2WAQL

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2waqL00
2PPBA 3K7AK 2Y0SL 4BY7C 3RZDK 1I3QC 1YNNA 1I50C 1HQMA 1TWAK 3S2HK 4OINA 3S17K 2B63C 2JA5K 3GTGC 1WCMK 2JA8C 3S14K 4A3CK 4MEXA 4QIWD 4KN7A 3H3VD 2NVTK 3HOZK 1TWAC 4A3IK 5M3MK 3GTKC 3GTPC 2JA5C 3GTGK 1Y1WK 2NVXK 4NOIA 5M5YK 3M4OC 5IYCK 2NVTC 4YFNA 3S16C 4KN4A 2O5IA 4A3LK 4BBRK 4A3EK 3GTQC 3RZOK 2WAQD 1XPPA 4JK1A 3S1RC 1Y1VK 2VUMK 3WODA 3RZDC 4A3FK 1YNJA 5C4XK 4OIPA 4XSXA 1I3QK 3S1QK 4G7OA 4LLGA 1WCMC 3S14C 5C44K 3S1NK 2YU9C 2E2IC 2JA6C 4A3GC 4A3KK 2A6HA 2NVXC 1TWGK 3GTJC 1SFOK 4BXXK 3HOWK 2O5JA 2NVYK 2R93K 2E2IK 4A3MK 1IW7A 5C3EK 3S15K 4LK1A 3GTOC 2WB1D 5M5XK 4LJZA 5IP9K 4BY1C 2PA8L 3GTQK 3S1MK 2JA7K 3DXJA 3GTJK 1SFOC 3S15C 4BXXC 4Q4ZA 3GTLC 1I6VA 2Y0SD 3PO2K 2WAQL 3M3YC 3H0GC 5C4XC 3HOVC 3GTKK 5IP9C 2CW0A 5C44C 4YFKA 4A3JK 3S1MC 2PMZD 4A3LC 4A3DK 5IP7K 3HOXC 3H0GK 5IYBK 4Y52C 3CQZK 5TMFA 4OIQA 3S2HC 1TWCK 3S1NC 1I50K 2NVYC 1Y1VC 3EQLA 4C3IK 1ZYRA 1K83K 4MQ9A 1TWGC 4XLNA 4G7ZA 4A3FC 3S1RK 5IYBC 5C4JK 2E2JK 2VUMC 5TMCA 3HOUC 3HOXK 1R9TC 5FLMC 2E2HK 3HOYC 4YFXA 3GTMC 5IYDK 5M5WK 4AYBD 4QJVA 4G7HA 4YG2A 3K7AC 4A3BK 4A93C 2A68A 4A3KC 4BBSK 5FLMK 2E2HC 1I6HK 3RZOC 5IYDC 2NVQC 3GTMK 3I4NK 4A3DC 2B63K 1SMYA 4AYBL 3GTOK 5C3EC 3HKZD 2A69A 3FKIK 4GZYA 2R7ZK 3GTPK 1TWCC 4C2MK 1Y1WC 4BY7K 4MEYA 3I4NC 3I4MC 4BBRC 4A3EC 5C4JC 2E2JC 4XSZA 2WB1L 1R9TK 3HOYK 3M3YK 1TWFK 4C3JK 4OIRA 4A3BC 2PMZL 3S17C 1TWHK 4A93K 5D4DA 3HOWC 4Y52K 4Y7NK 4A3IC 4ZH4A 3HOZC 3CQZC 2JA7C 2NVQK 4Q5SA 2YU9K 3HOUK 3PO3C 1K83C 4XLPA 3PO2C 1BDFA 2R93C 5IYCC 3GTLK 3S16K 2R7ZC 2R92K 4LK0A 4A3GK 3FKIC 2BE5A 4KMUA 3PO3K 5IP7C 3S2DK 4X6AK 4A3JC 3H3VL 2JA8K 4A3CC 4QJVB 4BY1K 3I4MK 1I6HC 3HKZL 2A6EA 4BBSC 2R92C 3S2DC 5M3FK 3S1QC 4X6AC 2PA8D 3M4OK 1TWFC 4Y7NC 5FJ8K 2JA6K 1TWHC 4QIWL 4C3HK 4OIOA 3HOVK 4A3MC
chains in the Genus database with same CATH superfamily
4BY7C 2Y0SL 1I3QC 2P5MA 1I50C 1J98A 3S17K 3OPFA 4KMHA 3SZZA 4KN7A 3V4GA 1TWAC 4NOIA 5M5YK 2EBBA 4FZBA 4YFNA 1IE0A 3GTQC 4KM8A 3ERED 1XXCA 4JK1A 1Y1VK 1XXAA 1USOA 3L4KA 3RZDC 3LAPA 1B4AA 2NVXA 4G7OA 3S14C 3S1NK 2JA6C 1IBAA 1J6XA 1ZVUA 2NVYK 4C3IC 5C3EK 1O28A 1USMA 3H0GA 4LK1A 3G4AA 2WB1D 5M5XK 2JA7K 3GTLC 4DDQA 3L4JA 3M3YC 1J6VA 1ISEA 2CW0A 3GTMA 4A3JK 3HOXC 1WQHA 4GFQA 4GTCA 4Y52C 5EGEA 5IYBK 3S2HC 1TWCK 3Q3QA 3EQLA 1Y1VC 4XLNA 4MQ9A 5IYBC 3HOXK 3AD7C 3GTMC 5IYDK 3K7AC 1DCHA 4A3BK 1BS2A 4KASA 3RZOC 3I4NK 4AYBL 1O2FB 1F9NA 5C3EC 3GTJA 3FOEA 2R7ZK 2R7ZA 1O2BA 1Y1WC 4BY7K 3I4NC 3LPXA 3HXAA 1R9TK 3HOYK 2GAGC 4BLBA 4A3BC 5D4DA 2FQTA 3TFHA 4C45A 3HOZC 3A8KA 4LQYA 3ADAC 2E2HA 1VJEA 3PO2C 1WSVA 3T01A 3S0XA 3NUHA 4A3GK 4KC6A 1WOOA 4A3JC 3N3YA 4QJVB 4BY1K 2GSUA 1I6HC 1YCLA 2A6EA 4BBSC 2R92C 3S1QC 3M4OK 4GTAA 1TWHC 4C3HK 4G0WA 2JA5A 2ZUEA 1XZPA 4LR2A 3K7AK 4P5BA 3GSIA 2NVYA 2D6FC 3CAGA 3GTGC 5JFEA 3S14K 3S1NC 4QIWD 1O26A 5M3MK 5IORA 3GTPC 2JA5C 3G4CA 5IYCK 3S16C 3GIRA 1V5VA 3N0BA 2GSOA 3WODA 1BJTA 4GTEA 4OIPA 4GTDA 3GEHA 2XCRB 2V6TA 5C44K 2YU9C 4A3KK 4C3HC 4KDDA 1TWFA 3OREA 5TJ3A 2GSNA 4BY1C 3GTPA 4BXXC 4XCHA 3TTGA 4Q4ZA 1I6VA 2Y0SD 3PO2K 3GTOA 1VGXA 2B63A 3HOVC 1DD5A 5IP9C 1EQRA 3MMLB 3S1MC 5IP7K 5TMFA 4OIQA 2E2IA 1G51A 2R93C 1K83K 1TWGC 4AH6A 1WOSA 4A3FC 1WQGA 1O2AA 1DCPA 5FLMC 1R9TC 2E2HK 3HOYC 3BUEA 1TWAA 2XCQA 1C0AA 4KMDA 4A93C 3CQZA 2A68A 4A3KC 4KM9A 4BBSK 5FLMK 2E2HC 1I6HK 1HI9A 1PJ7A 4A3DC 2B63K 1VRQC 2ZUFA 1B4BA 2Y3PA 4C2MK 4KATA 4XSZA 2PMZL 3HOWC 4P9SA 4Y52K 4ZH4A 3VA7A 2NVQK 1IQ0A 3PO3C 1TWHA 3GTLK 2R7ZC 4LOWA 2BE5A 1JOEA 1PJ5A 3S2DK 4X6AK 3H3VL 3HKZL 3S2DC 5M3FK 4X6AC 2PA8D 1TWFC 4Y7NC 2R92A 4WJ4A 2JA6K 2RH6A 4G0UA 2YU9A 3OEPA 3AQOA 2PPBA 3RZDK 1YNNA 3AH5A 3T02A 2PHCB 1UV7A 3S2HK 2JA5K 3QX3A 5EGHA 2JA8C 1RU0A 4A3CK 4MEXA 3H3VD 3HOZK 3GTGK 1I50A 2NVXK 1EK8A 4A3LK 5CJ9A 1EFWA 5JVOA 2P8TA 3S1RC 2VUMK 3TFJA 4XSXA 1I3QK 1Y1WA 3S1QK 4LLGA 1WCMC 1O27A 2E2IC 1WCMA 4A3GC 2NVXC 1TWGK 3GTJC 1SFOK 3HOWK 2O5JA 2R93K 3N0CA 4A3MK 1IW7A 1ZXOA 3S15K 3GTOC 4LJZA 5IP9K 2PA8L 3GTQK 5E68A 3S1MK 1EI6A 3DXJA 3GTJK 1SFOC 3S15C 4C2MC 2CFAA 2VUMA 2WAQL 1XZQA 5C4XC 5IOSA 2PMZD 3JSTA 2RGRA 4A3DK 2V6UA 3CQZK 1WSRA 1I50K 1SFOA 1ZYRA 2FQOA 3S1RK 3HOUC 5C4JK 2E2JK 2VUMC 2KWAA 5TMCA 3BP3A 4YFXA 4QJVA 4G7HA 1TWCA 1I3QA 1YX2A 1ZBSA 1X31C 3BP8C 3GDZA 4G0VA 5IYDC 2NVQC 3GTMK 4PAAA 4KB4A 1SMYA 3GTOK 2JA6A 2A69A 3FKIK 3GTPK 1TWCC 3GTGA 4MEYA 3I4MC 2WB1L 3M3YK 1WIHA 1TWFK 4OIRA 4Y7NK 2ZFZA 1O29A 2JA7C 1O25A 2YU9K 3HOUK 2V6SA 1L0WA 2R92K 4LK0A 4KMUA 3PO3K 3AD8C 4BKWA 2CFAB 2JA8K 2XCOA 4A3CC 3I4MK 3FHZA 5CHPA 3GTKA 3FKIA 4RMFA 4ILDA 4OIOA 3AD9C 1VLOA 3HOVK 4A3MC 1KQ4A 4KMAA 2R93A 1HQMA 1TWAK 4OINA 2B63C 4GTFA 5HL8A 1R9TA 1WCMK 1JQWA 2NVTK 1EH1A 1K83A 4A3IK 3GTKC 3IPJA 1Y1WK 1O24A 3M4OC 3T00A 2NVTC 4KN4A 2O5IA 4BBRK 4A3EK 3RZOK 2WAQD 1XPPA 1ZQ1C 4KARA 4A3FK 1YNJA 5C4XK 4J3NA 4M1XA 3TFIA 1JVIA 4KB2A 3GEIA 2A6HA 1TWGA 2GAHC 4BXXK 2E2IK 4KAWX 5L46A 1IL2A 1F93A 1INNA 3H0GC 1XZPB 4C3JC 3GTKK 5C44C 4YFKA 4BLAA 4A3LC 5IOTA 3H0GK 4PABA 4C3IK 2NVYC 3A8JA 4G7ZA 1XZQB 1XXBA 1IS1A 5M5WK 4AYBD 4P5AA 4YG2A 4O2DA 4GTLA 1AB4A 1Y1VA 1GE9A 3SZYA 3FOFA 4GT9A 3AQPA 3HKZD 4GZYA 2JA7A 4BBRC 4A3EC 5C4JC 2E2JC 1F7VA 1F7UA 4C3JK 4A93K 1BGWA 3S17C 1TWHK 3GTLA 2W7VA 4A3IC 4FM9A 3CQZC 1VH2A 4Q5SA 1WQFA 3A8IA 1K83C 4XLPA 1BDFA 5IYCC 3S16K 3FKIC 5IP7C 3LAJA 4WJ3M 1PJ6A 1WOPA 4WILA 5IOQA 4GTBA 5FJ8K 1WORA 4QIWL 1J6WA 2JH3A 3GTQA 3GEEA 1DCOA
chains in the Genus database with same CATH topology
2PPBA 3K7AK 2Y0SL 4BY7C 3RZDK 1I3QC 1YNNA 1I50C 1HQMA 1TWAK 3S2HK 4OINA 3S17K 2B63C 2JA5K 3GTGC 1WCMK 2JA8C 3S14K 4A3CK 4MEXA 4QIWD 4KN7A 3H3VD 2NVTK 3HOZK 1TWAC 4A3IK 5M3MK 3GTKC 3GTPC 2JA5C 3GTGK 1Y1WK 2NVXK 4NOIA 5M5YK 3M4OC 5IYCK 2NVTC 4YFNA 3S16C 4KN4A 2O5IA 4A3LK 4BBRK 4A3EK 3GTQC 3RZOK 2WAQD 1XPPA 4JK1A 3S1RC 1Y1VK 2VUMK 3WODA 3RZDC 4A3FK 1YNJA 5C4XK 4OIPA 4XSXA 1I3QK 3S1QK 4G7OA 4LLGA 1WCMC 3S14C 5C44K 3S1NK 2YU9C 2E2IC 2JA6C 4A3GC 4A3KK 2A6HA 2NVXC 1TWGK 3GTJC 1SFOK 4BXXK 3HOWK 2O5JA 2NVYK 2R93K 2E2IK 4A3MK 1IW7A 5C3EK 3S15K 4LK1A 3GTOC 2WB1D 5M5XK 4LJZA 5IP9K 4BY1C 2PA8L 3GTQK 3S1MK 2JA7K 3DXJA 3GTJK 1SFOC 3S15C 4BXXC 4Q4ZA 3GTLC 1I6VA 2Y0SD 3PO2K 2WAQL 3M3YC 3H0GC 5C4XC 3HOVC 3GTKK 5IP9C 2CW0A 5C44C 4YFKA 4A3JK 3S1MC 2PMZD 4A3LC 4A3DK 5IP7K 3HOXC 3H0GK 5IYBK 4Y52C 3CQZK 5TMFA 4OIQA 3S2HC 1TWCK 3S1NC 1I50K 2NVYC 1Y1VC 3EQLA 4C3IK 1ZYRA 1K83K 4MQ9A 1TWGC 4XLNA 4G7ZA 4A3FC 3S1RK 5IYBC 5C4JK 2E2JK 2VUMC 5TMCA 3HOUC 3HOXK 1R9TC 5FLMC 2E2HK 3HOYC 4YFXA 3GTMC 5IYDK 5M5WK 4AYBD 4QJVA 4G7HA 4YG2A 3K7AC 4A3BK 4A93C 2A68A 4A3KC 4BBSK 5FLMK 2E2HC 1I6HK 3RZOC 5IYDC 2NVQC 3GTMK 3I4NK 4A3DC 2B63K 1SMYA 4AYBL 3GTOK 5C3EC 3HKZD 2A69A 3FKIK 4GZYA 2R7ZK 3GTPK 1TWCC 4C2MK 1Y1WC 4BY7K 4MEYA 3I4NC 3I4MC 4BBRC 4A3EC 5C4JC 2E2JC 4XSZA 2WB1L 1R9TK 3HOYK 3M3YK 1TWFK 4C3JK 4OIRA 4A3BC 2PMZL 3S17C 1TWHK 4A93K 5D4DA 3HOWC 4Y52K 4Y7NK 4A3IC 4ZH4A 3HOZC 3CQZC 2JA7C 2NVQK 4Q5SA 2YU9K 3HOUK 3PO3C 1K83C 4XLPA 3PO2C 1BDFA 2R93C 5IYCC 3GTLK 3S16K 2R7ZC 2R92K 4LK0A 4A3GK 3FKIC 2BE5A 4KMUA 3PO3K 5IP7C 3S2DK 4X6AK 4A3JC 3H3VL 2JA8K 4A3CC 4QJVB 4BY1K 3I4MK 1I6HC 3HKZL 2A6EA 4BBSC 2R92C 3S2DC 5M3FK 3S1QC 4X6AC 2PA8D 3M4OK 1TWFC 4Y7NC 5FJ8K 2JA6K 1TWHC 4QIWL 4C3HK 4OIOA 3HOVK 4A3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPB A;  3K7A K;  2Y0S L;  4BY7 C;  3RZD K;  1I3Q C;  1YNN A;  1I50 C;  1HQM A;  1TWA K;  3S2H K;  4OIN A;  3S17 K;  2B63 C;  2JA5 K;  3GTG C;  1WCM K;  2JA8 C;  3S14 K;  4A3C K;  4MEX A;  4QIW D;  4KN7 A;  3H3V D;  2NVT K;  3HOZ K;  1TWA C;  4A3I K;  5M3M K;  3GTK C;  3GTP C;  2JA5 C;  3GTG K;  1Y1W K;  2NVX K;  4NOI A;  5M5Y K;  3M4O C;  5IYC K;  2NVT C;  4YFN A;  3S16 C;  4KN4 A;  2O5I A;  4A3L K;  4BBR K;  4A3E K;  3GTQ C;  3RZO K;  2WAQ D;  1XPP A;  4JK1 A;  3S1R C;  1Y1V K;  2VUM K;  3WOD A;  3RZD C;  4A3F K;  1YNJ A;  5C4X K;  4OIP A;  4XSX A;  1I3Q K;  3S1Q K;  4G7O A;  4LLG A;  1WCM C;  3S14 C;  5C44 K;  3S1N K;  2YU9 C;  2E2I C;  2JA6 C;  4A3G C;  4A3K K;  2A6H A;  2NVX C;  1TWG K;  3GTJ C;  1SFO K;  4BXX K;  3HOW K;  2O5J A;  2NVY K;  2R93 K;  2E2I K;  4A3M K;  1IW7 A;  5C3E K;  3S15 K;  4LK1 A;  3GTO C;  2WB1 D;  5M5X K;  4LJZ A;  5IP9 K;  4BY1 C;  2PA8 L;  3GTQ K;  3S1M K;  2JA7 K;  3DXJ A;  3GTJ K;  1SFO C;  3S15 C;  4BXX C;  4Q4Z A;  3GTL C;  1I6V A;  2Y0S D;  3PO2 K;  2WAQ L;  3M3Y C;  3H0G C;  5C4X C;  3HOV C;  3GTK K;  5IP9 C;  2CW0 A;  5C44 C;  4YFK A;  4A3J K;  3S1M C;  2PMZ D;  4A3L C;  4A3D K;  5IP7 K;  3HOX C;  3H0G K;  5IYB K;  4Y52 C;  3CQZ K;  5TMF A;  4OIQ A;  3S2H C;  1TWC K;  3S1N C;  1I50 K;  2NVY C;  1Y1V C;  3EQL A;  4C3I K;  1ZYR A;  1K83 K;  4MQ9 A;  1TWG C;  4XLN A;  4G7Z A;  4A3F C;  3S1R K;  5IYB C;  5C4J K;  2E2J K;  2VUM C;  5TMC A;  3HOU C;  3HOX K;  1R9T C;  5FLM C;  2E2H K;  3HOY C;  4YFX A;  3GTM C;  5IYD K;  5M5W K;  4AYB D;  4QJV A;  4G7H A;  4YG2 A;  3K7A C;  4A3B K;  4A93 C;  2A68 A;  4A3K C;  4BBS K;  5FLM K;  2E2H C;  1I6H K;  3RZO C;  5IYD C;  2NVQ C;  3GTM K;  3I4N K;  4A3D C;  2B63 K;  1SMY A;  4AYB L;  3GTO K;  5C3E C;  3HKZ D;  2A69 A;  3FKI K;  4GZY A;  2R7Z K;  3GTP K;  1TWC C;  4C2M K;  1Y1W C;  4BY7 K;  4MEY A;  3I4N C;  3I4M C;  4BBR C;  4A3E C;  5C4J C;  2E2J C;  4XSZ A;  2WB1 L;  1R9T K;  3HOY K;  3M3Y K;  1TWF K;  4C3J K;  4OIR A;  4A3B C;  2PMZ L;  3S17 C;  1TWH K;  4A93 K;  5D4D A;  3HOW C;  4Y52 K;  4Y7N K;  4A3I C;  4ZH4 A;  3HOZ C;  3CQZ C;  2JA7 C;  2NVQ K;  4Q5S A;  2YU9 K;  3HOU K;  3PO3 C;  1K83 C;  4XLP A;  3PO2 C;  1BDF A;  2R93 C;  5IYC C;  3GTL K;  3S16 K;  2R7Z C;  2R92 K;  4LK0 A;  4A3G K;  3FKI C;  2BE5 A;  4KMU A;  3PO3 K;  5IP7 C;  3S2D K;  4X6A K;  4A3J C;  3H3V L;  2JA8 K;  4A3C C;  4QJV B;  4BY1 K;  3I4M K;  1I6H C;  3HKZ L;  2A6E A;  4BBS C;  2R92 C;  3S2D C;  5M3F K;  3S1Q C;  4X6A C;  2PA8 D;  3M4O K;  1TWF C;  4Y7N C;  5FJ8 K;  2JA6 K;  1TWH C;  4QIW L;  4C3H K;  4OIO A;  3HOV K;  4A3M C; 
#chains in the Genus database with same CATH topology
 4BY7 C;  2Y0S L;  1I3Q C;  2P5M A;  1I50 C;  1J98 A;  3S17 K;  3OPF A;  4KMH A;  3SZZ A;  4KN7 A;  3V4G A;  1TWA C;  4NOI A;  5M5Y K;  2EBB A;  4FZB A;  4YFN A;  1IE0 A;  3GTQ C;  4KM8 A;  3ERE D;  1XXC A;  4JK1 A;  1Y1V K;  1XXA A;  1USO A;  3L4K A;  3RZD C;  3LAP A;  1B4A A;  2NVX A;  4G7O A;  3S14 C;  3S1N K;  2JA6 C;  1IBA A;  1J6X A;  1ZVU A;  2NVY K;  4C3I C;  5C3E K;  1O28 A;  1USM A;  3H0G A;  4LK1 A;  3G4A A;  2WB1 D;  5M5X K;  2JA7 K;  3GTL C;  4DDQ A;  3L4J A;  3M3Y C;  1J6V A;  1ISE A;  2CW0 A;  3GTM A;  4A3J K;  3HOX C;  1WQH A;  4GFQ A;  4GTC A;  4Y52 C;  5EGE A;  5IYB K;  3S2H C;  1TWC K;  3Q3Q A;  3EQL A;  1Y1V C;  4XLN A;  4MQ9 A;  5IYB C;  3HOX K;  3AD7 C;  3GTM C;  5IYD K;  3K7A C;  1DCH A;  4A3B K;  1BS2 A;  4KAS A;  3RZO C;  3I4N K;  4AYB L;  1O2F B;  1F9N A;  5C3E C;  3GTJ A;  3FOE A;  2R7Z K;  2R7Z A;  1O2B A;  1Y1W C;  4BY7 K;  3I4N C;  3LPX A;  3HXA A;  1R9T K;  3HOY K;  2GAG C;  4BLB A;  4A3B C;  5D4D A;  2FQT A;  3TFH A;  4C45 A;  3HOZ C;  3A8K A;  4LQY A;  3ADA C;  2E2H A;  1VJE A;  3PO2 C;  1WSV A;  3T01 A;  3S0X A;  3NUH A;  4A3G K;  4KC6 A;  1WOO A;  4A3J C;  3N3Y A;  4QJV B;  4BY1 K;  2GSU A;  1I6H C;  1YCL A;  2A6E A;  4BBS C;  2R92 C;  3S1Q C;  3M4O K;  4GTA A;  1TWH C;  4C3H K;  4G0W A;  2JA5 A;  2ZUE A;  1XZP A;  4LR2 A;  3K7A K;  4P5B A;  3GSI A;  2NVY A;  2D6F C;  3CAG A;  3GTG C;  5JFE A;  3S14 K;  3S1N C;  4QIW D;  1O26 A;  5M3M K;  5IOR A;  3GTP C;  2JA5 C;  3G4C A;  5IYC K;  3S16 C;  3GIR A;  1V5V A;  3N0B A;  2GSO A;  3WOD A;  1BJT A;  4GTE A;  4OIP A;  4GTD A;  3GEH A;  2XCR B;  2V6T A;  5C44 K;  2YU9 C;  4A3K K;  4C3H C;  4KDD A;  1TWF A;  3ORE A;  5TJ3 A;  2GSN A;  4BY1 C;  3GTP A;  4BXX C;  4XCH A;  3TTG A;  4Q4Z A;  1I6V A;  2Y0S D;  3PO2 K;  3GTO A;  1VGX A;  2B63 A;  3HOV C;  1DD5 A;  5IP9 C;  1EQR A;  3MML B;  3S1M C;  5IP7 K;  5TMF A;  4OIQ A;  2E2I A;  1G51 A;  2R93 C;  1K83 K;  1TWG C;  4AH6 A;  1WOS A;  4A3F C;  1WQG A;  1O2A A;  1DCP A;  5FLM C;  1R9T C;  2E2H K;  3HOY C;  3BUE A;  1TWA A;  2XCQ A;  1C0A A;  4KMD A;  4A93 C;  3CQZ A;  2A68 A;  4A3K C;  4KM9 A;  4BBS K;  5FLM K;  2E2H C;  1I6H K;  1HI9 A;  1PJ7 A;  4A3D C;  2B63 K;  1VRQ C;  2ZUF A;  1B4B A;  2Y3P A;  4C2M K;  4KAT A;  4XSZ A;  2PMZ L;  3HOW C;  4P9S A;  4Y52 K;  4ZH4 A;  3VA7 A;  2NVQ K;  1IQ0 A;  3PO3 C;  1TWH A;  3GTL K;  2R7Z C;  4LOW A;  2BE5 A;  1JOE A;  1PJ5 A;  3S2D K;  4X6A K;  3H3V L;  3HKZ L;  3S2D C;  5M3F K;  4X6A C;  2PA8 D;  1TWF C;  4Y7N C;  2R92 A;  4WJ4 A;  2JA6 K;  2RH6 A;  4G0U A;  2YU9 A;  3OEP A;  3AQO A;  2PPB A;  3RZD K;  1YNN A;  3AH5 A;  3T02 A;  2PHC B;  1UV7 A;  3S2H K;  2JA5 K;  3QX3 A;  5EGH A;  2JA8 C;  1RU0 A;  4A3C K;  4MEX A;  3H3V D;  3HOZ K;  3GTG K;  1I50 A;  2NVX K;  1EK8 A;  4A3L K;  5CJ9 A;  1EFW A;  5JVO A;  2P8T A;  3S1R C;  2VUM K;  3TFJ A;  4XSX A;  1I3Q K;  1Y1W A;  3S1Q K;  4LLG A;  1WCM C;  1O27 A;  2E2I C;  1WCM A;  4A3G C;  2NVX C;  1TWG K;  3GTJ C;  1SFO K;  3HOW K;  2O5J A;  2R93 K;  3N0C A;  4A3M K;  1IW7 A;  1ZXO A;  3S15 K;  3GTO C;  4LJZ A;  5IP9 K;  2PA8 L;  3GTQ K;  5E68 A;  3S1M K;  1EI6 A;  3DXJ A;  3GTJ K;  1SFO C;  3S15 C;  4C2M C;  2CFA A;  2VUM A;  2WAQ L;  1XZQ A;  5C4X C;  5IOS A;  2PMZ D;  3JST A;  2RGR A;  4A3D K;  2V6U A;  3CQZ K;  1WSR A;  1I50 K;  1SFO A;  1ZYR A;  2FQO A;  3S1R K;  3HOU C;  5C4J K;  2E2J K;  2VUM C;  2KWA A;  5TMC A;  3BP3 A;  4YFX A;  4QJV A;  4G7H A;  1TWC A;  1I3Q A;  1YX2 A;  1ZBS A;  1X31 C;  3BP8 C;  3GDZ A;  4G0V A;  5IYD C;  2NVQ C;  3GTM K;  4PAA A;  4KB4 A;  1SMY A;  3GTO K;  2JA6 A;  2A69 A;  3FKI K;  3GTP K;  1TWC C;  3GTG A;  4MEY A;  3I4M C;  2WB1 L;  3M3Y K;  1WIH A;  1TWF K;  4OIR A;  4Y7N K;  2ZFZ A;  1O29 A;  2JA7 C;  1O25 A;  2YU9 K;  3HOU K;  2V6S A;  1L0W A;  2R92 K;  4LK0 A;  4KMU A;  3PO3 K;  3AD8 C;  4BKW A;  2CFA B;  2JA8 K;  2XCO A;  4A3C C;  3I4M K;  3FHZ A;  5CHP A;  3GTK A;  3FKI A;  4RMF A;  4ILD A;  4OIO A;  3AD9 C;  1VLO A;  3HOV K;  4A3M C;  1KQ4 A;  4KMA A;  2R93 A;  1HQM A;  1TWA K;  4OIN A;  2B63 C;  4GTF A;  5HL8 A;  1R9T A;  1WCM K;  1JQW A;  2NVT K;  1EH1 A;  1K83 A;  4A3I K;  3GTK C;  3IPJ A;  1Y1W K;  1O24 A;  3M4O C;  3T00 A;  2NVT C;  4KN4 A;  2O5I A;  4BBR K;  4A3E K;  3RZO K;  2WAQ D;  1XPP A;  1ZQ1 C;  4KAR A;  4A3F K;  1YNJ A;  5C4X K;  4J3N A;  4M1X A;  3TFI A;  1JVI A;  4KB2 A;  3GEI A;  2A6H A;  1TWG A;  2GAH C;  4BXX K;  2E2I K;  4KAW X;  5L46 A;  1IL2 A;  1F93 A;  1INN A;  3H0G C;  1XZP B;  4C3J C;  3GTK K;  5C44 C;  4YFK A;  4BLA A;  4A3L C;  5IOT A;  3H0G K;  4PAB A;  4C3I K;  2NVY C;  3A8J A;  4G7Z A;  1XZQ B;  1XXB A;  1IS1 A;  5M5W K;  4AYB D;  4P5A A;  4YG2 A;  4O2D A;  4GTL A;  1AB4 A;  1Y1V A;  1GE9 A;  3SZY A;  3FOF A;  4GT9 A;  3AQP A;  3HKZ D;  4GZY A;  2JA7 A;  4BBR C;  4A3E C;  5C4J C;  2E2J C;  1F7V A;  1F7U A;  4C3J K;  4A93 K;  1BGW A;  3S17 C;  1TWH K;  3GTL A;  2W7V A;  4A3I C;  4FM9 A;  3CQZ C;  1VH2 A;  4Q5S A;  1WQF A;  3A8I A;  1K83 C;  4XLP A;  1BDF A;  5IYC C;  3S16 K;  3FKI C;  5IP7 C;  3LAJ A;  4WJ3 M;  1PJ6 A;  1WOP A;  4WIL A;  5IOQ A;  4GTB A;  5FJ8 K;  1WOR A;  4QIW L;  1J6W A;  2JH3 A;  3GTQ A;  3GEE A;  1DCO A; 
#chains in the Genus database with same CATH homology
 2PPB A;  3K7A K;  2Y0S L;  4BY7 C;  3RZD K;  1I3Q C;  1YNN A;  1I50 C;  1HQM A;  1TWA K;  3S2H K;  4OIN A;  3S17 K;  2B63 C;  2JA5 K;  3GTG C;  1WCM K;  2JA8 C;  3S14 K;  4A3C K;  4MEX A;  4QIW D;  4KN7 A;  3H3V D;  2NVT K;  3HOZ K;  1TWA C;  4A3I K;  5M3M K;  3GTK C;  3GTP C;  2JA5 C;  3GTG K;  1Y1W K;  2NVX K;  4NOI A;  5M5Y K;  3M4O C;  5IYC K;  2NVT C;  4YFN A;  3S16 C;  4KN4 A;  2O5I A;  4A3L K;  4BBR K;  4A3E K;  3GTQ C;  3RZO K;  2WAQ D;  1XPP A;  4JK1 A;  3S1R C;  1Y1V K;  2VUM K;  3WOD A;  3RZD C;  4A3F K;  1YNJ A;  5C4X K;  4OIP A;  4XSX A;  1I3Q K;  3S1Q K;  4G7O A;  4LLG A;  1WCM C;  3S14 C;  5C44 K;  3S1N K;  2YU9 C;  2E2I C;  2JA6 C;  4A3G C;  4A3K K;  2A6H A;  2NVX C;  1TWG K;  3GTJ C;  1SFO K;  4BXX K;  3HOW K;  2O5J A;  2NVY K;  2R93 K;  2E2I K;  4A3M K;  1IW7 A;  5C3E K;  3S15 K;  4LK1 A;  3GTO C;  2WB1 D;  5M5X K;  4LJZ A;  5IP9 K;  4BY1 C;  2PA8 L;  3GTQ K;  3S1M K;  2JA7 K;  3DXJ A;  3GTJ K;  1SFO C;  3S15 C;  4BXX C;  4Q4Z A;  3GTL C;  1I6V A;  2Y0S D;  3PO2 K;  2WAQ L;  3M3Y C;  3H0G C;  5C4X C;  3HOV C;  3GTK K;  5IP9 C;  2CW0 A;  5C44 C;  4YFK A;  4A3J K;  3S1M C;  2PMZ D;  4A3L C;  4A3D K;  5IP7 K;  3HOX C;  3H0G K;  5IYB K;  4Y52 C;  3CQZ K;  5TMF A;  4OIQ A;  3S2H C;  1TWC K;  3S1N C;  1I50 K;  2NVY C;  1Y1V C;  3EQL A;  4C3I K;  1ZYR A;  1K83 K;  4MQ9 A;  1TWG C;  4XLN A;  4G7Z A;  4A3F C;  3S1R K;  5IYB C;  5C4J K;  2E2J K;  2VUM C;  5TMC A;  3HOU C;  3HOX K;  1R9T C;  5FLM C;  2E2H K;  3HOY C;  4YFX A;  3GTM C;  5IYD K;  5M5W K;  4AYB D;  4QJV A;  4G7H A;  4YG2 A;  3K7A C;  4A3B K;  4A93 C;  2A68 A;  4A3K C;  4BBS K;  5FLM K;  2E2H C;  1I6H K;  3RZO C;  5IYD C;  2NVQ C;  3GTM K;  3I4N K;  4A3D C;  2B63 K;  1SMY A;  4AYB L;  3GTO K;  5C3E C;  3HKZ D;  2A69 A;  3FKI K;  4GZY A;  2R7Z K;  3GTP K;  1TWC C;  4C2M K;  1Y1W C;  4BY7 K;  4MEY A;  3I4N C;  3I4M C;  4BBR C;  4A3E C;  5C4J C;  2E2J C;  4XSZ A;  2WB1 L;  1R9T K;  3HOY K;  3M3Y K;  1TWF K;  4C3J K;  4OIR A;  4A3B C;  2PMZ L;  3S17 C;  1TWH K;  4A93 K;  5D4D A;  3HOW C;  4Y52 K;  4Y7N K;  4A3I C;  4ZH4 A;  3HOZ C;  3CQZ C;  2JA7 C;  2NVQ K;  4Q5S A;  2YU9 K;  3HOU K;  3PO3 C;  1K83 C;  4XLP A;  3PO2 C;  1BDF A;  2R93 C;  5IYC C;  3GTL K;  3S16 K;  2R7Z C;  2R92 K;  4LK0 A;  4A3G K;  3FKI C;  2BE5 A;  4KMU A;  3PO3 K;  5IP7 C;  3S2D K;  4X6A K;  4A3J C;  3H3V L;  2JA8 K;  4A3C C;  4QJV B;  4BY1 K;  3I4M K;  1I6H C;  3HKZ L;  2A6E A;  4BBS C;  2R92 C;  3S2D C;  5M3F K;  3S1Q C;  4X6A C;  2PA8 D;  3M4O K;  1TWF C;  4Y7N C;  5FJ8 K;  2JA6 K;  1TWH C;  4QIW L;  4C3H K;  4OIO A;  3HOV K;  4A3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...