2WAQL

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
b'MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2waqL00
4C3JK 3PO2K 4C2MK 1TWAC 2WAQL 4Y52C 4AYBL 2NVXK 3GTGK 4YFKA 5M5WK 4G7ZA 4BY7C 1TWCK 4Y7NK 2E2HC 3S2HK 5C3EK 2PMZL 2E2IK 3GTKK 3S1QC 1IW7A 2R92K 2NVYC 4OIRA 1WCMC 3CQZC 4A3CC 2JA6C 4BY1K 4A3GK 4A3MK 4ZH4A 5C44K 1TWFK 4A3IC 3FKIK 2NVTK 3HKZL 4C3HK 3I4NK 4A3DC 2R93C 4YFNA 4Q4ZA 3GTPK 3RZOC 4KN7A 2A68A 4XSZA 2B63K 4LK0A 1I6HC 1K83C 5IYBC 2PA8D 1Y1WK 1YNNA 3S1MK 3I4MK 4KN4A 4YFXA 3GTJK 4A3FK 3GTLC 1I50K 2NVQC 3PO3K 4OIPA 5C4JC 4A3KC 3S16K 2YU9K 3S14C 3H3VD 4A3JC 1Y1VC 5IP7K 3GTOC 1SFOC 5IP9K 5TMFA 2VUMC 3K7AK 5IYDC 3HOUC 3S1RC 2WAQD 1TWGK 1R9TK 4A93C 4A3LC 2A69A 5FJ8K 3GTLK 3M3YK 2WB1D 2E2JK 3S15K 5FLMC 4BBRC 3HOVC 2JA8K 3GTQK 3GTMK 4C3IK 3M4OC 3HOXC 4A3KK 1I3QC 4OIOA 4Y52K 1TWAK 2Y0SD 4BY7K 1I6VA 5IYCC 2E2HK 3HOYC 5C4XC 2PPBA 4MEXA 1XPPA 5M3MK 3HOWC 1YNJA 3S1QK 3S1NC 4XLNA 2NVYK 1HQMA 1WCMK 3CQZK 4A3CK 2JA6K 2O5JA 3RZDC 4A3IK 2JA7C 3S2DC 4A3DK 4JK1A 2R93K 4QIWL 3RZOK 4OINA 2JA5C 4BXXC 4G7HA 1I6HK 1K83K 4NOIA 5IYBK 3S17C 3H0GC 4AYBD 1TWHC 4YG2A 4A3BC 1ZYRA 2NVQK 5C4JK 2PMZD 4A3EC 3S14K 4A3JK 1Y1VK 3EQLA 2JA5K 3GTOK 4BBSC 1SFOK 4QJVB 3HOZC 2PA8L 2VUMK 4X6AC 5IYDK 3HOUK 5M3FK 3S1RK 3PO2C 4A93K 4GZYA 4A3LK 2NVXC 3GTGC 3HKZD 1BDFA 4LLGA 4Y7NC 4QJVA 5FLMK 2A6EA 4BBRK 5C3EC 2E2IC 3GTKC 3HOVK 3H3VL 3M4OK 3HOXK 1I3QK 2R92C 5M5XK 3WODA 5TMCA 4BY1C 4LJZA 4KMUA 5C44C 4A3MC 2R7ZC 4Q5SA 1TWFC 4MEYA 5IYCK 3HOYK 3FKIC 5C4XK 2NVTC 3GTMC 3GTQC 3I4NC 2WB1L 3HOWK 4QIWD 3GTPC 3S1NK 2B63C 4XLPA 3RZDK 2A6HA 1Y1WC 2JA7K 2R7ZK 2Y0SL 3I4MC 3S2DK 3S1MC 4LK1A 3GTJC 4A3FC 1I50C 5D4DA 3PO3C 2O5IA 3S16C 4BXXK 4A3GC 2YU9C 3S17K 3H0GK 5IP7C 5IP9C 4G7OA 3K7AC 1SMYA 1TWHK 4OIQA 1TWGC 1R9TC 1TWCC 4A3BK 4XSXA 3S2HC 2BE5A 5M5YK 4A3EK 3M3YC 2E2JC 3S15C 2CW0A 4BBSK 2JA8C 3HOZK 4X6AK 4MQ9A 3DXJA
chains in the Genus database with same CATH superfamily
3GDZA 1IQ0A 1HI9A 1KQ4A 2RGRA 4LR2A 5E68A 1EH1A 2PMZL 5C3EK 2E2IK 1XZPA 4A3CC 4ZH4A 2A68A 4XSZA 4G0UA 3AD9C 3GSIA 1VJEA 4KB4A 2VUMA 3LAPA 3S16K 3S14C 2VUMC 3HOUC 3T00A 5FJ8K 2WB1D 3S15K 1ZXOA 2XCQA 3GTQK 3GTMK 1J6VA 3BUEA 1TWAK 4P5AA 2GSNA 2E2HK 2JA7A 2PPBA 1XPPA 1YX2A 5CJ9A 1ZQ1C 3OREA 3S1NC 4XLNA 2NVYK 1WCMK 4PABA 3RZDC 4BLBA 1L0WA 2JA7C 3G4AA 2R93K 4G0WA 4OINA 1I6HK 1K83K 3S17C 1B4AA 1DCOA 3HXAA 4KMAA 4A3BC 2JH3A 2NVQK 1JQWA 1O24A 4XCHA 3AD8C 1Y1VK 3BP3A 3GTOK 3GTKA 4GTFA 1VLOA 4C3JC 3PO2C 3S1RK 4A93K 2GSOA 1TWFA 4QJVA 2V6TA 3TTGA 5FLMK 1BGWA 3HOVK 3ERED 3GTKC 4A3MC 2ZUFA 1TWFC 1Y1WA 3HOWK 4KM8A 4QIWD 1O29A 1I50A 2A6HA 1Y1WC 3S1MC 4GTBA 3SZYA 1I50C 3PO3C 3H0GK 5IP7C 4LOWA 4XSXA 3FKIA 4A3EK 2GSUA 5JVOA 3GIRA 1XXBA 2JA8C 3HOZK 4KARA 4A3GC 2XCOA 4C2MK 4Y52C 2NVXK 2JA6A 4YFKA 4G7ZA 1XZQB 1WQHA 1UV7A 4GTDA 3S1QC 1IW7A 4KAWX 4OIRA 4A3GK 2JA6C 4BY1K 1WOSA 4A3IC 3FKIK 4GT9A 4C3HK 4A3DC 3A8KA 3RZOC 4KN7A 2PA8D 2ZUEA 3NUHA 2CFAA 3I4MK 4KN4A 1IL2A 4A3FK 5JFEA 3FOFA 1ZBSA 2YU9K 3H3VD 4A3JC 3T02A 1DCPA 5TMFA 3K7AK 4A3LC 1J6XA 1PJ5A 2E2JK 4BBRC 1F9NA 2FQOA 3M4OC 3HOXC 4A3KK 4BLAA 1I6VA 4PAAA 3HOYC 4GTCA 4A3CK 5IOTA 1X31C 4GFQA 2EBBA 1G51A 3SZZA 5EGEA 1VH2A 4AYBD 3FOEA 3GEEA 1O2AA 3T01A 3GTGA 4G0VA 3S14K 4BBSC 2V6SA 1O27A 2VUMK 3HOUK 2R92A 2R7ZA 3GTGC 3HKZD 4LLGA 3TFJA 4Y7NC 4P9SA 3QX3A 4C45A 1PJ6A 3GTPA 2R92C 5M5XK 2B63A 5TMCA 2R7ZC 4KMUA 5C44C 4MEYA 2NVTC 3I4NC 2WB1L 3GTPC 3S1NK 1EI6A 1J98A 3GTJA 2B63C 4KATA 3RZDK 5IORA 2JA7K 2R7ZK 1WQGA 3GTJC 1TWGA 4KB2A 1TWCA 1R9TA 4KMDA 2O5IA 3G4CA 3S17K 5IP9C 4DDQA 1SMYA 4A3BK 1TWGC 1R9TC 1TWCC 3S2HC 2P5MA 5M5YK 3M3YC 4C3IC 4C3JK 1DCHA 4BKWA 3PO2K 2WAQL 3CQZA 1XZPB 4M1XA 4BY7C 1TWCK 3S2HK 3GTKK 4RMFA 3CQZC 3BP8C 4A3MK 1F7VA 5EGHA 1TWFK 3S0XA 4LQYA 4Q4ZA 3GTLA 1F7UA 5IYBC 3V4GA 2V6UA 1Y1WK 1B4BA 3GEIA 3S1MK 1SFOA 4YFXA 3GTLC 2P8TA 1I50K 3PO3K 5C4JC 1WSVA 2D6FC 1EK8A 5TJ3A 5IP7K 1SFOC 2GAGC 5IYDC 1I3QA 3GTLK 5CHPA 5L46A 2JA8K 2ZFZA 1I3QC 4Y52K 2Y0SD 5IYCC 4KC6A 5C4XC 3AD7C 5M3MK 1V5VA 1EQRA 3S1QK 1C0AA 1HQMA 2O5JA 2JA6K 1EFWA 2JA5A 4A3IK 3N0BA 3S2DC 4A3DK 1WOPA 3RZOK 1TWHA 1IE0A 3OPFA 2JA5C 4BXXC 4NOIA 1DD5A 1TWHC 3L4KA 2PMZD 4A3JK 2JA5K 2E2IA 4QJVB 2PA8L 4X6AC 3N0CA 5M3FK 4A3LK 4BBRK 5C3EC 2E2IC 4AH6A 1XXCA 3N3YA 3H3VL 3M4OK 3HOXK 1USMA 3WODA 4LJZA 4Q5SA 3HOYK 1O25A 3LPXA 3FHZA 3MMLB 4KDDA 3LAJA 4WILA 4LK1A 5D4DA 3S16C 1O2FB 3A8IA 1RU0A 3GTQA 3GTMA 1PJ7A 4OIQA 1TWAA 1O28A 2BE5A 3S15C 2E2HA 2CW0A 4BBSK 3GTMC 3GTQC 4KM9A 3DXJA 1TWAC 2NVYA 1WCMA 4AYBL 3GTGK 5M5WK 4Y7NK 2GAHC 2E2HC 4GTAA 2R93A 1O2BA 2R92K 2NVYC 1WCMC 1XZQA 5C44K 1K83A 2NVTK 1VRQC 3HKZL 3I4NK 2R93C 4YFNA 2KWAA 2CFAB 3GTPK 2B63K 4LK0A 2XCRB 1I6HC 1K83C 1YNNA 1Y1VA 1XXAA 3GTOA 4GTLA 4WJ4A 1F93A 4O2DA 3GTJK 2NVQC 4OIPA 2PHCB 3AH5A 1Y1VC 3GTOC 3Q3QA 5HL8A 5IP9K 4WJ3M 1ZVUA 3S1RC 2WAQD 1TWGK 3CAGA 1R9TK 4A93C 2A69A 3M3YK 5FLMC 3HOVC 4C3IK 4OIOA 4BY7K 1WIHA 1WOOA 4MEXA 3HOWC 1YNJA 3AQPA 3CQZK 2W7VA 3IPJA 1WORA 1YCLA 1IS1A 2RH6A 3H0GA 4J3NA 4GTEA 1IBAA 4JK1A 1USOA 4QIWL 4FM9A 3A8JA 4G7HA 5IYBK 3H0GC 3OEPA 4YG2A 1ZYRA 5C4JK 2NVXA 4A3EC 5IOQA 3EQLA 1JOEA 1SFOK 3HOZC 3ADAC 1GE9A 5IYDK 4C2MC 4GZYA 2NVXC 3TFIA 1JVIA 1VGXA 1BDFA 2A6EA 3JSTA 1I3QK 4BY1C 4KASA 2FQTA 5IYCK 1WQFA 3FKIC 3GEHA 5C4XK 4C3HC 4FZBA 4XLPA 1BS2A 4KMHA 3TFHA 2YU9A 1INNA 1J6WA 2Y0SL 3I4MC 2Y3PA 3S2DK 1ISEA 4A3FC 1BJTA 4P5BA 4BXXK 2YU9C 1AB4A 3AQOA 5IOSA 3VA7A 4G7OA 3K7AC 1TWHK 3L4JA 1O26A 2E2JC 1WSRA 4ILDA 4X6AK 4MQ9A 4A3KC
chains in the Genus database with same CATH topology
4C3JK 3PO2K 4C2MK 1TWAC 2WAQL 4Y52C 4AYBL 2NVXK 3GTGK 4YFKA 5M5WK 4G7ZA 4BY7C 1TWCK 4Y7NK 2E2HC 3S2HK 5C3EK 2PMZL 2E2IK 3GTKK 3S1QC 1IW7A 2R92K 2NVYC 4OIRA 1WCMC 3CQZC 4A3CC 2JA6C 4BY1K 4A3GK 4A3MK 4ZH4A 5C44K 1TWFK 4A3IC 3FKIK 2NVTK 3HKZL 4C3HK 3I4NK 4A3DC 2R93C 4YFNA 4Q4ZA 3GTPK 3RZOC 4KN7A 2A68A 4XSZA 2B63K 4LK0A 1I6HC 1K83C 5IYBC 2PA8D 1Y1WK 1YNNA 3S1MK 3I4MK 4KN4A 4YFXA 3GTJK 4A3FK 3GTLC 1I50K 2NVQC 3PO3K 4OIPA 5C4JC 4A3KC 3S16K 2YU9K 3S14C 3H3VD 4A3JC 1Y1VC 5IP7K 3GTOC 1SFOC 5IP9K 5TMFA 2VUMC 3K7AK 5IYDC 3HOUC 3S1RC 2WAQD 1TWGK 1R9TK 4A93C 4A3LC 2A69A 5FJ8K 3GTLK 3M3YK 2WB1D 2E2JK 3S15K 5FLMC 4BBRC 3HOVC 2JA8K 3GTQK 3GTMK 4C3IK 3M4OC 3HOXC 4A3KK 1I3QC 4OIOA 4Y52K 1TWAK 2Y0SD 4BY7K 1I6VA 5IYCC 2E2HK 3HOYC 5C4XC 2PPBA 4MEXA 1XPPA 5M3MK 3HOWC 1YNJA 3S1QK 3S1NC 4XLNA 2NVYK 1HQMA 1WCMK 3CQZK 4A3CK 2JA6K 2O5JA 3RZDC 4A3IK 2JA7C 3S2DC 4A3DK 4JK1A 2R93K 4QIWL 3RZOK 4OINA 2JA5C 4BXXC 4G7HA 1I6HK 1K83K 4NOIA 5IYBK 3S17C 3H0GC 4AYBD 1TWHC 4YG2A 4A3BC 1ZYRA 2NVQK 5C4JK 2PMZD 4A3EC 3S14K 4A3JK 1Y1VK 3EQLA 2JA5K 3GTOK 4BBSC 1SFOK 4QJVB 3HOZC 2PA8L 2VUMK 4X6AC 5IYDK 3HOUK 5M3FK 3S1RK 3PO2C 4A93K 4GZYA 4A3LK 2NVXC 3GTGC 3HKZD 1BDFA 4LLGA 4Y7NC 4QJVA 5FLMK 2A6EA 4BBRK 5C3EC 2E2IC 3GTKC 3HOVK 3H3VL 3M4OK 3HOXK 1I3QK 2R92C 5M5XK 3WODA 5TMCA 4BY1C 4LJZA 4KMUA 5C44C 4A3MC 2R7ZC 4Q5SA 1TWFC 4MEYA 5IYCK 3HOYK 3FKIC 5C4XK 2NVTC 3GTMC 3GTQC 3I4NC 2WB1L 3HOWK 4QIWD 3GTPC 3S1NK 2B63C 4XLPA 3RZDK 2A6HA 1Y1WC 2JA7K 2R7ZK 2Y0SL 3I4MC 3S2DK 3S1MC 4LK1A 3GTJC 4A3FC 1I50C 5D4DA 3PO3C 2O5IA 3S16C 4BXXK 4A3GC 2YU9C 3S17K 3H0GK 5IP7C 5IP9C 4G7OA 3K7AC 1SMYA 1TWHK 4OIQA 1TWGC 1R9TC 1TWCC 4A3BK 4XSXA 3S2HC 2BE5A 5M5YK 4A3EK 3M3YC 2E2JC 3S15C 2CW0A 4BBSK 2JA8C 3HOZK 4X6AK 4MQ9A 3DXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J K;  3PO2 K;  4C2M K;  1TWA C;  2WAQ L;  4Y52 C;  4AYB L;  2NVX K;  3GTG K;  4YFK A;  5M5W K;  4G7Z A;  4BY7 C;  1TWC K;  4Y7N K;  2E2H C;  3S2H K;  5C3E K;  2PMZ L;  2E2I K;  3GTK K;  3S1Q C;  1IW7 A;  2R92 K;  2NVY C;  4OIR A;  1WCM C;  3CQZ C;  4A3C C;  2JA6 C;  4BY1 K;  4A3G K;  4A3M K;  4ZH4 A;  5C44 K;  1TWF K;  4A3I C;  3FKI K;  2NVT K;  3HKZ L;  4C3H K;  3I4N K;  4A3D C;  2R93 C;  4YFN A;  4Q4Z A;  3GTP K;  3RZO C;  4KN7 A;  2A68 A;  4XSZ A;  2B63 K;  4LK0 A;  1I6H C;  1K83 C;  5IYB C;  2PA8 D;  1Y1W K;  1YNN A;  3S1M K;  3I4M K;  4KN4 A;  4YFX A;  3GTJ K;  4A3F K;  3GTL C;  1I50 K;  2NVQ C;  3PO3 K;  4OIP A;  5C4J C;  4A3K C;  3S16 K;  2YU9 K;  3S14 C;  3H3V D;  4A3J C;  1Y1V C;  5IP7 K;  3GTO C;  1SFO C;  5IP9 K;  5TMF A;  2VUM C;  3K7A K;  5IYD C;  3HOU C;  3S1R C;  2WAQ D;  1TWG K;  1R9T K;  4A93 C;  4A3L C;  2A69 A;  5FJ8 K;  3GTL K;  3M3Y K;  2WB1 D;  2E2J K;  3S15 K;  5FLM C;  4BBR C;  3HOV C;  2JA8 K;  3GTQ K;  3GTM K;  4C3I K;  3M4O C;  3HOX C;  4A3K K;  1I3Q C;  4OIO A;  4Y52 K;  1TWA K;  2Y0S D;  4BY7 K;  1I6V A;  5IYC C;  2E2H K;  3HOY C;  5C4X C;  2PPB A;  4MEX A;  1XPP A;  5M3M K;  3HOW C;  1YNJ A;  3S1Q K;  3S1N C;  4XLN A;  2NVY K;  1HQM A;  1WCM K;  3CQZ K;  4A3C K;  2JA6 K;  2O5J A;  3RZD C;  4A3I K;  2JA7 C;  3S2D C;  4A3D K;  4JK1 A;  2R93 K;  4QIW L;  3RZO K;  4OIN A;  2JA5 C;  4BXX C;  4G7H A;  1I6H K;  1K83 K;  4NOI A;  5IYB K;  3S17 C;  3H0G C;  4AYB D;  1TWH C;  4YG2 A;  4A3B C;  1ZYR A;  2NVQ K;  5C4J K;  2PMZ D;  4A3E C;  3S14 K;  4A3J K;  1Y1V K;  3EQL A;  2JA5 K;  3GTO K;  4BBS C;  1SFO K;  4QJV B;  3HOZ C;  2PA8 L;  2VUM K;  4X6A C;  5IYD K;  3HOU K;  5M3F K;  3S1R K;  3PO2 C;  4A93 K;  4GZY A;  4A3L K;  2NVX C;  3GTG C;  3HKZ D;  1BDF A;  4LLG A;  4Y7N C;  4QJV A;  5FLM K;  2A6E A;  4BBR K;  5C3E C;  2E2I C;  3GTK C;  3HOV K;  3H3V L;  3M4O K;  3HOX K;  1I3Q K;  2R92 C;  5M5X K;  3WOD A;  5TMC A;  4BY1 C;  4LJZ A;  4KMU A;  5C44 C;  4A3M C;  2R7Z C;  4Q5S A;  1TWF C;  4MEY A;  5IYC K;  3HOY K;  3FKI C;  5C4X K;  2NVT C;  3GTM C;  3GTQ C;  3I4N C;  2WB1 L;  3HOW K;  4QIW D;  3GTP C;  3S1N K;  2B63 C;  4XLP A;  3RZD K;  2A6H A;  1Y1W C;  2JA7 K;  2R7Z K;  2Y0S L;  3I4M C;  3S2D K;  3S1M C;  4LK1 A;  3GTJ C;  4A3F C;  1I50 C;  5D4D A;  3PO3 C;  2O5I A;  3S16 C;  4BXX K;  4A3G C;  2YU9 C;  3S17 K;  3H0G K;  5IP7 C;  5IP9 C;  4G7O A;  3K7A C;  1SMY A;  1TWH K;  4OIQ A;  1TWG C;  1R9T C;  1TWC C;  4A3B K;  4XSX A;  3S2H C;  2BE5 A;  5M5Y K;  4A3E K;  3M3Y C;  2E2J C;  3S15 C;  2CW0 A;  4BBS K;  2JA8 C;  3HOZ K;  4X6A K;  4MQ9 A;  3DXJ A; 
#chains in the Genus database with same CATH topology
 3GDZ A;  1IQ0 A;  1HI9 A;  1KQ4 A;  2RGR A;  4LR2 A;  5E68 A;  1EH1 A;  2PMZ L;  5C3E K;  2E2I K;  1XZP A;  4A3C C;  4ZH4 A;  2A68 A;  4XSZ A;  4G0U A;  3AD9 C;  3GSI A;  1VJE A;  4KB4 A;  2VUM A;  3LAP A;  3S16 K;  3S14 C;  2VUM C;  3HOU C;  3T00 A;  5FJ8 K;  2WB1 D;  3S15 K;  1ZXO A;  2XCQ A;  3GTQ K;  3GTM K;  1J6V A;  3BUE A;  1TWA K;  4P5A A;  2GSN A;  2E2H K;  2JA7 A;  2PPB A;  1XPP A;  1YX2 A;  5CJ9 A;  1ZQ1 C;  3ORE A;  3S1N C;  4XLN A;  2NVY K;  1WCM K;  4PAB A;  3RZD C;  4BLB A;  1L0W A;  2JA7 C;  3G4A A;  2R93 K;  4G0W A;  4OIN A;  1I6H K;  1K83 K;  3S17 C;  1B4A A;  1DCO A;  3HXA A;  4KMA A;  4A3B C;  2JH3 A;  2NVQ K;  1JQW A;  1O24 A;  4XCH A;  3AD8 C;  1Y1V K;  3BP3 A;  3GTO K;  3GTK A;  4GTF A;  1VLO A;  4C3J C;  3PO2 C;  3S1R K;  4A93 K;  2GSO A;  1TWF A;  4QJV A;  2V6T A;  3TTG A;  5FLM K;  1BGW A;  3HOV K;  3ERE D;  3GTK C;  4A3M C;  2ZUF A;  1TWF C;  1Y1W A;  3HOW K;  4KM8 A;  4QIW D;  1O29 A;  1I50 A;  2A6H A;  1Y1W C;  3S1M C;  4GTB A;  3SZY A;  1I50 C;  3PO3 C;  3H0G K;  5IP7 C;  4LOW A;  4XSX A;  3FKI A;  4A3E K;  2GSU A;  5JVO A;  3GIR A;  1XXB A;  2JA8 C;  3HOZ K;  4KAR A;  4A3G C;  2XCO A;  4C2M K;  4Y52 C;  2NVX K;  2JA6 A;  4YFK A;  4G7Z A;  1XZQ B;  1WQH A;  1UV7 A;  4GTD A;  3S1Q C;  1IW7 A;  4KAW X;  4OIR A;  4A3G K;  2JA6 C;  4BY1 K;  1WOS A;  4A3I C;  3FKI K;  4GT9 A;  4C3H K;  4A3D C;  3A8K A;  3RZO C;  4KN7 A;  2PA8 D;  2ZUE A;  3NUH A;  2CFA A;  3I4M K;  4KN4 A;  1IL2 A;  4A3F K;  5JFE A;  3FOF A;  1ZBS A;  2YU9 K;  3H3V D;  4A3J C;  3T02 A;  1DCP A;  5TMF A;  3K7A K;  4A3L C;  1J6X A;  1PJ5 A;  2E2J K;  4BBR C;  1F9N A;  2FQO A;  3M4O C;  3HOX C;  4A3K K;  4BLA A;  1I6V A;  4PAA A;  3HOY C;  4GTC A;  4A3C K;  5IOT A;  1X31 C;  4GFQ A;  2EBB A;  1G51 A;  3SZZ A;  5EGE A;  1VH2 A;  4AYB D;  3FOE A;  3GEE A;  1O2A A;  3T01 A;  3GTG A;  4G0V A;  3S14 K;  4BBS C;  2V6S A;  1O27 A;  2VUM K;  3HOU K;  2R92 A;  2R7Z A;  3GTG C;  3HKZ D;  4LLG A;  3TFJ A;  4Y7N C;  4P9S A;  3QX3 A;  4C45 A;  1PJ6 A;  3GTP A;  2R92 C;  5M5X K;  2B63 A;  5TMC A;  2R7Z C;  4KMU A;  5C44 C;  4MEY A;  2NVT C;  3I4N C;  2WB1 L;  3GTP C;  3S1N K;  1EI6 A;  1J98 A;  3GTJ A;  2B63 C;  4KAT A;  3RZD K;  5IOR A;  2JA7 K;  2R7Z K;  1WQG A;  3GTJ C;  1TWG A;  4KB2 A;  1TWC A;  1R9T A;  4KMD A;  2O5I A;  3G4C A;  3S17 K;  5IP9 C;  4DDQ A;  1SMY A;  4A3B K;  1TWG C;  1R9T C;  1TWC C;  3S2H C;  2P5M A;  5M5Y K;  3M3Y C;  4C3I C;  4C3J K;  1DCH A;  4BKW A;  3PO2 K;  2WAQ L;  3CQZ A;  1XZP B;  4M1X A;  4BY7 C;  1TWC K;  3S2H K;  3GTK K;  4RMF A;  3CQZ C;  3BP8 C;  4A3M K;  1F7V A;  5EGH A;  1TWF K;  3S0X A;  4LQY A;  4Q4Z A;  3GTL A;  1F7U A;  5IYB C;  3V4G A;  2V6U A;  1Y1W K;  1B4B A;  3GEI A;  3S1M K;  1SFO A;  4YFX A;  3GTL C;  2P8T A;  1I50 K;  3PO3 K;  5C4J C;  1WSV A;  2D6F C;  1EK8 A;  5TJ3 A;  5IP7 K;  1SFO C;  2GAG C;  5IYD C;  1I3Q A;  3GTL K;  5CHP A;  5L46 A;  2JA8 K;  2ZFZ A;  1I3Q C;  4Y52 K;  2Y0S D;  5IYC C;  4KC6 A;  5C4X C;  3AD7 C;  5M3M K;  1V5V A;  1EQR A;  3S1Q K;  1C0A A;  1HQM A;  2O5J A;  2JA6 K;  1EFW A;  2JA5 A;  4A3I K;  3N0B A;  3S2D C;  4A3D K;  1WOP A;  3RZO K;  1TWH A;  1IE0 A;  3OPF A;  2JA5 C;  4BXX C;  4NOI A;  1DD5 A;  1TWH C;  3L4K A;  2PMZ D;  4A3J K;  2JA5 K;  2E2I A;  4QJV B;  2PA8 L;  4X6A C;  3N0C A;  5M3F K;  4A3L K;  4BBR K;  5C3E C;  2E2I C;  4AH6 A;  1XXC A;  3N3Y A;  3H3V L;  3M4O K;  3HOX K;  1USM A;  3WOD A;  4LJZ A;  4Q5S A;  3HOY K;  1O25 A;  3LPX A;  3FHZ A;  3MML B;  4KDD A;  3LAJ A;  4WIL A;  4LK1 A;  5D4D A;  3S16 C;  1O2F B;  3A8I A;  1RU0 A;  3GTQ A;  3GTM A;  1PJ7 A;  4OIQ A;  1TWA A;  1O28 A;  2BE5 A;  3S15 C;  2E2H A;  2CW0 A;  4BBS K;  3GTM C;  3GTQ C;  4KM9 A;  3DXJ A;  1TWA C;  2NVY A;  1WCM A;  4AYB L;  3GTG K;  5M5W K;  4Y7N K;  2GAH C;  2E2H C;  4GTA A;  2R93 A;  1O2B A;  2R92 K;  2NVY C;  1WCM C;  1XZQ A;  5C44 K;  1K83 A;  2NVT K;  1VRQ C;  3HKZ L;  3I4N K;  2R93 C;  4YFN A;  2KWA A;  2CFA B;  3GTP K;  2B63 K;  4LK0 A;  2XCR B;  1I6H C;  1K83 C;  1YNN A;  1Y1V A;  1XXA A;  3GTO A;  4GTL A;  4WJ4 A;  1F93 A;  4O2D A;  3GTJ K;  2NVQ C;  4OIP A;  2PHC B;  3AH5 A;  1Y1V C;  3GTO C;  3Q3Q A;  5HL8 A;  5IP9 K;  4WJ3 M;  1ZVU A;  3S1R C;  2WAQ D;  1TWG K;  3CAG A;  1R9T K;  4A93 C;  2A69 A;  3M3Y K;  5FLM C;  3HOV C;  4C3I K;  4OIO A;  4BY7 K;  1WIH A;  1WOO A;  4MEX A;  3HOW C;  1YNJ A;  3AQP A;  3CQZ K;  2W7V A;  3IPJ A;  1WOR A;  1YCL A;  1IS1 A;  2RH6 A;  3H0G A;  4J3N A;  4GTE A;  1IBA A;  4JK1 A;  1USO A;  4QIW L;  4FM9 A;  3A8J A;  4G7H A;  5IYB K;  3H0G C;  3OEP A;  4YG2 A;  1ZYR A;  5C4J K;  2NVX A;  4A3E C;  5IOQ A;  3EQL A;  1JOE A;  1SFO K;  3HOZ C;  3ADA C;  1GE9 A;  5IYD K;  4C2M C;  4GZY A;  2NVX C;  3TFI A;  1JVI A;  1VGX A;  1BDF A;  2A6E A;  3JST A;  1I3Q K;  4BY1 C;  4KAS A;  2FQT A;  5IYC K;  1WQF A;  3FKI C;  3GEH A;  5C4X K;  4C3H C;  4FZB A;  4XLP A;  1BS2 A;  4KMH A;  3TFH A;  2YU9 A;  1INN A;  1J6W A;  2Y0S L;  3I4M C;  2Y3P A;  3S2D K;  1ISE A;  4A3F C;  1BJT A;  4P5B A;  4BXX K;  2YU9 C;  1AB4 A;  3AQO A;  5IOS A;  3VA7 A;  4G7O A;  3K7A C;  1TWH K;  3L4J A;  1O26 A;  2E2J C;  1WSR A;  4ILD A;  4X6A K;  4MQ9 A;  4A3K C; 
#chains in the Genus database with same CATH homology
 4C3J K;  3PO2 K;  4C2M K;  1TWA C;  2WAQ L;  4Y52 C;  4AYB L;  2NVX K;  3GTG K;  4YFK A;  5M5W K;  4G7Z A;  4BY7 C;  1TWC K;  4Y7N K;  2E2H C;  3S2H K;  5C3E K;  2PMZ L;  2E2I K;  3GTK K;  3S1Q C;  1IW7 A;  2R92 K;  2NVY C;  4OIR A;  1WCM C;  3CQZ C;  4A3C C;  2JA6 C;  4BY1 K;  4A3G K;  4A3M K;  4ZH4 A;  5C44 K;  1TWF K;  4A3I C;  3FKI K;  2NVT K;  3HKZ L;  4C3H K;  3I4N K;  4A3D C;  2R93 C;  4YFN A;  4Q4Z A;  3GTP K;  3RZO C;  4KN7 A;  2A68 A;  4XSZ A;  2B63 K;  4LK0 A;  1I6H C;  1K83 C;  5IYB C;  2PA8 D;  1Y1W K;  1YNN A;  3S1M K;  3I4M K;  4KN4 A;  4YFX A;  3GTJ K;  4A3F K;  3GTL C;  1I50 K;  2NVQ C;  3PO3 K;  4OIP A;  5C4J C;  4A3K C;  3S16 K;  2YU9 K;  3S14 C;  3H3V D;  4A3J C;  1Y1V C;  5IP7 K;  3GTO C;  1SFO C;  5IP9 K;  5TMF A;  2VUM C;  3K7A K;  5IYD C;  3HOU C;  3S1R C;  2WAQ D;  1TWG K;  1R9T K;  4A93 C;  4A3L C;  2A69 A;  5FJ8 K;  3GTL K;  3M3Y K;  2WB1 D;  2E2J K;  3S15 K;  5FLM C;  4BBR C;  3HOV C;  2JA8 K;  3GTQ K;  3GTM K;  4C3I K;  3M4O C;  3HOX C;  4A3K K;  1I3Q C;  4OIO A;  4Y52 K;  1TWA K;  2Y0S D;  4BY7 K;  1I6V A;  5IYC C;  2E2H K;  3HOY C;  5C4X C;  2PPB A;  4MEX A;  1XPP A;  5M3M K;  3HOW C;  1YNJ A;  3S1Q K;  3S1N C;  4XLN A;  2NVY K;  1HQM A;  1WCM K;  3CQZ K;  4A3C K;  2JA6 K;  2O5J A;  3RZD C;  4A3I K;  2JA7 C;  3S2D C;  4A3D K;  4JK1 A;  2R93 K;  4QIW L;  3RZO K;  4OIN A;  2JA5 C;  4BXX C;  4G7H A;  1I6H K;  1K83 K;  4NOI A;  5IYB K;  3S17 C;  3H0G C;  4AYB D;  1TWH C;  4YG2 A;  4A3B C;  1ZYR A;  2NVQ K;  5C4J K;  2PMZ D;  4A3E C;  3S14 K;  4A3J K;  1Y1V K;  3EQL A;  2JA5 K;  3GTO K;  4BBS C;  1SFO K;  4QJV B;  3HOZ C;  2PA8 L;  2VUM K;  4X6A C;  5IYD K;  3HOU K;  5M3F K;  3S1R K;  3PO2 C;  4A93 K;  4GZY A;  4A3L K;  2NVX C;  3GTG C;  3HKZ D;  1BDF A;  4LLG A;  4Y7N C;  4QJV A;  5FLM K;  2A6E A;  4BBR K;  5C3E C;  2E2I C;  3GTK C;  3HOV K;  3H3V L;  3M4O K;  3HOX K;  1I3Q K;  2R92 C;  5M5X K;  3WOD A;  5TMC A;  4BY1 C;  4LJZ A;  4KMU A;  5C44 C;  4A3M C;  2R7Z C;  4Q5S A;  1TWF C;  4MEY A;  5IYC K;  3HOY K;  3FKI C;  5C4X K;  2NVT C;  3GTM C;  3GTQ C;  3I4N C;  2WB1 L;  3HOW K;  4QIW D;  3GTP C;  3S1N K;  2B63 C;  4XLP A;  3RZD K;  2A6H A;  1Y1W C;  2JA7 K;  2R7Z K;  2Y0S L;  3I4M C;  3S2D K;  3S1M C;  4LK1 A;  3GTJ C;  4A3F C;  1I50 C;  5D4D A;  3PO3 C;  2O5I A;  3S16 C;  4BXX K;  4A3G C;  2YU9 C;  3S17 K;  3H0G K;  5IP7 C;  5IP9 C;  4G7O A;  3K7A C;  1SMY A;  1TWH K;  4OIQ A;  1TWG C;  1R9T C;  1TWC C;  4A3B K;  4XSX A;  3S2H C;  2BE5 A;  5M5Y K;  4A3E K;  3M3Y C;  2E2J C;  3S15 C;  2CW0 A;  4BBS K;  2JA8 C;  3HOZ K;  4X6A K;  4MQ9 A;  3DXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...