4A3CK

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3cK00
4A93K 3HOYC 3GTJK 4A3LC 4A3MC 1XPPA 2Y0SD 5IP9K 3GTKK 4G7OA 3FKIK 5IP7C 4BY7C 1R9TC 2E2HK 3RZOK 3S16K 5C4XK 2NVTK 3DXJA 4LLGA 2Y0SL 4G7ZA 3HOVK 2JA5C 2JA6K 5IYBC 4Y7NC 2JA7C 3H3VD 4BBSC 4A3GK 3I4MK 5M5XK 3HOUC 4YG2A 4ZH4A 5C4JC 3H0GK 4MQ9A 2R7ZK 3S2HK 2BE5A 1Y1WC 2E2IC 3H3VL 4A93C 4QIWD 3S14K 3S1QC 2WAQL 1SFOK 2NVXK 3RZDK 3WODA 3CQZK 3S15K 4G7HA 3FKIC 3K7AK 2VUMK 3PO2K 1TWFK 3GTGC 4A3KK 3S1MC 4NOIA 2A6HA 4A3CC 1ZYRA 3HOZC 2NVQC 5C44C 4C3IK 3S1NC 1TWAK 1Y1VK 4C3HK 3GTLC 2R92K 3H0GC 1TWCK 4A3FC 4YFXA 2A69A 3GTPC 5M5YK 1K83K 1WCMC 3PO3C 2JA8K 3GTOC 3GTMC 3HOWK 4Y52K 4MEYA 4A3EK 3M3YK 5IYCK 2NVXC 4A3DC 3GTQK 1I50C 3CQZC 4OIOA 4A3JC 1I3QK 4KN4A 2VUMC 4X6AK 2PMZD 4A3GC 5M3MK 3EQLA 2R93K 4KMUA 1I6HK 3GTJC 4BBRK 2PMZL 2R92C 5IP9C 2PA8D 5C3EK 3GTKC 3M4OC 3S2DK 2E2JK 4QIWL 3RZOC 2E2HC 3M3YC 3S16C 3GTQC 5C4XC 2NVTC 3HOVC 5TMCA 4LJZA 5IYDC 2PA8L 2CW0A 5TMFA 4C2MK 4XLNA 2YU9K 2JA6C 5FLMK 4C3JK 3I4MC 3S17K 3I4NK 4BXXK 1TWGK 1YNNA 2R7ZC 3S2HC 3HOYK 2R93C 3M4OK 3S14C 1SFOC 4A3MK 3RZDC 3S15C 4Q5SA 5C3EC 5IP7K 3S2DC 4BY7K 2NVYK 3K7AC 1R9TK 2O5IA 5M3FK 3PO2C 1TWFC 3HOXK 4A3KC 2PPBA 3S1RK 4GZYA 5IYDK 1IW7A 2YU9C 3HKZD 5IYBK 3HOUK 1TWAC 1Y1VC 5C4JK 4OIQA 4LK1A 1TWCC 4A3BC 2B63K 1K83C 3HKZL 4Y52C 1Y1WK 2E2IK 2JA8C 4KN7A 1TWHK 3HOWC 3S1QK 4OINA 1YNJA 1SMYA 4A3EC 5IYCC 4A3IK 2WB1D 2O5JA 2A6EA 1HQMA 4BY1K 1I6VA 2NVYC 1I3QC 4X6AC 4OIPA 3GTGK 4A3CK 3S1MK 3HOXC 5M5WK 2WB1L 3S1RC 3HOZK 2NVQK 4LK0A 5C44K 3S1NK 2WAQD 5FJ8K 1I6HC 4A3LK 1BDFA 3GTLK 4BBRC 4XLPA 5D4DA 4A3FK 3GTPK 4A3BK 2A68A 1WCMK 4QJVA 3PO3K 2B63C 4YFNA 3GTOK 3GTMK 4YFKA 1TWHC 2E2JC 4A3DK 4AYBD 4A3IC 4MEXA 1I50K 4XSXA 2JA5K 4Y7NK 4A3JK 2JA7K 4BY1C 4BBSK 4OIRA 3S17C 5FLMC 3I4NC 4QJVB 4BXXC 4XSZA 4AYBL 4JK1A 4Q4ZA 1TWGC
chains in the Genus database with same CATH superfamily
4A93K 3LPXA 4BLAA 1GE9A 4LQYA 2KWAA 2ZUFA 4KB4A 4A3MC 5IP9K 1WQGA 1R9TC 3VA7A 2E2IA 2Y0SL 1PJ6A 2JA6K 3I4MK 1EI6A 4ZH4A 1XXCA 3H0GK 4MQ9A 3S2HK 3TTGA 1Y1WC 1B4AA 3H3VL 4QIWD 3S14K 1USOA 2FQOA 2JH3A 3FKIC 2GAHC 2VUMK 3GTPA 1YX2A 4A3KK 3HOZC 2W7VA 2NVQC 1WOSA 3OPFA 1Y1VK 1I50A 4C3HK 3GTLC 4KB2A 1XXBA 3L4KA 3SZYA 3GTOC 4KARA 4MEYA 4A3EK 2V6UA 5IYCK 5EGHA 1DD5A 4G0WA 3GDZA 2RGRA 4KMUA 5IP9C 1ZQ1C 4QIWL 5TMCA 2JA6C 1SFOA 3S17K 5FLMK 4C3JK 3I4MC 1O29A 1UV7A 1YNNA 3S2HC 3S14C 4P5AA 4BY7K 2R92A 4ILDA 1TWCA 4A3KC 4GZYA 2YU9C 4C2MC 1Y1VC 4C3HC 4LK1A 1I3QA 4GTEA 2B63K 3HKZL 1EH1A 4WJ4A 4KN7A 3S1QK 4O2DA 1YNJA 4A3EC 1ZVUA 5IYCC 2WB1D 4GTLA 2NVYC 4OIPA 3GTGK 4GTAA 3MMLB 3HOXC 4LK0A 4M1XA 1ISEA 1VGXA 4XLPA 3TFJA 3PO3K 4QJVA 3GTMK 1TWGA 4A3IC 3A8IA 4BY1C 3S17C 5FLMC 4C3JC 1O2AA 4KMHA 4AYBL 4JK1A 1R9TA 1J6XA 5L46A 3QX3A 1XPPA 2Y0SD 4KDDA 3N0CA 3GTKK 4G7OA 3FKIK 4BY7C 3RZOK 2E2HK 1O25A 3S16K 4KATA 2NVTK 1Y1WA 3HOVK 3H3VD 4Y7NC 5M5XK 1WORA 4YG2A 1WSVA 2FQTA 4C45A 2BE5A 1BS2A 3S1QC 2XCRB 1WQFA 3RZDK 3S15K 3GTLA 4P5BA 1TWFK 3GTGC 4NOIA 3GTOA 5IORA 3G4CA 1TWAK 1WQHA 2JA7A 2A69A 3PO3C 2JA8K 3GTMC 1ZXOA 1XZQB 3CQZC 1B4BA 2GSNA 2EBBA 3CAGA 5M3MK 3N0BA 3EQLA 2GSUA 2PMZL 2JA6A 3M4OC 3GTKC 1F7VA 3H0GA 2E2JK 3RZOC 2E2HC 3M3YC 3S16C 3JSTA 2NVTC 3ADAC 2YU9K 4LJZA 1F7UA 2PA8L 2V6TA 4C2MK 4XLNA 3HOVC 3T01A 1J98A 3ERED 2VUMA 3LAJA 3HOYK 2R93C 3Q3QA 3T02A 3RZDC 3S15C 5C3EC 1Y1VA 2NVYK 2O5IA 1TWFC 3HOXK 1J6VA 4BKWA 3HKZD 5IYBK 4WJ3M 1TWAC 4GTFA 1USMA 4KMAA 4P9SA 4GTBA 4OIQA 2JA8C 2O5JA 1SMYA 4A3IK 4PAAA 4G0VA 1WOOA 2A6EA 1HQMA 4BY1K 1VJEA 1WSRA 1XZPB 3BUEA 5C44K 2CFAB 2WAQD 3GEEA 1IQ0A 1EK8A 3AQPA 4A3FK 1WCMK 4YFKA 2E2JC 4AYBD 4GT9A 4MEXA 1EFWA 4XSXA 5E68A 4Y7NK 4A3JK 4OIRA 4KC6A 3TFHA 4GFQA 4XSZA 4Q4ZA 4A3GK 3FOFA 1C0AA 3HOYC 3GTJK 4A3LC 1INNA 5JFEA 5C4XK 2B63A 4XCHA 3DXJA 5IYDK 2JA5C 5IYBC 3T00A 1VH2A 3S0XA 2R7ZK 1XXAA 1HI9A 3GTGA 2WAQL 1WOPA 2RH6A 3CQZK 3OEPA 1DCOA 5IOSA 4PABA 3AD7C 3GTMA 1O2BA 5C44C 4C3IK 1XZQA 4LOWA 4A3FC 3M4OK 4YFXA 1VLOA 5M5YK 1K83K 1WCMC 4KM8A 1IBAA 1IE0A 3FOEA 3M3YK 2NVXC 4OIOA 3GEIA 4A3JC 2PMZD 4KMDA 3GTKA 3FKIA 4A3GC 2R93K 2E2HA 3GTJC 4BBRK 3GEHA 2R92C 4BLBA 2PA8D 5C3EK 3G4AA 4FZBA 3AQOA 1F93A 3GTQC 5C4XC 1O27A 3AD8C 5IYDC 2CW0A 5TMFA 1PJ7A 1G51A 3I4NK 2R7ZC 3A8KA 3FHZA 1TWFA 3IPJA 1IL2A 3SZZA 4Q5SA 1TWAA 5IP7K 3S2DC 4GTDA 5M3FK 1O2FB 2PPBA 1IW7A 4C3IC 3HOUK 4AH6A 5C4JK 1AB4A 3A8JA 1K83C 2E2IK 4J3NA 1XZPA 3V4GA 3BP3A 2CFAA 3L4JA 1L0WA 4A3CK 3S1MK 1JOEA 5M5WK 3S1RC 1VRQC 5EGEA 1O26A 3S1NK 5FJ8K 4A3LK 1BDFA 4BBRC 2YU9A 3GTPK 4A3BK 1PJ5A 2A68A 4YFNA 1TWHC 4A3DK 2ZFZA 1I50K 2JA5K 5IOTA 2ZUEA 3I4NC 2XCQA 3LAPA 2NVYA 3NUHA 2JA5A 3AH5A 5IP7C 2GAGC 4LLGA 4G7ZA 1F9NA 2JA7C 4BBSC 4KAWX 3HOUC 3TFIA 2Y3PA 5C4JC 2E2IC 4A93C 1KQ4A 1DCHA 1SFOK 2NVXK 3WODA 4G7HA 1RU0A 3K7AK 4KASA 3PO2K 3HXAA 2D6FC 1IS1A 2XCOA 3S1MC 2A6HA 1V5VA 1WCMA 1ZYRA 4A3CC 2NVXA 3S1NC 3N3YA 3H0GC 1TWCK 2R92K 3GTPC 1BJTA 4A3BC 4Y52K 4KM9A 3HOWK 3GSIA 4A3DC 3GTQK 2PHCB 1I50C 3GTJA 1ZBSA 1I3QK 4KN4A 2VUMC 4X6AK 4WILA 1DCPA 1I6HK 5CJ9A 3GTQA 2P5MA 4DDQA 5TJ3A 2V6SA 3S2DK 2R7ZA 4G0UA 4GTCA 1YCLA 3CQZA 4BXXK 1TWGK 1SFOC 4A3MK 1O28A 2GSOA 3K7AC 1R9TK 3PO2C 3S1RK 1K83A 5JVOA 1TWCC 1Y1WK 4Y52C 4RMFA 5CHPA 1TWHK 3HOWC 4OINA 2R93A 4FM9A 3OREA 1I6VA 1I3QC 2P8TA 4X6AC 5HL8A 1EQRA 2WB1L 3HOZK 1TWHA 1X31C 2NVQK 3GIRA 1I6HC 3GTLK 5D4DA 2B63C 1J6WA 3GTOK 4LR2A 1O24A 1JVIA 1BGWA 1JQWA 3AD9C 5IOQA 2JA7K 4BBSK 1WIHA 4QJVB 4BXXC 1TWGC 3BP8C
chains in the Genus database with same CATH topology
4A93K 3HOYC 3GTJK 4A3LC 4A3MC 1XPPA 2Y0SD 5IP9K 3GTKK 4G7OA 3FKIK 5IP7C 4BY7C 1R9TC 2E2HK 3RZOK 3S16K 5C4XK 2NVTK 3DXJA 4LLGA 2Y0SL 4G7ZA 3HOVK 2JA5C 2JA6K 5IYBC 4Y7NC 2JA7C 3H3VD 4BBSC 4A3GK 3I4MK 5M5XK 3HOUC 4YG2A 4ZH4A 5C4JC 3H0GK 4MQ9A 2R7ZK 3S2HK 2BE5A 1Y1WC 2E2IC 3H3VL 4A93C 4QIWD 3S14K 3S1QC 2WAQL 1SFOK 2NVXK 3RZDK 3WODA 3CQZK 3S15K 4G7HA 3FKIC 3K7AK 2VUMK 3PO2K 1TWFK 3GTGC 4A3KK 3S1MC 4NOIA 2A6HA 4A3CC 1ZYRA 3HOZC 2NVQC 5C44C 4C3IK 3S1NC 1TWAK 1Y1VK 4C3HK 3GTLC 2R92K 3H0GC 1TWCK 4A3FC 4YFXA 2A69A 3GTPC 5M5YK 1K83K 1WCMC 3PO3C 2JA8K 3GTOC 3GTMC 3HOWK 4Y52K 4MEYA 4A3EK 3M3YK 5IYCK 2NVXC 4A3DC 3GTQK 1I50C 3CQZC 4OIOA 4A3JC 1I3QK 4KN4A 2VUMC 4X6AK 2PMZD 4A3GC 5M3MK 3EQLA 2R93K 4KMUA 1I6HK 3GTJC 4BBRK 2PMZL 2R92C 5IP9C 2PA8D 5C3EK 3GTKC 3M4OC 3S2DK 2E2JK 4QIWL 3RZOC 2E2HC 3M3YC 3S16C 3GTQC 5C4XC 2NVTC 3HOVC 5TMCA 4LJZA 5IYDC 2PA8L 2CW0A 5TMFA 4C2MK 4XLNA 2YU9K 2JA6C 5FLMK 4C3JK 3I4MC 3S17K 3I4NK 4BXXK 1TWGK 1YNNA 2R7ZC 3S2HC 3HOYK 2R93C 3M4OK 3S14C 1SFOC 4A3MK 3RZDC 3S15C 4Q5SA 5C3EC 5IP7K 3S2DC 4BY7K 2NVYK 3K7AC 1R9TK 2O5IA 5M3FK 3PO2C 1TWFC 3HOXK 4A3KC 2PPBA 3S1RK 4GZYA 5IYDK 1IW7A 2YU9C 3HKZD 5IYBK 3HOUK 1TWAC 1Y1VC 5C4JK 4OIQA 4LK1A 1TWCC 4A3BC 2B63K 1K83C 3HKZL 4Y52C 1Y1WK 2E2IK 2JA8C 4KN7A 1TWHK 3HOWC 3S1QK 4OINA 1YNJA 1SMYA 4A3EC 5IYCC 4A3IK 2WB1D 2O5JA 2A6EA 1HQMA 4BY1K 1I6VA 2NVYC 1I3QC 4X6AC 4OIPA 3GTGK 4A3CK 3S1MK 3HOXC 5M5WK 2WB1L 3S1RC 3HOZK 2NVQK 4LK0A 5C44K 3S1NK 2WAQD 5FJ8K 1I6HC 4A3LK 1BDFA 3GTLK 4BBRC 4XLPA 5D4DA 4A3FK 3GTPK 4A3BK 2A68A 1WCMK 4QJVA 3PO3K 2B63C 4YFNA 3GTOK 3GTMK 4YFKA 1TWHC 2E2JC 4A3DK 4AYBD 4A3IC 4MEXA 1I50K 4XSXA 2JA5K 4Y7NK 4A3JK 2JA7K 4BY1C 4BBSK 4OIRA 3S17C 5FLMC 3I4NC 4QJVB 4BXXC 4XSZA 4AYBL 4JK1A 4Q4ZA 1TWGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A93 K;  3HOY C;  3GTJ K;  4A3L C;  4A3M C;  1XPP A;  2Y0S D;  5IP9 K;  3GTK K;  4G7O A;  3FKI K;  5IP7 C;  4BY7 C;  1R9T C;  2E2H K;  3RZO K;  3S16 K;  5C4X K;  2NVT K;  3DXJ A;  4LLG A;  2Y0S L;  4G7Z A;  3HOV K;  2JA5 C;  2JA6 K;  5IYB C;  4Y7N C;  2JA7 C;  3H3V D;  4BBS C;  4A3G K;  3I4M K;  5M5X K;  3HOU C;  4YG2 A;  4ZH4 A;  5C4J C;  3H0G K;  4MQ9 A;  2R7Z K;  3S2H K;  2BE5 A;  1Y1W C;  2E2I C;  3H3V L;  4A93 C;  4QIW D;  3S14 K;  3S1Q C;  2WAQ L;  1SFO K;  2NVX K;  3RZD K;  3WOD A;  3CQZ K;  3S15 K;  4G7H A;  3FKI C;  3K7A K;  2VUM K;  3PO2 K;  1TWF K;  3GTG C;  4A3K K;  3S1M C;  4NOI A;  2A6H A;  4A3C C;  1ZYR A;  3HOZ C;  2NVQ C;  5C44 C;  4C3I K;  3S1N C;  1TWA K;  1Y1V K;  4C3H K;  3GTL C;  2R92 K;  3H0G C;  1TWC K;  4A3F C;  4YFX A;  2A69 A;  3GTP C;  5M5Y K;  1K83 K;  1WCM C;  3PO3 C;  2JA8 K;  3GTO C;  3GTM C;  3HOW K;  4Y52 K;  4MEY A;  4A3E K;  3M3Y K;  5IYC K;  2NVX C;  4A3D C;  3GTQ K;  1I50 C;  3CQZ C;  4OIO A;  4A3J C;  1I3Q K;  4KN4 A;  2VUM C;  4X6A K;  2PMZ D;  4A3G C;  5M3M K;  3EQL A;  2R93 K;  4KMU A;  1I6H K;  3GTJ C;  4BBR K;  2PMZ L;  2R92 C;  5IP9 C;  2PA8 D;  5C3E K;  3GTK C;  3M4O C;  3S2D K;  2E2J K;  4QIW L;  3RZO C;  2E2H C;  3M3Y C;  3S16 C;  3GTQ C;  5C4X C;  2NVT C;  3HOV C;  5TMC A;  4LJZ A;  5IYD C;  2PA8 L;  2CW0 A;  5TMF A;  4C2M K;  4XLN A;  2YU9 K;  2JA6 C;  5FLM K;  4C3J K;  3I4M C;  3S17 K;  3I4N K;  4BXX K;  1TWG K;  1YNN A;  2R7Z C;  3S2H C;  3HOY K;  2R93 C;  3M4O K;  3S14 C;  1SFO C;  4A3M K;  3RZD C;  3S15 C;  4Q5S A;  5C3E C;  5IP7 K;  3S2D C;  4BY7 K;  2NVY K;  3K7A C;  1R9T K;  2O5I A;  5M3F K;  3PO2 C;  1TWF C;  3HOX K;  4A3K C;  2PPB A;  3S1R K;  4GZY A;  5IYD K;  1IW7 A;  2YU9 C;  3HKZ D;  5IYB K;  3HOU K;  1TWA C;  1Y1V C;  5C4J K;  4OIQ A;  4LK1 A;  1TWC C;  4A3B C;  2B63 K;  1K83 C;  3HKZ L;  4Y52 C;  1Y1W K;  2E2I K;  2JA8 C;  4KN7 A;  1TWH K;  3HOW C;  3S1Q K;  4OIN A;  1YNJ A;  1SMY A;  4A3E C;  5IYC C;  4A3I K;  2WB1 D;  2O5J A;  2A6E A;  1HQM A;  4BY1 K;  1I6V A;  2NVY C;  1I3Q C;  4X6A C;  4OIP A;  3GTG K;  4A3C K;  3S1M K;  3HOX C;  5M5W K;  2WB1 L;  3S1R C;  3HOZ K;  2NVQ K;  4LK0 A;  5C44 K;  3S1N K;  2WAQ D;  5FJ8 K;  1I6H C;  4A3L K;  1BDF A;  3GTL K;  4BBR C;  4XLP A;  5D4D A;  4A3F K;  3GTP K;  4A3B K;  2A68 A;  1WCM K;  4QJV A;  3PO3 K;  2B63 C;  4YFN A;  3GTO K;  3GTM K;  4YFK A;  1TWH C;  2E2J C;  4A3D K;  4AYB D;  4A3I C;  4MEX A;  1I50 K;  4XSX A;  2JA5 K;  4Y7N K;  4A3J K;  2JA7 K;  4BY1 C;  4BBS K;  4OIR A;  3S17 C;  5FLM C;  3I4N C;  4QJV B;  4BXX C;  4XSZ A;  4AYB L;  4JK1 A;  4Q4Z A;  1TWG C; 
#chains in the Genus database with same CATH topology
 4A93 K;  3LPX A;  4BLA A;  1GE9 A;  4LQY A;  2KWA A;  2ZUF A;  4KB4 A;  4A3M C;  5IP9 K;  1WQG A;  1R9T C;  3VA7 A;  2E2I A;  2Y0S L;  1PJ6 A;  2JA6 K;  3I4M K;  1EI6 A;  4ZH4 A;  1XXC A;  3H0G K;  4MQ9 A;  3S2H K;  3TTG A;  1Y1W C;  1B4A A;  3H3V L;  4QIW D;  3S14 K;  1USO A;  2FQO A;  2JH3 A;  3FKI C;  2GAH C;  2VUM K;  3GTP A;  1YX2 A;  4A3K K;  3HOZ C;  2W7V A;  2NVQ C;  1WOS A;  3OPF A;  1Y1V K;  1I50 A;  4C3H K;  3GTL C;  4KB2 A;  1XXB A;  3L4K A;  3SZY A;  3GTO C;  4KAR A;  4MEY A;  4A3E K;  2V6U A;  5IYC K;  5EGH A;  1DD5 A;  4G0W A;  3GDZ A;  2RGR A;  4KMU A;  5IP9 C;  1ZQ1 C;  4QIW L;  5TMC A;  2JA6 C;  1SFO A;  3S17 K;  5FLM K;  4C3J K;  3I4M C;  1O29 A;  1UV7 A;  1YNN A;  3S2H C;  3S14 C;  4P5A A;  4BY7 K;  2R92 A;  4ILD A;  1TWC A;  4A3K C;  4GZY A;  2YU9 C;  4C2M C;  1Y1V C;  4C3H C;  4LK1 A;  1I3Q A;  4GTE A;  2B63 K;  3HKZ L;  1EH1 A;  4WJ4 A;  4KN7 A;  3S1Q K;  4O2D A;  1YNJ A;  4A3E C;  1ZVU A;  5IYC C;  2WB1 D;  4GTL A;  2NVY C;  4OIP A;  3GTG K;  4GTA A;  3MML B;  3HOX C;  4LK0 A;  4M1X A;  1ISE A;  1VGX A;  4XLP A;  3TFJ A;  3PO3 K;  4QJV A;  3GTM K;  1TWG A;  4A3I C;  3A8I A;  4BY1 C;  3S17 C;  5FLM C;  4C3J C;  1O2A A;  4KMH A;  4AYB L;  4JK1 A;  1R9T A;  1J6X A;  5L46 A;  3QX3 A;  1XPP A;  2Y0S D;  4KDD A;  3N0C A;  3GTK K;  4G7O A;  3FKI K;  4BY7 C;  3RZO K;  2E2H K;  1O25 A;  3S16 K;  4KAT A;  2NVT K;  1Y1W A;  3HOV K;  3H3V D;  4Y7N C;  5M5X K;  1WOR A;  4YG2 A;  1WSV A;  2FQT A;  4C45 A;  2BE5 A;  1BS2 A;  3S1Q C;  2XCR B;  1WQF A;  3RZD K;  3S15 K;  3GTL A;  4P5B A;  1TWF K;  3GTG C;  4NOI A;  3GTO A;  5IOR A;  3G4C A;  1TWA K;  1WQH A;  2JA7 A;  2A69 A;  3PO3 C;  2JA8 K;  3GTM C;  1ZXO A;  1XZQ B;  3CQZ C;  1B4B A;  2GSN A;  2EBB A;  3CAG A;  5M3M K;  3N0B A;  3EQL A;  2GSU A;  2PMZ L;  2JA6 A;  3M4O C;  3GTK C;  1F7V A;  3H0G A;  2E2J K;  3RZO C;  2E2H C;  3M3Y C;  3S16 C;  3JST A;  2NVT C;  3ADA C;  2YU9 K;  4LJZ A;  1F7U A;  2PA8 L;  2V6T A;  4C2M K;  4XLN A;  3HOV C;  3T01 A;  1J98 A;  3ERE D;  2VUM A;  3LAJ A;  3HOY K;  2R93 C;  3Q3Q A;  3T02 A;  3RZD C;  3S15 C;  5C3E C;  1Y1V A;  2NVY K;  2O5I A;  1TWF C;  3HOX K;  1J6V A;  4BKW A;  3HKZ D;  5IYB K;  4WJ3 M;  1TWA C;  4GTF A;  1USM A;  4KMA A;  4P9S A;  4GTB A;  4OIQ A;  2JA8 C;  2O5J A;  1SMY A;  4A3I K;  4PAA A;  4G0V A;  1WOO A;  2A6E A;  1HQM A;  4BY1 K;  1VJE A;  1WSR A;  1XZP B;  3BUE A;  5C44 K;  2CFA B;  2WAQ D;  3GEE A;  1IQ0 A;  1EK8 A;  3AQP A;  4A3F K;  1WCM K;  4YFK A;  2E2J C;  4AYB D;  4GT9 A;  4MEX A;  1EFW A;  4XSX A;  5E68 A;  4Y7N K;  4A3J K;  4OIR A;  4KC6 A;  3TFH A;  4GFQ A;  4XSZ A;  4Q4Z A;  4A3G K;  3FOF A;  1C0A A;  3HOY C;  3GTJ K;  4A3L C;  1INN A;  5JFE A;  5C4X K;  2B63 A;  4XCH A;  3DXJ A;  5IYD K;  2JA5 C;  5IYB C;  3T00 A;  1VH2 A;  3S0X A;  2R7Z K;  1XXA A;  1HI9 A;  3GTG A;  2WAQ L;  1WOP A;  2RH6 A;  3CQZ K;  3OEP A;  1DCO A;  5IOS A;  4PAB A;  3AD7 C;  3GTM A;  1O2B A;  5C44 C;  4C3I K;  1XZQ A;  4LOW A;  4A3F C;  3M4O K;  4YFX A;  1VLO A;  5M5Y K;  1K83 K;  1WCM C;  4KM8 A;  1IBA A;  1IE0 A;  3FOE A;  3M3Y K;  2NVX C;  4OIO A;  3GEI A;  4A3J C;  2PMZ D;  4KMD A;  3GTK A;  3FKI A;  4A3G C;  2R93 K;  2E2H A;  3GTJ C;  4BBR K;  3GEH A;  2R92 C;  4BLB A;  2PA8 D;  5C3E K;  3G4A A;  4FZB A;  3AQO A;  1F93 A;  3GTQ C;  5C4X C;  1O27 A;  3AD8 C;  5IYD C;  2CW0 A;  5TMF A;  1PJ7 A;  1G51 A;  3I4N K;  2R7Z C;  3A8K A;  3FHZ A;  1TWF A;  3IPJ A;  1IL2 A;  3SZZ A;  4Q5S A;  1TWA A;  5IP7 K;  3S2D C;  4GTD A;  5M3F K;  1O2F B;  2PPB A;  1IW7 A;  4C3I C;  3HOU K;  4AH6 A;  5C4J K;  1AB4 A;  3A8J A;  1K83 C;  2E2I K;  4J3N A;  1XZP A;  3V4G A;  3BP3 A;  2CFA A;  3L4J A;  1L0W A;  4A3C K;  3S1M K;  1JOE A;  5M5W K;  3S1R C;  1VRQ C;  5EGE A;  1O26 A;  3S1N K;  5FJ8 K;  4A3L K;  1BDF A;  4BBR C;  2YU9 A;  3GTP K;  4A3B K;  1PJ5 A;  2A68 A;  4YFN A;  1TWH C;  4A3D K;  2ZFZ A;  1I50 K;  2JA5 K;  5IOT A;  2ZUE A;  3I4N C;  2XCQ A;  3LAP A;  2NVY A;  3NUH A;  2JA5 A;  3AH5 A;  5IP7 C;  2GAG C;  4LLG A;  4G7Z A;  1F9N A;  2JA7 C;  4BBS C;  4KAW X;  3HOU C;  3TFI A;  2Y3P A;  5C4J C;  2E2I C;  4A93 C;  1KQ4 A;  1DCH A;  1SFO K;  2NVX K;  3WOD A;  4G7H A;  1RU0 A;  3K7A K;  4KAS A;  3PO2 K;  3HXA A;  2D6F C;  1IS1 A;  2XCO A;  3S1M C;  2A6H A;  1V5V A;  1WCM A;  1ZYR A;  4A3C C;  2NVX A;  3S1N C;  3N3Y A;  3H0G C;  1TWC K;  2R92 K;  3GTP C;  1BJT A;  4A3B C;  4Y52 K;  4KM9 A;  3HOW K;  3GSI A;  4A3D C;  3GTQ K;  2PHC B;  1I50 C;  3GTJ A;  1ZBS A;  1I3Q K;  4KN4 A;  2VUM C;  4X6A K;  4WIL A;  1DCP A;  1I6H K;  5CJ9 A;  3GTQ A;  2P5M A;  4DDQ A;  5TJ3 A;  2V6S A;  3S2D K;  2R7Z A;  4G0U A;  4GTC A;  1YCL A;  3CQZ A;  4BXX K;  1TWG K;  1SFO C;  4A3M K;  1O28 A;  2GSO A;  3K7A C;  1R9T K;  3PO2 C;  3S1R K;  1K83 A;  5JVO A;  1TWC C;  1Y1W K;  4Y52 C;  4RMF A;  5CHP A;  1TWH K;  3HOW C;  4OIN A;  2R93 A;  4FM9 A;  3ORE A;  1I6V A;  1I3Q C;  2P8T A;  4X6A C;  5HL8 A;  1EQR A;  2WB1 L;  3HOZ K;  1TWH A;  1X31 C;  2NVQ K;  3GIR A;  1I6H C;  3GTL K;  5D4D A;  2B63 C;  1J6W A;  3GTO K;  4LR2 A;  1O24 A;  1JVI A;  1BGW A;  1JQW A;  3AD9 C;  5IOQ A;  2JA7 K;  4BBS K;  1WIH A;  4QJV B;  4BXX C;  1TWG C;  3BP8 C; 
#chains in the Genus database with same CATH homology
 4A93 K;  3HOY C;  3GTJ K;  4A3L C;  4A3M C;  1XPP A;  2Y0S D;  5IP9 K;  3GTK K;  4G7O A;  3FKI K;  5IP7 C;  4BY7 C;  1R9T C;  2E2H K;  3RZO K;  3S16 K;  5C4X K;  2NVT K;  3DXJ A;  4LLG A;  2Y0S L;  4G7Z A;  3HOV K;  2JA5 C;  2JA6 K;  5IYB C;  4Y7N C;  2JA7 C;  3H3V D;  4BBS C;  4A3G K;  3I4M K;  5M5X K;  3HOU C;  4YG2 A;  4ZH4 A;  5C4J C;  3H0G K;  4MQ9 A;  2R7Z K;  3S2H K;  2BE5 A;  1Y1W C;  2E2I C;  3H3V L;  4A93 C;  4QIW D;  3S14 K;  3S1Q C;  2WAQ L;  1SFO K;  2NVX K;  3RZD K;  3WOD A;  3CQZ K;  3S15 K;  4G7H A;  3FKI C;  3K7A K;  2VUM K;  3PO2 K;  1TWF K;  3GTG C;  4A3K K;  3S1M C;  4NOI A;  2A6H A;  4A3C C;  1ZYR A;  3HOZ C;  2NVQ C;  5C44 C;  4C3I K;  3S1N C;  1TWA K;  1Y1V K;  4C3H K;  3GTL C;  2R92 K;  3H0G C;  1TWC K;  4A3F C;  4YFX A;  2A69 A;  3GTP C;  5M5Y K;  1K83 K;  1WCM C;  3PO3 C;  2JA8 K;  3GTO C;  3GTM C;  3HOW K;  4Y52 K;  4MEY A;  4A3E K;  3M3Y K;  5IYC K;  2NVX C;  4A3D C;  3GTQ K;  1I50 C;  3CQZ C;  4OIO A;  4A3J C;  1I3Q K;  4KN4 A;  2VUM C;  4X6A K;  2PMZ D;  4A3G C;  5M3M K;  3EQL A;  2R93 K;  4KMU A;  1I6H K;  3GTJ C;  4BBR K;  2PMZ L;  2R92 C;  5IP9 C;  2PA8 D;  5C3E K;  3GTK C;  3M4O C;  3S2D K;  2E2J K;  4QIW L;  3RZO C;  2E2H C;  3M3Y C;  3S16 C;  3GTQ C;  5C4X C;  2NVT C;  3HOV C;  5TMC A;  4LJZ A;  5IYD C;  2PA8 L;  2CW0 A;  5TMF A;  4C2M K;  4XLN A;  2YU9 K;  2JA6 C;  5FLM K;  4C3J K;  3I4M C;  3S17 K;  3I4N K;  4BXX K;  1TWG K;  1YNN A;  2R7Z C;  3S2H C;  3HOY K;  2R93 C;  3M4O K;  3S14 C;  1SFO C;  4A3M K;  3RZD C;  3S15 C;  4Q5S A;  5C3E C;  5IP7 K;  3S2D C;  4BY7 K;  2NVY K;  3K7A C;  1R9T K;  2O5I A;  5M3F K;  3PO2 C;  1TWF C;  3HOX K;  4A3K C;  2PPB A;  3S1R K;  4GZY A;  5IYD K;  1IW7 A;  2YU9 C;  3HKZ D;  5IYB K;  3HOU K;  1TWA C;  1Y1V C;  5C4J K;  4OIQ A;  4LK1 A;  1TWC C;  4A3B C;  2B63 K;  1K83 C;  3HKZ L;  4Y52 C;  1Y1W K;  2E2I K;  2JA8 C;  4KN7 A;  1TWH K;  3HOW C;  3S1Q K;  4OIN A;  1YNJ A;  1SMY A;  4A3E C;  5IYC C;  4A3I K;  2WB1 D;  2O5J A;  2A6E A;  1HQM A;  4BY1 K;  1I6V A;  2NVY C;  1I3Q C;  4X6A C;  4OIP A;  3GTG K;  4A3C K;  3S1M K;  3HOX C;  5M5W K;  2WB1 L;  3S1R C;  3HOZ K;  2NVQ K;  4LK0 A;  5C44 K;  3S1N K;  2WAQ D;  5FJ8 K;  1I6H C;  4A3L K;  1BDF A;  3GTL K;  4BBR C;  4XLP A;  5D4D A;  4A3F K;  3GTP K;  4A3B K;  2A68 A;  1WCM K;  4QJV A;  3PO3 K;  2B63 C;  4YFN A;  3GTO K;  3GTM K;  4YFK A;  1TWH C;  2E2J C;  4A3D K;  4AYB D;  4A3I C;  4MEX A;  1I50 K;  4XSX A;  2JA5 K;  4Y7N K;  4A3J K;  2JA7 K;  4BY1 C;  4BBS K;  4OIR A;  3S17 C;  5FLM C;  3I4N C;  4QJV B;  4BXX C;  4XSZ A;  4AYB L;  4JK1 A;  4Q4Z A;  1TWG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...