4A3J C;  1J6W A;  3GTJ A;  1X31 C;  1YX2 A;  2A6E A;  3DXJ A;  3S1M C;  3M3Y C;  2VUM A;  4KAT A;  4OIN A;  1VGX A;  1I6H C;  4QJV B;  3GTP A;  4YFN A;  3FKI A;  3GTG A;  3S16 C;  4BXX K;  4A93 K;  3GEE A;  1BJT A;  3TFH A;  2NVT C;  3S1N C;  1JVI A;  3S2H K;  1EQR A;  2VUM C;  1Y1W A;  1WCM A;  3BP3 A;  2O5I A;  1BDF A;  1I50 A;  3AH5 A;  3GTP C;  2PMZ D;  4C3H C;  1WQH A;  5IP9 K;  2JA5 A;  4C45 A;  1WOS A;  3SZY A;  4MEY A;  1O2F B;  4C3J C;  4A3F K;  4KDD A;  2P8T A;  4BBS C;  2WAQ L;  4A3C K;  4QIW L;  3GTL A;  3HOZ C;  1VLO A;  1TWF A;  1XZQ A;  1TWG K;  4KM9 A;  4AYB L;  1R9T K;  4A3G C;  2R7Z A;  1USO A;  2E2J C;  1XXC A;  5FLM C;  4A3D K;  2E2I K;  3GTL C;  2FQO A;  4LOW A;  4WJ3 M;  5M5X K;  4G0V A;  1O25 A;  4YG2 A;  2E2H A;  4BKW A;  5IYD C;  3GTQ C; 
#chains in the Genus database with same CATH homology
 3H0G C;  3GTG K;  2B63 K;  1K83 C;  4LK1 A;  3M4O C;  4Y52 K;  1SMY A;  5IYD K;  3S1R K;  1Y1W C;  1I3Q C;  5IYC K;  1SFO K;  3GTQ K;  1WCM C;  4MQ9 A;  3GTK C;  2BE5 A;  1I50 C;  2JA8 K;  4C3J K;  3M4O K;  1Y1W K;  1I3Q K;  2JA5 C;  1WCM K;  4BY7 C;  5C44 C;  1I50 K;  5M5Y K;  4A3E C;  3I4M K;  3S15 C;  4KN7 A;  2JA7 C;  3S17 C;  2A6H A;  4MEX A;  3HOW C;  3RZO C;  2JA5 K;  3PO2 C;  5C44 K;  3S15 K;  3HOU C;  3S17 K;  1ZYR A;  1Y1V K;  4XSZ A;  3HOW K;  4A3L K;  3RZO K;  2A68 A;  2NVY C;  3PO2 K;  4LK0 A;  2WAQ D;  3HOU K;  3S1Q K;  1TWF C;  4KN4 A;  5FLM K;  4Y7N K;  4BY1 K;  3GTM K;  3I4N C;  4G7H A;  3GTL K;  2Y0S L;  3S2D C;  4X6A C;  2NVY K;  5C4J C;  4A3B C;  4BXX C;  1TWF K;  1YNJ A;  2PMZ L;  4XLP A;  3S2D K;  4Q4Z A;  3I4N K;  4X6A K;  4AYB D;  4XLN A;  5C4J K;  2R7Z C;  5C4X C;  4LLG A;  4A3B K;  3HOX C;  3H0G K;  2YU9 C;  3HKZ D;  1K83 K;  4LJZ A;  2R7Z K;  5C4X K;  3HOX K;  4XSX A;  1XPP A;  3RZD C;  2E2H C;  2WB1 D;  3GTK K;  1HQM A;  5IP7 C;  1YNN A;  2O5J A;  3RZD K;  2E2H K;  3GTO C;  4BY7 K;  4C3I K;  4A3E K;  2PA8 L;  5IP7 K;  2JA7 K;  4A3J C;  4G7O A;  3GTO K;  4NOI A;  2JA6 C;  4OIP A;  2A6E A;  4QIW D;  3DXJ A;  3HOV C;  3S1M C;  4A3J K;  3M3Y C;  2R92 C;  4C2M K;  1TWA C;  5D4D A;  2JA6 K;  3GTP K;  3H3V L;  4GZY A;  3HOV K;  4OIN A;  3EQL A;  5TMC A;  4A3K C;  3M3Y K;  4A93 C;  1I6V A;  4QJV B;  1I6H C;  4YFN A;  2R93 C;  4BXX K;  3S16 C;  4BBR C;  1R9T C;  3S14 C;  3PO3 C;  3S2H C;  4A93 K;  1I6H K;  4A3I C;  2NVT C;  3S16 K;  5TMF A;  4BBR K;  2NVQ C;  3S14 K;  3S1N C;  3PO3 K;  3S2H K;  4OIQ A;  2YU9 K;  2VUM C;  5IP9 C;  2NVT K;  3S1N K;  1TWC C;  1BDF A;  4YFX A;  2NVX C;  2O5I A;  3GTP C;  2WB1 L;  2PMZ D;  4KMU A;  5IP9 K;  3CQZ C;  5IYB C;  2PPB A;  1TWC K;  4A3F C;  4Q5S A;  2NVX K;  4A3M C;  1SFO C;  4OIR A;  5IYC C;  4A3C C;  4C3H K;  5M3F K;  3CQZ K;  1TWH C;  4MEY A;  5IYB K;  2JA8 C;  4A3F K;  4A3M K;  4BBS C;  2A69 A;  2WAQ L;  4A3C K;  4QIW L;  3WOD A;  3S1M K;  1TWH K;  1TWG C;  4JK1 A;  3I4M C;  3HOY C;  2R92 K;  4G7Z A;  4OIO A;  3HOZ C;  1TWA K;  4BBS K;  3K7A C;  3GTQ C;  5C3E C;  3GTJ C;  1TWG K;  4A3K K;  2PA8 D;  3HOY K;  4YFK A;  2R93 K;  3HOZ K;  4AYB L;  4A3D C;  1Y1V C;  4QJV A;  1IW7 A;  3K7A K;  2E2I C;  1R9T K;  5C3E K;  5FJ8 K;  4A3L C;  4A3G C;  3GTJ K;  3S1Q C;  2E2J C;  5FLM C;  3HKZ L;  4Y7N C;  4A3I K;  4BY1 C;  3GTM C;  2E2I K;  4A3D K;  2Y0S D;  2NVQ K;  3GTL C;  4A3G K;  5M5W K;  3FKI C;  5M5X K;  2VUM K;  2E2J K;  3GTG C;  4YG2 A;  3H3V D;  2CW0 A;  2B63 C;  4Y52 C;  5M3M K;  5IYD C;  4ZH4 A;  3S1R C;  3FKI K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...