4A3CK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3cK00
1HQMA 1I3QC 5M5YK 4Y52C 4A3EK 1TWCK 4BBSC 2NVTC 1SFOK 4G7ZA 1K83K 2CW0A 4YFXA 2PA8D 4A3FK 3S1MK 3HOWC 5IYBC 2WAQD 5M3FK 3PO2C 2R93K 3HOXK 2R7ZK 2B63C 3PO3K 2BE5A 4QIWD 3HKZD 1TWGK 4A3EC 1TWCC 4C3HK 1SFOC 4A3FC 1K83C 3S15K 3S1MC 4YFNA 5C4JK 5IP7K 3GTGK 2R93C 3HOXC 2R7ZC 2A6HA 3PO3C 1TWGC 4LLGA 3H3VL 4YG2A 5M5WK 5FJ8K 2JA8K 3S15C 4C2MK 4XLNA 5C4JC 5IP7C 3FKIK 3GTGC 4OIPA 4BY1K 1Y1WK 3GTJK 4A93K 2PMZL 2Y0SL 2JA6K 4Q5SA 4BY7K 2E2JK 4AYBD 3DXJA 4A3BK 4OINA 5IYCK 2JA8C 3HOVK 3S17K 4A3CK 3FKIC 3M4OK 4A3JK 4BY1C 3S1QK 4A3GK 1BDFA 1Y1WC 3GTJC 3HOZK 4A93C 5C44K 4XLPA 2E2IK 2JA6C 3S2HK 4BY7C 4A3IK 2A69A 3EQLA 2E2JC 4A3BC 3HOVC 5IYCC 3RZDK 1I50K 4BBRK 3S17C 5M5XK 4A3CC 1TWAK 2NVYK 4MEYA 4A3JC 3M4OC 3S16K 3S1QC 4A3DK 4A3GC 3I4NK 3HOZC 4G7HA 5C44C 2WB1L 5TMFA 2E2IC 3HOYK 3S2HC 4A3IC 4OIQA 3M3YK 3RZDC 1YNJA 4XSXA 1YNNA 1I50C 4BBRC 4Y7NK 2NVYC 1TWAC 2PA8L 3GTLK 3S16C 5C3EK 2NVXK 4A3LK 1I6VA 2WAQL 3I4NC 4A3DC 2O5IA 4JK1A 3GTMK 3HOYC 4QIWL 3HKZL 3M3YC 4OIRA 1I6HK 1WCMK 4QJVB 5IP9K 4Y7NC 3GTQK 3GTLC 1R9TK 3S1NK 5C3EC 2NVXC 4A3LC 4BXXK 4KMUA 3H0GK 3S1RK 2JA7K 2E2HK 3GTMC 3GTKK 4LJZA 4MQ9A 1TWHK 1I6HC 1WCMC 5IP9C 1I3QK 3GTQC 2NVQK 3CQZK 4NOIA 4QJVA 5M3MK 1ZYRA 1R9TC 1Y1VK 4KN7A 3S1NC 4BXXC 4A3KK 3S1RC 2JA7C 2E2HC 3GTKC 4G7OA 4GZYA 3GTOK 5TMCA 2YU9K 1TWHC 5IYDK 4AYBL 3H3VD 5D4DA 3S14K 5C4XK 2NVQC 3CQZC 4X6AC 3HOUK 1Y1VC 4KN4A 2R92K 2A68A 4C3IK 4A3KC 3RZOK 4LK1A 3GTOC 2YU9C 2Y0SD 2PMZD 5FLMK 3GTPK 2O5JA 2VUMK 5IYDC 3S14C 1XPPA 3WODA 5C4XC 4Q4ZA 3K7AK 3HOUC 3I4MK 2R92C 4ZH4A 1TWFK 3RZOC 3S2DK 4C3JK 5FLMC 3GTPC 4A3MK 4OIOA 2VUMC 1IW7A 2JA5K 4Y52K 3K7AC 2A6EA 4XSZA 3I4MC 4BBSK 2NVTK 2PPBA 1TWFC 3H0GC 4YFKA 3HOWK 4X6AK 5IYBK 1SMYA 3PO2K 4MEXA 3S2DC 2WB1D 4A3MC 2B63K 2JA5C 4LK0A
chains in the Genus database with same CATH superfamily
5M5YK 1TWCK 5CJ9A 1USOA 2NVTC 4YFXA 2PA8D 1VRQC 5E68A 4KAWX 3PO2C 3HOXK 3IPJA 2BE5A 1TWGK 1XZQB 3TTGA 1TWCC 4LR2A 1BS2A 3ERED 3H0GA 1F7UA 5C4JK 5IP7K 3HOXC 4DDQA 1G51A 1TWGC 1XZQA 3H3VL 2JA8K 2V6UA 3A8JA 5C4JC 5IP7C 1L0WA 3SZYA 1EI6A 2XCQA 2ZUFA 3GTJK 1XZPB 2Y0SL 1YX2A 1K83A 2JA8C 2XCOA 2P8TA 1J98A 3S1QK 1USMA 3GTJC 2E2IK 3AD8C 3EQLA 1XZPA 1IL2A 4GTEA 5M5XK 1VJEA 3S1QC 1C0AA 2E2IC 4XSXA 1YNNA 4Y7NK 3GTLK 4KC6A 2PA8L 2NVXK 5EGHA 4A3LK 2JA6A 2O5IA 4OIRA 2V6SA 4Y7NC 3GTLC 1R9TK 2NVXC 4A3LC 4BXXK 2GSOA 3H0GK 4LJZA 4MQ9A 1I50A 1TWAA 2NVYA 1WQGA 4X6AK 1R9TC 5M3MK 1ZYRA 4BXXC 5TMCA 3JSTA 5IYDK 5C4XK 4X6AC 1F9NA 2FQOA 5IORA 1VH2A 1YCLA 3T00A 3GTPK 1WCMA 2VUMK 5IYDC 4KDDA 5C4XC 1DCPA 4Q4ZA 3I4MK 2JA7A 1O24A 4KATA 4ZH4A 1V5VA 3AD7C 3GEHA 3GTPC 1O2BA 4OIOA 2VUMC 4GTAA 4Y52K 3I4MC 2P5MA 4C45A 3GTOA 3HOWK 2B63K 1I3QC 4Y52C 1WQHA 4G7ZA 3S1MK 3GIRA 3HOWC 2RH6A 2R93K 2R7ZK 2B63C 4QIWD 3HKZD 4PABA 4C3HK 1TWFA 3S15K 1AB4A 3AD9C 3S1MC 4YFNA 2R93C 3BUEA 2R7ZC 3N0BA 4PAAA 3SZZA 3CQZA 4C3HC 1WOPA 3V4GA 3S15C 3FHZA 1O2AA 3LAJA 3FKIK 4OIPA 4KMAA 4Q5SA 4BY7K 3TFIA 3NUHA 1SFOA 3DXJA 3HOVK 5IYCK 4KASA 4WJ3M 1WOSA 3FKIC 3M4OK 4BY7C 4KMDA 4A3IK 2A69A 4KARA 1J6VA 3L4KA 5IYCC 3HOVC 3GTGA 3M4OC 1O26A 4A3IC 3M3YK 5IOQA 1Y1WA 5C3EK 4G0UA 2GAGC 5CHPA 4QIWL 1J6WA 3HKZL 5JVOA 3M3YC 3Q3QA 4P9SA 5C3EC 1O29A 1RU0A 3TFHA 3GEEA 3OREA 4BLBA 3CQZK 3CAGA 1Y1VK 3A8IA 4A3KK 4GZYA 4G7OA 4GTCA 2YU9K 4P5AA 5D4DA 3QX3A 3S14K 3CQZC 3HOUK 1Y1VC 2A68A 4C3IK 3GTMA 4A3KC 4LK1A 2YU9C 2KWAA 1EQRA 5FLMK 3GTQA 3S14C 1XPPA 3WODA 3HOUC 4C3IC 2E2HA 3GTKA 2Y3PA 1IQ0A 1WIHA 3LPXA 5FLMC 2GSNA 1WQFA 2A6EA 3G4AA 2PPBA 4G0WA 3H0GC 4KM8A 5IYBK 2XCRB 1SMYA 2WB1D 4OINA 1HI9A 1HQMA 4A3EK 2R92A 3A8KA 1K83K 2CW0A 3ADAC 1PJ5A 5IOSA 4A3FK 4GTLA 5IYBC 2CFAB 2GAHC 3PO3K 1WSVA 5L46A 1EFWA 3FOEA 4A3EC 3HXAA 1JVIA 4A3FC 1K83C 1O25A 1KQ4A 3FOFA 1PJ6A 2A6HA 2JA5A 3PO3C 1EH1A 4GTDA 4FM9A 4YG2A 5M5WK 2ZUEA 4XLNA 2EBBA 4BY1K 1TWCA 2JA6K 2E2JK 4GTFA 3N3YA 1DCOA 3S17K 4A3CK 1O2FB 4A3JK 1F7VA 4BY1C 1TWGA 3HOZK 2JA6C 2E2JC 1I50K 3S17C 4A3CC 4GTBA 4LQYA 1TWAK 1PJ7A 2NVYK 4MEYA 4A3JC 3HOZC 2WB1L 3HOYK 1JOEA 4GFQA 4OIQA 1I50C 1TWAC 1ISEA 2NVYC 1INNA 4JK1A 3HOYC 5JFEA 1I6HK 1WCMK 4QJVB 2E2IA 2JA7K 1I6HC 1WCMC 1O27A 3OEPA 4P5BA 1JQWA 3GDZA 4QJVA 2JA7C 3GTOK 3GTLA 3OPFA 2NVXA 3S0XA 3AQOA 3RZOK 3GTOC 2PMZD 3GEIA 3AQPA 1R9TA 2FQTA 4FZBA 1TWFK 2GSUA 3RZOC 1BJTA 4KB4A 4LOWA 3S2DK 3LAPA 4BBSK 1TWFC 3S2DC 5TJ3A 4O2DA 1ZQ1C 1XXAA 4BBSC 3T02A 1DD5A 1SFOK 2WAQD 1EK8A 5M3FK 3GTPA 2VUMA 1BGWA 4GT9A 2JH3A 3TFJA 2V6TA 4J3NA 1SFOC 1TWHA 3GTGK 1ZBSA 1I3QA 4LLGA 1XXBA 5FJ8K 4G0VA 4C2MK 4AH6A 3L4JA 1VLOA 3GTGC 2B63A 1UV7A 1Y1WK 4A93K 2PMZL 2ZFZA 1ZVUA 4AYBD 4A3BK 1VGXA 3BP3A 4C2MC 3BP8C 2R93A 4BKWA 2R7ZA 4A3GK 4KB2A 1B4BA 1BDFA 5EGEA 1Y1WC 4A93C 5C44K 1F93A 4XLPA 3S2HK 1X31C 4XCHA 4A3BC 3RZDK 3N0CA 4BBRK 3AH5A 3S16K 4A3DK 4A3GC 4KMHA 3I4NK 2CFAA 4G7HA 5C44C 5TMFA 3S2HC 1GE9A 3RZDC 1YNJA 1J6XA 3FKIA 4BBRC 1DCHA 1IS1A 3S16C 4A3DC 1I6VA 2WAQL 3I4NC 3GTMK 2D6FC 4WILA 1IBAA 5IP9K 3GTQK 3VA7A 3S1NK 1IE0A 1XXCA 4KMUA 3S1RK 2E2HK 3GTMC 3GTKK 1WORA 4ILDA 1TWHK 1WSRA 5IP9C 2RGRA 1I3QK 3GTQC 2NVQK 4BLAA 4NOIA 3S1NC 5IOTA 4KN7A 5HL8A 3T01A 3S1RC 2E2HC 3GTKC 1TWHC 2W7VA 1ZXOA 3MMLB 4AYBL 4RMFA 3H3VD 4WJ4A 2NVQC 4KN4A 3GTJA 2R92K 2Y0SD 4KM9A 2O5JA 3K7AK 3GSIA 2R92C 4C3JK 2PHCB 4A3MK 1B4AA 1IW7A 1O28A 2JA5K 1Y1VA 3K7AC 4XSZA 2NVTK 1WOOA 4M1XA 3G4CA 4YFKA 2YU9A 3PO2K 4C3JC 4MEXA 4A3MC 2JA5C 4LK0A
chains in the Genus database with same CATH topology
1HQMA 1I3QC 5M5YK 4Y52C 4A3EK 1TWCK 4BBSC 2NVTC 1SFOK 4G7ZA 1K83K 2CW0A 4YFXA 2PA8D 4A3FK 3S1MK 3HOWC 5IYBC 2WAQD 5M3FK 3PO2C 2R93K 3HOXK 2R7ZK 2B63C 3PO3K 2BE5A 4QIWD 3HKZD 1TWGK 4A3EC 1TWCC 4C3HK 1SFOC 4A3FC 1K83C 3S15K 3S1MC 4YFNA 5C4JK 5IP7K 3GTGK 2R93C 3HOXC 2R7ZC 2A6HA 3PO3C 1TWGC 4LLGA 3H3VL 4YG2A 5M5WK 5FJ8K 2JA8K 3S15C 4C2MK 4XLNA 5C4JC 5IP7C 3FKIK 3GTGC 4OIPA 4BY1K 1Y1WK 3GTJK 4A93K 2PMZL 2Y0SL 2JA6K 4Q5SA 4BY7K 2E2JK 4AYBD 3DXJA 4A3BK 4OINA 5IYCK 2JA8C 3HOVK 3S17K 4A3CK 3FKIC 3M4OK 4A3JK 4BY1C 3S1QK 4A3GK 1BDFA 1Y1WC 3GTJC 3HOZK 4A93C 5C44K 4XLPA 2E2IK 2JA6C 3S2HK 4BY7C 4A3IK 2A69A 3EQLA 2E2JC 4A3BC 3HOVC 5IYCC 3RZDK 1I50K 4BBRK 3S17C 5M5XK 4A3CC 1TWAK 2NVYK 4MEYA 4A3JC 3M4OC 3S16K 3S1QC 4A3DK 4A3GC 3I4NK 3HOZC 4G7HA 5C44C 2WB1L 5TMFA 2E2IC 3HOYK 3S2HC 4A3IC 4OIQA 3M3YK 3RZDC 1YNJA 4XSXA 1YNNA 1I50C 4BBRC 4Y7NK 2NVYC 1TWAC 2PA8L 3GTLK 3S16C 5C3EK 2NVXK 4A3LK 1I6VA 2WAQL 3I4NC 4A3DC 2O5IA 4JK1A 3GTMK 3HOYC 4QIWL 3HKZL 3M3YC 4OIRA 1I6HK 1WCMK 4QJVB 5IP9K 4Y7NC 3GTQK 3GTLC 1R9TK 3S1NK 5C3EC 2NVXC 4A3LC 4BXXK 4KMUA 3H0GK 3S1RK 2JA7K 2E2HK 3GTMC 3GTKK 4LJZA 4MQ9A 1TWHK 1I6HC 1WCMC 5IP9C 1I3QK 3GTQC 2NVQK 3CQZK 4NOIA 4QJVA 5M3MK 1ZYRA 1R9TC 1Y1VK 4KN7A 3S1NC 4BXXC 4A3KK 3S1RC 2JA7C 2E2HC 3GTKC 4G7OA 4GZYA 3GTOK 5TMCA 2YU9K 1TWHC 5IYDK 4AYBL 3H3VD 5D4DA 3S14K 5C4XK 2NVQC 3CQZC 4X6AC 3HOUK 1Y1VC 4KN4A 2R92K 2A68A 4C3IK 4A3KC 3RZOK 4LK1A 3GTOC 2YU9C 2Y0SD 2PMZD 5FLMK 3GTPK 2O5JA 2VUMK 5IYDC 3S14C 1XPPA 3WODA 5C4XC 4Q4ZA 3K7AK 3HOUC 3I4MK 2R92C 4ZH4A 1TWFK 3RZOC 3S2DK 4C3JK 5FLMC 3GTPC 4A3MK 4OIOA 2VUMC 1IW7A 2JA5K 4Y52K 3K7AC 2A6EA 4XSZA 3I4MC 4BBSK 2NVTK 2PPBA 1TWFC 3H0GC 4YFKA 3HOWK 4X6AK 5IYBK 1SMYA 3PO2K 4MEXA 3S2DC 2WB1D 4A3MC 2B63K 2JA5C 4LK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  1I3Q C;  5M5Y K;  4Y52 C;  4A3E K;  1TWC K;  4BBS C;  2NVT C;  1SFO K;  4G7Z A;  1K83 K;  2CW0 A;  4YFX A;  2PA8 D;  4A3F K;  3S1M K;  3HOW C;  5IYB C;  2WAQ D;  5M3F K;  3PO2 C;  2R93 K;  3HOX K;  2R7Z K;  2B63 C;  3PO3 K;  2BE5 A;  4QIW D;  3HKZ D;  1TWG K;  4A3E C;  1TWC C;  4C3H K;  1SFO C;  4A3F C;  1K83 C;  3S15 K;  3S1M C;  4YFN A;  5C4J K;  5IP7 K;  3GTG K;  2R93 C;  3HOX C;  2R7Z C;  2A6H A;  3PO3 C;  1TWG C;  4LLG A;  3H3V L;  4YG2 A;  5M5W K;  5FJ8 K;  2JA8 K;  3S15 C;  4C2M K;  4XLN A;  5C4J C;  5IP7 C;  3FKI K;  3GTG C;  4OIP A;  4BY1 K;  1Y1W K;  3GTJ K;  4A93 K;  2PMZ L;  2Y0S L;  2JA6 K;  4Q5S A;  4BY7 K;  2E2J K;  4AYB D;  3DXJ A;  4A3B K;  4OIN A;  5IYC K;  2JA8 C;  3HOV K;  3S17 K;  4A3C K;  3FKI C;  3M4O K;  4A3J K;  4BY1 C;  3S1Q K;  4A3G K;  1BDF A;  1Y1W C;  3GTJ C;  3HOZ K;  4A93 C;  5C44 K;  4XLP A;  2E2I K;  2JA6 C;  3S2H K;  4BY7 C;  4A3I K;  2A69 A;  3EQL A;  2E2J C;  4A3B C;  3HOV C;  5IYC C;  3RZD K;  1I50 K;  4BBR K;  3S17 C;  5M5X K;  4A3C C;  1TWA K;  2NVY K;  4MEY A;  4A3J C;  3M4O C;  3S16 K;  3S1Q C;  4A3D K;  4A3G C;  3I4N K;  3HOZ C;  4G7H A;  5C44 C;  2WB1 L;  5TMF A;  2E2I C;  3HOY K;  3S2H C;  4A3I C;  4OIQ A;  3M3Y K;  3RZD C;  1YNJ A;  4XSX A;  1YNN A;  1I50 C;  4BBR C;  4Y7N K;  2NVY C;  1TWA C;  2PA8 L;  3GTL K;  3S16 C;  5C3E K;  2NVX K;  4A3L K;  1I6V A;  2WAQ L;  3I4N C;  4A3D C;  2O5I A;  4JK1 A;  3GTM K;  3HOY C;  4QIW L;  3HKZ L;  3M3Y C;  4OIR A;  1I6H K;  1WCM K;  4QJV B;  5IP9 K;  4Y7N C;  3GTQ K;  3GTL C;  1R9T K;  3S1N K;  5C3E C;  2NVX C;  4A3L C;  4BXX K;  4KMU A;  3H0G K;  3S1R K;  2JA7 K;  2E2H K;  3GTM C;  3GTK K;  4LJZ A;  4MQ9 A;  1TWH K;  1I6H C;  1WCM C;  5IP9 C;  1I3Q K;  3GTQ C;  2NVQ K;  3CQZ K;  4NOI A;  4QJV A;  5M3M K;  1ZYR A;  1R9T C;  1Y1V K;  4KN7 A;  3S1N C;  4BXX C;  4A3K K;  3S1R C;  2JA7 C;  2E2H C;  3GTK C;  4G7O A;  4GZY A;  3GTO K;  5TMC A;  2YU9 K;  1TWH C;  5IYD K;  4AYB L;  3H3V D;  5D4D A;  3S14 K;  5C4X K;  2NVQ C;  3CQZ C;  4X6A C;  3HOU K;  1Y1V C;  4KN4 A;  2R92 K;  2A68 A;  4C3I K;  4A3K C;  3RZO K;  4LK1 A;  3GTO C;  2YU9 C;  2Y0S D;  2PMZ D;  5FLM K;  3GTP K;  2O5J A;  2VUM K;  5IYD C;  3S14 C;  1XPP A;  3WOD A;  5C4X C;  4Q4Z A;  3K7A K;  3HOU C;  3I4M K;  2R92 C;  4ZH4 A;  1TWF K;  3RZO C;  3S2D K;  4C3J K;  5FLM C;  3GTP C;  4A3M K;  4OIO A;  2VUM C;  1IW7 A;  2JA5 K;  4Y52 K;  3K7A C;  2A6E A;  4XSZ A;  3I4M C;  4BBS K;  2NVT K;  2PPB A;  1TWF C;  3H0G C;  4YFK A;  3HOW K;  4X6A K;  5IYB K;  1SMY A;  3PO2 K;  4MEX A;  3S2D C;  2WB1 D;  4A3M C;  2B63 K;  2JA5 C;  4LK0 A; 
#chains in the Genus database with same CATH topology
 5M5Y K;  1TWC K;  5CJ9 A;  1USO A;  2NVT C;  4YFX A;  2PA8 D;  1VRQ C;  5E68 A;  4KAW X;  3PO2 C;  3HOX K;  3IPJ A;  2BE5 A;  1TWG K;  1XZQ B;  3TTG A;  1TWC C;  4LR2 A;  1BS2 A;  3ERE D;  3H0G A;  1F7U A;  5C4J K;  5IP7 K;  3HOX C;  4DDQ A;  1G51 A;  1TWG C;  1XZQ A;  3H3V L;  2JA8 K;  2V6U A;  3A8J A;  5C4J C;  5IP7 C;  1L0W A;  3SZY A;  1EI6 A;  2XCQ A;  2ZUF A;  3GTJ K;  1XZP B;  2Y0S L;  1YX2 A;  1K83 A;  2JA8 C;  2XCO A;  2P8T A;  1J98 A;  3S1Q K;  1USM A;  3GTJ C;  2E2I K;  3AD8 C;  3EQL A;  1XZP A;  1IL2 A;  4GTE A;  5M5X K;  1VJE A;  3S1Q C;  1C0A A;  2E2I C;  4XSX A;  1YNN A;  4Y7N K;  3GTL K;  4KC6 A;  2PA8 L;  2NVX K;  5EGH A;  4A3L K;  2JA6 A;  2O5I A;  4OIR A;  2V6S A;  4Y7N C;  3GTL C;  1R9T K;  2NVX C;  4A3L C;  4BXX K;  2GSO A;  3H0G K;  4LJZ A;  4MQ9 A;  1I50 A;  1TWA A;  2NVY A;  1WQG A;  4X6A K;  1R9T C;  5M3M K;  1ZYR A;  4BXX C;  5TMC A;  3JST A;  5IYD K;  5C4X K;  4X6A C;  1F9N A;  2FQO A;  5IOR A;  1VH2 A;  1YCL A;  3T00 A;  3GTP K;  1WCM A;  2VUM K;  5IYD C;  4KDD A;  5C4X C;  1DCP A;  4Q4Z A;  3I4M K;  2JA7 A;  1O24 A;  4KAT A;  4ZH4 A;  1V5V A;  3AD7 C;  3GEH A;  3GTP C;  1O2B A;  4OIO A;  2VUM C;  4GTA A;  4Y52 K;  3I4M C;  2P5M A;  4C45 A;  3GTO A;  3HOW K;  2B63 K;  1I3Q C;  4Y52 C;  1WQH A;  4G7Z A;  3S1M K;  3GIR A;  3HOW C;  2RH6 A;  2R93 K;  2R7Z K;  2B63 C;  4QIW D;  3HKZ D;  4PAB A;  4C3H K;  1TWF A;  3S15 K;  1AB4 A;  3AD9 C;  3S1M C;  4YFN A;  2R93 C;  3BUE A;  2R7Z C;  3N0B A;  4PAA A;  3SZZ A;  3CQZ A;  4C3H C;  1WOP A;  3V4G A;  3S15 C;  3FHZ A;  1O2A A;  3LAJ A;  3FKI K;  4OIP A;  4KMA A;  4Q5S A;  4BY7 K;  3TFI A;  3NUH A;  1SFO A;  3DXJ A;  3HOV K;  5IYC K;  4KAS A;  4WJ3 M;  1WOS A;  3FKI C;  3M4O K;  4BY7 C;  4KMD A;  4A3I K;  2A69 A;  4KAR A;  1J6V A;  3L4K A;  5IYC C;  3HOV C;  3GTG A;  3M4O C;  1O26 A;  4A3I C;  3M3Y K;  5IOQ A;  1Y1W A;  5C3E K;  4G0U A;  2GAG C;  5CHP A;  4QIW L;  1J6W A;  3HKZ L;  5JVO A;  3M3Y C;  3Q3Q A;  4P9S A;  5C3E C;  1O29 A;  1RU0 A;  3TFH A;  3GEE A;  3ORE A;  4BLB A;  3CQZ K;  3CAG A;  1Y1V K;  3A8I A;  4A3K K;  4GZY A;  4G7O A;  4GTC A;  2YU9 K;  4P5A A;  5D4D A;  3QX3 A;  3S14 K;  3CQZ C;  3HOU K;  1Y1V C;  2A68 A;  4C3I K;  3GTM A;  4A3K C;  4LK1 A;  2YU9 C;  2KWA A;  1EQR A;  5FLM K;  3GTQ A;  3S14 C;  1XPP A;  3WOD A;  3HOU C;  4C3I C;  2E2H A;  3GTK A;  2Y3P A;  1IQ0 A;  1WIH A;  3LPX A;  5FLM C;  2GSN A;  1WQF A;  2A6E A;  3G4A A;  2PPB A;  4G0W A;  3H0G C;  4KM8 A;  5IYB K;  2XCR B;  1SMY A;  2WB1 D;  4OIN A;  1HI9 A;  1HQM A;  4A3E K;  2R92 A;  3A8K A;  1K83 K;  2CW0 A;  3ADA C;  1PJ5 A;  5IOS A;  4A3F K;  4GTL A;  5IYB C;  2CFA B;  2GAH C;  3PO3 K;  1WSV A;  5L46 A;  1EFW A;  3FOE A;  4A3E C;  3HXA A;  1JVI A;  4A3F C;  1K83 C;  1O25 A;  1KQ4 A;  3FOF A;  1PJ6 A;  2A6H A;  2JA5 A;  3PO3 C;  1EH1 A;  4GTD A;  4FM9 A;  4YG2 A;  5M5W K;  2ZUE A;  4XLN A;  2EBB A;  4BY1 K;  1TWC A;  2JA6 K;  2E2J K;  4GTF A;  3N3Y A;  1DCO A;  3S17 K;  4A3C K;  1O2F B;  4A3J K;  1F7V A;  4BY1 C;  1TWG A;  3HOZ K;  2JA6 C;  2E2J C;  1I50 K;  3S17 C;  4A3C C;  4GTB A;  4LQY A;  1TWA K;  1PJ7 A;  2NVY K;  4MEY A;  4A3J C;  3HOZ C;  2WB1 L;  3HOY K;  1JOE A;  4GFQ A;  4OIQ A;  1I50 C;  1TWA C;  1ISE A;  2NVY C;  1INN A;  4JK1 A;  3HOY C;  5JFE A;  1I6H K;  1WCM K;  4QJV B;  2E2I A;  2JA7 K;  1I6H C;  1WCM C;  1O27 A;  3OEP A;  4P5B A;  1JQW A;  3GDZ A;  4QJV A;  2JA7 C;  3GTO K;  3GTL A;  3OPF A;  2NVX A;  3S0X A;  3AQO A;  3RZO K;  3GTO C;  2PMZ D;  3GEI A;  3AQP A;  1R9T A;  2FQT A;  4FZB A;  1TWF K;  2GSU A;  3RZO C;  1BJT A;  4KB4 A;  4LOW A;  3S2D K;  3LAP A;  4BBS K;  1TWF C;  3S2D C;  5TJ3 A;  4O2D A;  1ZQ1 C;  1XXA A;  4BBS C;  3T02 A;  1DD5 A;  1SFO K;  2WAQ D;  1EK8 A;  5M3F K;  3GTP A;  2VUM A;  1BGW A;  4GT9 A;  2JH3 A;  3TFJ A;  2V6T A;  4J3N A;  1SFO C;  1TWH A;  3GTG K;  1ZBS A;  1I3Q A;  4LLG A;  1XXB A;  5FJ8 K;  4G0V A;  4C2M K;  4AH6 A;  3L4J A;  1VLO A;  3GTG C;  2B63 A;  1UV7 A;  1Y1W K;  4A93 K;  2PMZ L;  2ZFZ A;  1ZVU A;  4AYB D;  4A3B K;  1VGX A;  3BP3 A;  4C2M C;  3BP8 C;  2R93 A;  4BKW A;  2R7Z A;  4A3G K;  4KB2 A;  1B4B A;  1BDF A;  5EGE A;  1Y1W C;  4A93 C;  5C44 K;  1F93 A;  4XLP A;  3S2H K;  1X31 C;  4XCH A;  4A3B C;  3RZD K;  3N0C A;  4BBR K;  3AH5 A;  3S16 K;  4A3D K;  4A3G C;  4KMH A;  3I4N K;  2CFA A;  4G7H A;  5C44 C;  5TMF A;  3S2H C;  1GE9 A;  3RZD C;  1YNJ A;  1J6X A;  3FKI A;  4BBR C;  1DCH A;  1IS1 A;  3S16 C;  4A3D C;  1I6V A;  2WAQ L;  3I4N C;  3GTM K;  2D6F C;  4WIL A;  1IBA A;  5IP9 K;  3GTQ K;  3VA7 A;  3S1N K;  1IE0 A;  1XXC A;  4KMU A;  3S1R K;  2E2H K;  3GTM C;  3GTK K;  1WOR A;  4ILD A;  1TWH K;  1WSR A;  5IP9 C;  2RGR A;  1I3Q K;  3GTQ C;  2NVQ K;  4BLA A;  4NOI A;  3S1N C;  5IOT A;  4KN7 A;  5HL8 A;  3T01 A;  3S1R C;  2E2H C;  3GTK C;  1TWH C;  2W7V A;  1ZXO A;  3MML B;  4AYB L;  4RMF A;  3H3V D;  4WJ4 A;  2NVQ C;  4KN4 A;  3GTJ A;  2R92 K;  2Y0S D;  4KM9 A;  2O5J A;  3K7A K;  3GSI A;  2R92 C;  4C3J K;  2PHC B;  4A3M K;  1B4A A;  1IW7 A;  1O28 A;  2JA5 K;  1Y1V A;  3K7A C;  4XSZ A;  2NVT K;  1WOO A;  4M1X A;  3G4C A;  4YFK A;  2YU9 A;  3PO2 K;  4C3J C;  4MEX A;  4A3M C;  2JA5 C;  4LK0 A; 
#chains in the Genus database with same CATH homology
 1HQM A;  1I3Q C;  5M5Y K;  4Y52 C;  4A3E K;  1TWC K;  4BBS C;  2NVT C;  1SFO K;  4G7Z A;  1K83 K;  2CW0 A;  4YFX A;  2PA8 D;  4A3F K;  3S1M K;  3HOW C;  5IYB C;  2WAQ D;  5M3F K;  3PO2 C;  2R93 K;  3HOX K;  2R7Z K;  2B63 C;  3PO3 K;  2BE5 A;  4QIW D;  3HKZ D;  1TWG K;  4A3E C;  1TWC C;  4C3H K;  1SFO C;  4A3F C;  1K83 C;  3S15 K;  3S1M C;  4YFN A;  5C4J K;  5IP7 K;  3GTG K;  2R93 C;  3HOX C;  2R7Z C;  2A6H A;  3PO3 C;  1TWG C;  4LLG A;  3H3V L;  4YG2 A;  5M5W K;  5FJ8 K;  2JA8 K;  3S15 C;  4C2M K;  4XLN A;  5C4J C;  5IP7 C;  3FKI K;  3GTG C;  4OIP A;  4BY1 K;  1Y1W K;  3GTJ K;  4A93 K;  2PMZ L;  2Y0S L;  2JA6 K;  4Q5S A;  4BY7 K;  2E2J K;  4AYB D;  3DXJ A;  4A3B K;  4OIN A;  5IYC K;  2JA8 C;  3HOV K;  3S17 K;  4A3C K;  3FKI C;  3M4O K;  4A3J K;  4BY1 C;  3S1Q K;  4A3G K;  1BDF A;  1Y1W C;  3GTJ C;  3HOZ K;  4A93 C;  5C44 K;  4XLP A;  2E2I K;  2JA6 C;  3S2H K;  4BY7 C;  4A3I K;  2A69 A;  3EQL A;  2E2J C;  4A3B C;  3HOV C;  5IYC C;  3RZD K;  1I50 K;  4BBR K;  3S17 C;  5M5X K;  4A3C C;  1TWA K;  2NVY K;  4MEY A;  4A3J C;  3M4O C;  3S16 K;  3S1Q C;  4A3D K;  4A3G C;  3I4N K;  3HOZ C;  4G7H A;  5C44 C;  2WB1 L;  5TMF A;  2E2I C;  3HOY K;  3S2H C;  4A3I C;  4OIQ A;  3M3Y K;  3RZD C;  1YNJ A;  4XSX A;  1YNN A;  1I50 C;  4BBR C;  4Y7N K;  2NVY C;  1TWA C;  2PA8 L;  3GTL K;  3S16 C;  5C3E K;  2NVX K;  4A3L K;  1I6V A;  2WAQ L;  3I4N C;  4A3D C;  2O5I A;  4JK1 A;  3GTM K;  3HOY C;  4QIW L;  3HKZ L;  3M3Y C;  4OIR A;  1I6H K;  1WCM K;  4QJV B;  5IP9 K;  4Y7N C;  3GTQ K;  3GTL C;  1R9T K;  3S1N K;  5C3E C;  2NVX C;  4A3L C;  4BXX K;  4KMU A;  3H0G K;  3S1R K;  2JA7 K;  2E2H K;  3GTM C;  3GTK K;  4LJZ A;  4MQ9 A;  1TWH K;  1I6H C;  1WCM C;  5IP9 C;  1I3Q K;  3GTQ C;  2NVQ K;  3CQZ K;  4NOI A;  4QJV A;  5M3M K;  1ZYR A;  1R9T C;  1Y1V K;  4KN7 A;  3S1N C;  4BXX C;  4A3K K;  3S1R C;  2JA7 C;  2E2H C;  3GTK C;  4G7O A;  4GZY A;  3GTO K;  5TMC A;  2YU9 K;  1TWH C;  5IYD K;  4AYB L;  3H3V D;  5D4D A;  3S14 K;  5C4X K;  2NVQ C;  3CQZ C;  4X6A C;  3HOU K;  1Y1V C;  4KN4 A;  2R92 K;  2A68 A;  4C3I K;  4A3K C;  3RZO K;  4LK1 A;  3GTO C;  2YU9 C;  2Y0S D;  2PMZ D;  5FLM K;  3GTP K;  2O5J A;  2VUM K;  5IYD C;  3S14 C;  1XPP A;  3WOD A;  5C4X C;  4Q4Z A;  3K7A K;  3HOU C;  3I4M K;  2R92 C;  4ZH4 A;  1TWF K;  3RZO C;  3S2D K;  4C3J K;  5FLM C;  3GTP C;  4A3M K;  4OIO A;  2VUM C;  1IW7 A;  2JA5 K;  4Y52 K;  3K7A C;  2A6E A;  4XSZ A;  3I4M C;  4BBS K;  2NVT K;  2PPB A;  1TWF C;  3H0G C;  4YFK A;  3HOW K;  4X6A K;  5IYB K;  1SMY A;  3PO2 K;  4MEX A;  3S2D C;  2WB1 D;  4A3M C;  2B63 K;  2JA5 C;  4LK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...