2WAQL

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2waqL00
5TMFA 2A6HA 3GTOK 1WCMC 3H3VL 1TWGK 4XSXA 5D4DA 4G7OA 3I4MK 3FKIK 2E2HC 3HKZL 2R93K 2BE5A 3GTKK 4A3BK 4A3KC 2JA5K 4XSZA 4A3CK 5M5YK 3S2HK 5IP7K 1I6VA 1R9TC 4OIPA 4BBRC 3S14K 1I3QK 3WODA 3RZDC 1SFOC 5IYCC 4OIRA 3GTOC 2JA6C 1TWHK 3RZOK 4G7HA 3PO2C 4JK1A 2WB1L 5IP9K 4MQ9A 2PMZD 5C44C 4QJVA 2A69A 2WAQD 3GTKC 4KN7A 2NVTK 1Y1WC 3GTLC 4LLGA 2VUMC 3S1NC 5C4JK 4A3MC 4C3JK 3H0GC 5M3FK 4XLNA 5IYDC 3HOVK 3S2DK 2JA8K 1Y1VK 4A3JK 2E2JK 3M3YK 3RZOC 4BY1C 4LJZA 4NOIA 3I4NK 1K83K 3S1QC 4GZYA 4A3EC 3K7AK 3GTMK 5IYBC 3HOYC 1TWCC 1YNNA 4A3GK 2PPBA 4A3FK 3GTQK 2R92C 2A6EA 4QJVB 5C4XK 3HOWC 3CQZC 4XLPA 2NVTC 3S16C 4YFKA 4G7ZA 5FLMC 2R7ZC 2B63C 3PO3C 4A3LK 2NVQK 2JA7K 3HOVC 4AYBD 1TWGC 4YFXA 3S15K 4AYBL 4C3HK 4LK1A 3I4MC 3FKIC 3S1MK 4A93K 4Y52K 1YNJA 2A68A 3GTJK 3GTPK 2PMZL 3GTGK 3S1RK 2R93C 1TWFK 4A3BC 2JA5C 3PO3K 2WAQL 4A3CC 2O5JA 4QIWD 3HOUK 3HOXK 2E2IK 2YU9K 2NVYK 5IP7C 3HOZK 4OIQA 4MEYA 4BBSK 4KN4A 4X6AK 3S14C 1I3QC 4A3DC 3S2HC 1I6HK 1TWHC 2NVXK 1I50K 4A3IK 1TWAK 4BY7K 5IP9C 1SMYA 2R7ZK 4BXXK 5C3EK 4Q5SA 1HQMA 1XPPA 5C3EC 4YFNA 2PA8D 5C4JC 3HOZC 2E2HK 3S17K 4YG2A 3S2DC 2JA8C 1Y1VC 4A3JC 2E2JC 4A3KK 3M3YC 5M3MK 3I4NC 1IW7A 1K83C 4MEXA 3K7AC 1R9TK 3GTMC 3H3VD 4A3GC 2CW0A 3RZDK 4A3FC 5IYCK 1SFOK 3GTQC 2JA6K 5C4XC 3PO2K 5M5WK 4Q4ZA 1ZYRA 4QIWL 3M4OK 3HKZD 3S17C 1BDFA 4A3LC 5C44K 2NVQC 2JA7C 5TMCA 3S15C 4ZH4A 1Y1WK 3GTLK 2VUMK 4KMUA 3S1NK 4Y7NK 4A3MK 4Y52C 3S1MC 4A93C 3H0GK 3DXJA 2O5IA 3GTJC 3GTPC 5FJ8K 3S1RC 3GTGC 1TWFC 4A3DK 1WCMK 5IYDK 5M5XK 4BY1K 3HOUC 3EQLA 3HOXC 2E2IC 2YU9C 2NVYC 2WB1D 3S1QK 4A3EK 3M4OC 2PA8L 5IYBK 4BBSC 3HOYK 4X6AC 1TWCK 4C3IK 2Y0SD 1I6HC 2Y0SL 2NVXC 2R92K 4C2MK 1I50C 4A3IC 3CQZK 1TWAC 4OINA 3HOWK 4LK0A 3S16K 4OIOA 4Y7NC 4BY7C 5FLMK 4BXXC 2B63K 4BBRK
chains in the Genus database with same CATH superfamily
5TMFA 2YU9A 5D4DA 1O24A 1TWAA 4A3BK 4A3KC 4XSZA 4A3CK 2R7ZA 4GTAA 2GAHC 1R9TC 3FOEA 2PHCB 1O29A 4BBRC 1I3QK 3SZZA 3S2HK 1RU0A 3RZOK 4G7HA 1EQRA 4KC6A 1IL2A 2PMZD 3LAJA 4G0UA 4KN7A 4FM9A 1BS2A 1Y1WC 3GTLC 3S1NC 3H0GC 2FQTA 3M3YK 4LQYA 5IYBC 1YNNA 1O28A 2PPBA 4P5BA 4KM9A 4C2MC 5C4XK 2NVTC 4XLPA 1WCMA 4YFKA 4G7ZA 3PO3C 4KASA 3HOVC 1J6VA 3S15K 1TWCA 2V6UA 4LK1A 3GIRA 3I4MC 3S1MK 2A68A 3GTPK 3S1RK 1TWFK 3T00A 2WAQL 2E2IK 1DCPA 1YCLA 2NVYK 4MEYA 4BBSK 4A3DC 1TWHC 2R93A 3AD7C 3NUHA 2JA5A 2GSUA 5C3EK 1HQMA 4G0VA 4WJ3M 4C3JC 3LPXA 3S2DC 4KATA 1Y1VC 3OEPA 2E2JC 4A3KK 1R9TK 3GTMC 1DD5A 2GSNA 3AH5A 1EK8A 4BLBA 3IPJA 4Q4ZA 4A3LC 2JA7C 1K83A 4KM8A 5TJ3A 4C3HC 1Y1WK 3GTLK 3S1NK 4KMUA 4Y7NK 1HI9A 3T02A 3H0GK 3GTJC 2V6SA 2KWAA 3S0XA 3EQLA 2PA8L 5IYBK 3V4GA 3A8JA 3GEHA 4C2MK 4A3IC 2ZUFA 3GTGA 4BY7C 3PO3K 1J98A 3GTOK 1WCMC 5CJ9A 4G7OA 4J3NA 3I4MK 2NVXA 1I50A 3HKZL 2EBBA 4WJ4A 2CFAB 4GTFA 1UV7A 1WIHA 1GE9A 1ZBSA 1L0WA 4OIPA 1O2FB 3SZYA 4A3DK 1SFOC 1TWHK 2E2HA 3TTGA 3N0BA 3OREA 1WQGA 2WB1L 3GTKC 2WAQD 4WILA 1BJTA 2VUMC 4C3JK 5M3FK 2JA6A 4XLNA 2P5MA 3S2DK 1Y1VK 2E2JK 4BY1C 1O27A 4XCHA 3A8KA 4A3EC 4GZYA 3GTMK 3HOYC 3BUEA 1WOOA 4C3IC 2R92C 3CQZC 3L4JA 3HXAA 2B63C 4A3LK 1WQFA 3GSIA 2JA7K 1TWGC 4YFXA 4AYBL 4C3HK 4KMDA 3FKIC 1YNJA 1EH1A 3GTJK 4ILDA 3ADAC 3Q3QA 1IE0A 5IP7C 4BKWA 2GSOA 1INNA 3S14C 3BP8C 4A3IK 4BY7K 5IP9C 3AD8C 1XPPA 3TFHA 1DCOA 2PA8D 4DDQA 1I3QA 1PJ5A 5C4JC 3HOZC 3S17K 4YG2A 3AD9C 1KQ4A 5M3MK 5IOTA 3I4NC 4MEXA 1VRQC 3K7AC 3JSTA 4A3GC 2CW0A 5CHPA 1SFOK 3GTQC 5M5WK 4QIWL 1ISEA 2RH6A 3HKZD 1B4BA 2XCOA 2NVQC 4PABA 2JH3A 1ZVUA 2VUMK 3CAGA 4Y52C 4A93C 4LR2A 3TFJA 5M5XK 4BY1K 4RMFA 2YU9C 2WB1D 1ZXOA 3FOFA 4A3EK 3M4OC 3HOYK 5IOSA 4X6AC 4C3IK 2CFAA 1I6HC 2Y0SL 2R92K 3CQZK 1TWAC 3GTPA 1TWFA 5EGHA 2R7ZC 4BLAA 5L46A 4BBRK 2B63K 2E2IA 2NVYA 3H3VL 1TWGK 4XSXA 3FKIK 1F7UA 3TFIA 3QX3A 5IP7K 1AB4A 3S14K 3RZDC 3WODA 3N0CA 2ZFZA 1IS1A 5IP9K 4GTBA 4MQ9A 2A69A 1R9TA 1WSRA 2NVTK 5C4JK 4A3MC 4G0WA 1F93A 3HOVK 3RZOC 5JFEA 4LJZA 3I4NK 3K7AK 1G51A 1TWCC 1Y1WA 3GTLA 4A3GK 3GTQK 3H0GA 4QJVB 3S16C 4KDDA 5FLMC 2NVQK 2GAGC 1EI6A 3T01A 4Y52K 4A93K 3FHZA 1JVIA 5HL8A 2R93C 2JA5C 2O5JA 4P9SA 1WORA 4QIWD 1XZQB 2YU9K 3GTOA 4KN4A 4X6AK 4KB4A 2P8TA 1I6HK 1TWAK 4KAWX 1JQWA 2R7ZK 5EGEA 4YFNA 1WOPA 2XCRB 1TWHA 2JA8C 4A3JC 1IQ0A 1F7VA 1PJ7A 1IW7A 1K83C 3H3VD 3MMLB 3RZDK 4A3FC 1ZYRA 1WSVA 1Y1VA 5E68A 3GTMA 4O2DA 4A3MK 3AQOA 3DXJA 3GEIA 1F9NA 5FJ8K 3GTGC 1WCMK 3HOUC 4GTCA 3HOXC 3L4KA 2JA7A 4C45A 2V6TA 1VJEA 1TWCK 1IBAA 3G4AA 1XZPB 2NVXC 4GFQA 1I50C 3GTJA 4OINA 3S16K 4LK0A 4OIOA 4KARA 4Y7NC 5FLMK 4BXXC 2A6HA 2ZUEA 5IOQA 4P5AA 3G4CA 3GEEA 2E2HC 2R93K 2BE5A 3GTKK 3VA7A 3N3YA 2JA5K 1EFWA 5M5YK 1I6VA 1JOEA 4GTDA 1DCHA 3GTOC 5IYCC 4OIRA 5IORA 2JA6C 3OPFA 3PO2C 4JK1A 1WQHA 1C0AA 1O2AA 5C44C 2FQOA 4QJVA 5JVOA 1ZQ1C 4LLGA 2Y3PA 1SFOA 3GDZA 1PJ6A 5IYDC 2JA8K 4A3JK 4NOIA 4GTLA 1K83K 3S1QC 3GTKA 2XCQA 2VUMA 4A3FK 1XZQA 2A6EA 3HOWC 2D6FC 4KMAA 4PAAA 1XXBA 4GT9A 4AYBD 4KMHA 1WOSA 3LAPA 2R92A 1VLOA 3CQZA 2PMZL 3GTGK 1O26A 4A3BC 2W7VA 4A3CC 3HOUK 2B63A 3HOXK 3HOZK 1X31C 4OIQA 1TWGA 3ERED 1I3QC 3S2HC 1USMA 1BGWA 3AQPA 3FKIA 2NVXK 1I50K 1USOA 1SMYA 1J6WA 4BXXK 4Q5SA 4FZBA 2E2HK 3M3YC 4GTEA 3BP3A 4M1XA 5IYCK 2JA6K 5C4XC 3PO2K 3M4OK 2RGRA 4AH6A 3S17C 1XZPA 1BDFA 5C44K 1YX2A 5TMCA 1VGXA 3S15C 4ZH4A 1VH2A 3GTQA 3S1MC 2O5IA 3GTPC 3S1RC 1O2BA 1J6XA 1TWFC 4KB2A 5IYDK 2E2IC 1O25A 2NVYC 3S1QK 3A8IA 1V5VA 4BBSC 1XXCA 2Y0SD 3HOWK 1B4AA 4LOWA 1XXAA 5C3EC
chains in the Genus database with same CATH topology
5TMFA 2A6HA 3GTOK 1WCMC 3H3VL 1TWGK 4XSXA 5D4DA 4G7OA 3I4MK 3FKIK 2E2HC 3HKZL 2R93K 2BE5A 3GTKK 4A3BK 4A3KC 2JA5K 4XSZA 4A3CK 5M5YK 3S2HK 5IP7K 1I6VA 1R9TC 4OIPA 4BBRC 3S14K 1I3QK 3WODA 3RZDC 1SFOC 5IYCC 4OIRA 3GTOC 2JA6C 1TWHK 3RZOK 4G7HA 3PO2C 4JK1A 2WB1L 5IP9K 4MQ9A 2PMZD 5C44C 4QJVA 2A69A 2WAQD 3GTKC 4KN7A 2NVTK 1Y1WC 3GTLC 4LLGA 2VUMC 3S1NC 5C4JK 4A3MC 4C3JK 3H0GC 5M3FK 4XLNA 5IYDC 3HOVK 3S2DK 2JA8K 1Y1VK 4A3JK 2E2JK 3M3YK 3RZOC 4BY1C 4LJZA 4NOIA 3I4NK 1K83K 3S1QC 4GZYA 4A3EC 3K7AK 3GTMK 5IYBC 3HOYC 1TWCC 1YNNA 4A3GK 2PPBA 4A3FK 3GTQK 2R92C 2A6EA 4QJVB 5C4XK 3HOWC 3CQZC 4XLPA 2NVTC 3S16C 4YFKA 4G7ZA 5FLMC 2R7ZC 2B63C 3PO3C 4A3LK 2NVQK 2JA7K 3HOVC 4AYBD 1TWGC 4YFXA 3S15K 4AYBL 4C3HK 4LK1A 3I4MC 3FKIC 3S1MK 4A93K 4Y52K 1YNJA 2A68A 3GTJK 3GTPK 2PMZL 3GTGK 3S1RK 2R93C 1TWFK 4A3BC 2JA5C 3PO3K 2WAQL 4A3CC 2O5JA 4QIWD 3HOUK 3HOXK 2E2IK 2YU9K 2NVYK 5IP7C 3HOZK 4OIQA 4MEYA 4BBSK 4KN4A 4X6AK 3S14C 1I3QC 4A3DC 3S2HC 1I6HK 1TWHC 2NVXK 1I50K 4A3IK 1TWAK 4BY7K 5IP9C 1SMYA 2R7ZK 4BXXK 5C3EK 4Q5SA 1HQMA 1XPPA 5C3EC 4YFNA 2PA8D 5C4JC 3HOZC 2E2HK 3S17K 4YG2A 3S2DC 2JA8C 1Y1VC 4A3JC 2E2JC 4A3KK 3M3YC 5M3MK 3I4NC 1IW7A 1K83C 4MEXA 3K7AC 1R9TK 3GTMC 3H3VD 4A3GC 2CW0A 3RZDK 4A3FC 5IYCK 1SFOK 3GTQC 2JA6K 5C4XC 3PO2K 5M5WK 4Q4ZA 1ZYRA 4QIWL 3M4OK 3HKZD 3S17C 1BDFA 4A3LC 5C44K 2NVQC 2JA7C 5TMCA 3S15C 4ZH4A 1Y1WK 3GTLK 2VUMK 4KMUA 3S1NK 4Y7NK 4A3MK 4Y52C 3S1MC 4A93C 3H0GK 3DXJA 2O5IA 3GTJC 3GTPC 5FJ8K 3S1RC 3GTGC 1TWFC 4A3DK 1WCMK 5IYDK 5M5XK 4BY1K 3HOUC 3EQLA 3HOXC 2E2IC 2YU9C 2NVYC 2WB1D 3S1QK 4A3EK 3M4OC 2PA8L 5IYBK 4BBSC 3HOYK 4X6AC 1TWCK 4C3IK 2Y0SD 1I6HC 2Y0SL 2NVXC 2R92K 4C2MK 1I50C 4A3IC 3CQZK 1TWAC 4OINA 3HOWK 4LK0A 3S16K 4OIOA 4Y7NC 4BY7C 5FLMK 4BXXC 2B63K 4BBRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TMF A;  2A6H A;  3GTO K;  1WCM C;  3H3V L;  1TWG K;  4XSX A;  5D4D A;  4G7O A;  3I4M K;  3FKI K;  2E2H C;  3HKZ L;  2R93 K;  2BE5 A;  3GTK K;  4A3B K;  4A3K C;  2JA5 K;  4XSZ A;  4A3C K;  5M5Y K;  3S2H K;  5IP7 K;  1I6V A;  1R9T C;  4OIP A;  4BBR C;  3S14 K;  1I3Q K;  3WOD A;  3RZD C;  1SFO C;  5IYC C;  4OIR A;  3GTO C;  2JA6 C;  1TWH K;  3RZO K;  4G7H A;  3PO2 C;  4JK1 A;  2WB1 L;  5IP9 K;  4MQ9 A;  2PMZ D;  5C44 C;  4QJV A;  2A69 A;  2WAQ D;  3GTK C;  4KN7 A;  2NVT K;  1Y1W C;  3GTL C;  4LLG A;  2VUM C;  3S1N C;  5C4J K;  4A3M C;  4C3J K;  3H0G C;  5M3F K;  4XLN A;  5IYD C;  3HOV K;  3S2D K;  2JA8 K;  1Y1V K;  4A3J K;  2E2J K;  3M3Y K;  3RZO C;  4BY1 C;  4LJZ A;  4NOI A;  3I4N K;  1K83 K;  3S1Q C;  4GZY A;  4A3E C;  3K7A K;  3GTM K;  5IYB C;  3HOY C;  1TWC C;  1YNN A;  4A3G K;  2PPB A;  4A3F K;  3GTQ K;  2R92 C;  2A6E A;  4QJV B;  5C4X K;  3HOW C;  3CQZ C;  4XLP A;  2NVT C;  3S16 C;  4YFK A;  4G7Z A;  5FLM C;  2R7Z C;  2B63 C;  3PO3 C;  4A3L K;  2NVQ K;  2JA7 K;  3HOV C;  4AYB D;  1TWG C;  4YFX A;  3S15 K;  4AYB L;  4C3H K;  4LK1 A;  3I4M C;  3FKI C;  3S1M K;  4A93 K;  4Y52 K;  1YNJ A;  2A68 A;  3GTJ K;  3GTP K;  2PMZ L;  3GTG K;  3S1R K;  2R93 C;  1TWF K;  4A3B C;  2JA5 C;  3PO3 K;  2WAQ L;  4A3C C;  2O5J A;  4QIW D;  3HOU K;  3HOX K;  2E2I K;  2YU9 K;  2NVY K;  5IP7 C;  3HOZ K;  4OIQ A;  4MEY A;  4BBS K;  4KN4 A;  4X6A K;  3S14 C;  1I3Q C;  4A3D C;  3S2H C;  1I6H K;  1TWH C;  2NVX K;  1I50 K;  4A3I K;  1TWA K;  4BY7 K;  5IP9 C;  1SMY A;  2R7Z K;  4BXX K;  5C3E K;  4Q5S A;  1HQM A;  1XPP A;  5C3E C;  4YFN A;  2PA8 D;  5C4J C;  3HOZ C;  2E2H K;  3S17 K;  4YG2 A;  3S2D C;  2JA8 C;  1Y1V C;  4A3J C;  2E2J C;  4A3K K;  3M3Y C;  5M3M K;  3I4N C;  1IW7 A;  1K83 C;  4MEX A;  3K7A C;  1R9T K;  3GTM C;  3H3V D;  4A3G C;  2CW0 A;  3RZD K;  4A3F C;  5IYC K;  1SFO K;  3GTQ C;  2JA6 K;  5C4X C;  3PO2 K;  5M5W K;  4Q4Z A;  1ZYR A;  4QIW L;  3M4O K;  3HKZ D;  3S17 C;  1BDF A;  4A3L C;  5C44 K;  2NVQ C;  2JA7 C;  5TMC A;  3S15 C;  4ZH4 A;  1Y1W K;  3GTL K;  2VUM K;  4KMU A;  3S1N K;  4Y7N K;  4A3M K;  4Y52 C;  3S1M C;  4A93 C;  3H0G K;  3DXJ A;  2O5I A;  3GTJ C;  3GTP C;  5FJ8 K;  3S1R C;  3GTG C;  1TWF C;  4A3D K;  1WCM K;  5IYD K;  5M5X K;  4BY1 K;  3HOU C;  3EQL A;  3HOX C;  2E2I C;  2YU9 C;  2NVY C;  2WB1 D;  3S1Q K;  4A3E K;  3M4O C;  2PA8 L;  5IYB K;  4BBS C;  3HOY K;  4X6A C;  1TWC K;  4C3I K;  2Y0S D;  1I6H C;  2Y0S L;  2NVX C;  2R92 K;  4C2M K;  1I50 C;  4A3I C;  3CQZ K;  1TWA C;  4OIN A;  3HOW K;  4LK0 A;  3S16 K;  4OIO A;  4Y7N C;  4BY7 C;  5FLM K;  4BXX C;  2B63 K;  4BBR K; 
#chains in the Genus database with same CATH topology
 5TMF A;  2YU9 A;  5D4D A;  1O24 A;  1TWA A;  4A3B K;  4A3K C;  4XSZ A;  4A3C K;  2R7Z A;  4GTA A;  2GAH C;  1R9T C;  3FOE A;  2PHC B;  1O29 A;  4BBR C;  1I3Q K;  3SZZ A;  3S2H K;  1RU0 A;  3RZO K;  4G7H A;  1EQR A;  4KC6 A;  1IL2 A;  2PMZ D;  3LAJ A;  4G0U A;  4KN7 A;  4FM9 A;  1BS2 A;  1Y1W C;  3GTL C;  3S1N C;  3H0G C;  2FQT A;  3M3Y K;  4LQY A;  5IYB C;  1YNN A;  1O28 A;  2PPB A;  4P5B A;  4KM9 A;  4C2M C;  5C4X K;  2NVT C;  4XLP A;  1WCM A;  4YFK A;  4G7Z A;  3PO3 C;  4KAS A;  3HOV C;  1J6V A;  3S15 K;  1TWC A;  2V6U A;  4LK1 A;  3GIR A;  3I4M C;  3S1M K;  2A68 A;  3GTP K;  3S1R K;  1TWF K;  3T00 A;  2WAQ L;  2E2I K;  1DCP A;  1YCL A;  2NVY K;  4MEY A;  4BBS K;  4A3D C;  1TWH C;  2R93 A;  3AD7 C;  3NUH A;  2JA5 A;  2GSU A;  5C3E K;  1HQM A;  4G0V A;  4WJ3 M;  4C3J C;  3LPX A;  3S2D C;  4KAT A;  1Y1V C;  3OEP A;  2E2J C;  4A3K K;  1R9T K;  3GTM C;  1DD5 A;  2GSN A;  3AH5 A;  1EK8 A;  4BLB A;  3IPJ A;  4Q4Z A;  4A3L C;  2JA7 C;  1K83 A;  4KM8 A;  5TJ3 A;  4C3H C;  1Y1W K;  3GTL K;  3S1N K;  4KMU A;  4Y7N K;  1HI9 A;  3T02 A;  3H0G K;  3GTJ C;  2V6S A;  2KWA A;  3S0X A;  3EQL A;  2PA8 L;  5IYB K;  3V4G A;  3A8J A;  3GEH A;  4C2M K;  4A3I C;  2ZUF A;  3GTG A;  4BY7 C;  3PO3 K;  1J98 A;  3GTO K;  1WCM C;  5CJ9 A;  4G7O A;  4J3N A;  3I4M K;  2NVX A;  1I50 A;  3HKZ L;  2EBB A;  4WJ4 A;  2CFA B;  4GTF A;  1UV7 A;  1WIH A;  1GE9 A;  1ZBS A;  1L0W A;  4OIP A;  1O2F B;  3SZY A;  4A3D K;  1SFO C;  1TWH K;  2E2H A;  3TTG A;  3N0B A;  3ORE A;  1WQG A;  2WB1 L;  3GTK C;  2WAQ D;  4WIL A;  1BJT A;  2VUM C;  4C3J K;  5M3F K;  2JA6 A;  4XLN A;  2P5M A;  3S2D K;  1Y1V K;  2E2J K;  4BY1 C;  1O27 A;  4XCH A;  3A8K A;  4A3E C;  4GZY A;  3GTM K;  3HOY C;  3BUE A;  1WOO A;  4C3I C;  2R92 C;  3CQZ C;  3L4J A;  3HXA A;  2B63 C;  4A3L K;  1WQF A;  3GSI A;  2JA7 K;  1TWG C;  4YFX A;  4AYB L;  4C3H K;  4KMD A;  3FKI C;  1YNJ A;  1EH1 A;  3GTJ K;  4ILD A;  3ADA C;  3Q3Q A;  1IE0 A;  5IP7 C;  4BKW A;  2GSO A;  1INN A;  3S14 C;  3BP8 C;  4A3I K;  4BY7 K;  5IP9 C;  3AD8 C;  1XPP A;  3TFH A;  1DCO A;  2PA8 D;  4DDQ A;  1I3Q A;  1PJ5 A;  5C4J C;  3HOZ C;  3S17 K;  4YG2 A;  3AD9 C;  1KQ4 A;  5M3M K;  5IOT A;  3I4N C;  4MEX A;  1VRQ C;  3K7A C;  3JST A;  4A3G C;  2CW0 A;  5CHP A;  1SFO K;  3GTQ C;  5M5W K;  4QIW L;  1ISE A;  2RH6 A;  3HKZ D;  1B4B A;  2XCO A;  2NVQ C;  4PAB A;  2JH3 A;  1ZVU A;  2VUM K;  3CAG A;  4Y52 C;  4A93 C;  4LR2 A;  3TFJ A;  5M5X K;  4BY1 K;  4RMF A;  2YU9 C;  2WB1 D;  1ZXO A;  3FOF A;  4A3E K;  3M4O C;  3HOY K;  5IOS A;  4X6A C;  4C3I K;  2CFA A;  1I6H C;  2Y0S L;  2R92 K;  3CQZ K;  1TWA C;  3GTP A;  1TWF A;  5EGH A;  2R7Z C;  4BLA A;  5L46 A;  4BBR K;  2B63 K;  2E2I A;  2NVY A;  3H3V L;  1TWG K;  4XSX A;  3FKI K;  1F7U A;  3TFI A;  3QX3 A;  5IP7 K;  1AB4 A;  3S14 K;  3RZD C;  3WOD A;  3N0C A;  2ZFZ A;  1IS1 A;  5IP9 K;  4GTB A;  4MQ9 A;  2A69 A;  1R9T A;  1WSR A;  2NVT K;  5C4J K;  4A3M C;  4G0W A;  1F93 A;  3HOV K;  3RZO C;  5JFE A;  4LJZ A;  3I4N K;  3K7A K;  1G51 A;  1TWC C;  1Y1W A;  3GTL A;  4A3G K;  3GTQ K;  3H0G A;  4QJV B;  3S16 C;  4KDD A;  5FLM C;  2NVQ K;  2GAG C;  1EI6 A;  3T01 A;  4Y52 K;  4A93 K;  3FHZ A;  1JVI A;  5HL8 A;  2R93 C;  2JA5 C;  2O5J A;  4P9S A;  1WOR A;  4QIW D;  1XZQ B;  2YU9 K;  3GTO A;  4KN4 A;  4X6A K;  4KB4 A;  2P8T A;  1I6H K;  1TWA K;  4KAW X;  1JQW A;  2R7Z K;  5EGE A;  4YFN A;  1WOP A;  2XCR B;  1TWH A;  2JA8 C;  4A3J C;  1IQ0 A;  1F7V A;  1PJ7 A;  1IW7 A;  1K83 C;  3H3V D;  3MML B;  3RZD K;  4A3F C;  1ZYR A;  1WSV A;  1Y1V A;  5E68 A;  3GTM A;  4O2D A;  4A3M K;  3AQO A;  3DXJ A;  3GEI A;  1F9N A;  5FJ8 K;  3GTG C;  1WCM K;  3HOU C;  4GTC A;  3HOX C;  3L4K A;  2JA7 A;  4C45 A;  2V6T A;  1VJE A;  1TWC K;  1IBA A;  3G4A A;  1XZP B;  2NVX C;  4GFQ A;  1I50 C;  3GTJ A;  4OIN A;  3S16 K;  4LK0 A;  4OIO A;  4KAR A;  4Y7N C;  5FLM K;  4BXX C;  2A6H A;  2ZUE A;  5IOQ A;  4P5A A;  3G4C A;  3GEE A;  2E2H C;  2R93 K;  2BE5 A;  3GTK K;  3VA7 A;  3N3Y A;  2JA5 K;  1EFW A;  5M5Y K;  1I6V A;  1JOE A;  4GTD A;  1DCH A;  3GTO C;  5IYC C;  4OIR A;  5IOR A;  2JA6 C;  3OPF A;  3PO2 C;  4JK1 A;  1WQH A;  1C0A A;  1O2A A;  5C44 C;  2FQO A;  4QJV A;  5JVO A;  1ZQ1 C;  4LLG A;  2Y3P A;  1SFO A;  3GDZ A;  1PJ6 A;  5IYD C;  2JA8 K;  4A3J K;  4NOI A;  4GTL A;  1K83 K;  3S1Q C;  3GTK A;  2XCQ A;  2VUM A;  4A3F K;  1XZQ A;  2A6E A;  3HOW C;  2D6F C;  4KMA A;  4PAA A;  1XXB A;  4GT9 A;  4AYB D;  4KMH A;  1WOS A;  3LAP A;  2R92 A;  1VLO A;  3CQZ A;  2PMZ L;  3GTG K;  1O26 A;  4A3B C;  2W7V A;  4A3C C;  3HOU K;  2B63 A;  3HOX K;  3HOZ K;  1X31 C;  4OIQ A;  1TWG A;  3ERE D;  1I3Q C;  3S2H C;  1USM A;  1BGW A;  3AQP A;  3FKI A;  2NVX K;  1I50 K;  1USO A;  1SMY A;  1J6W A;  4BXX K;  4Q5S A;  4FZB A;  2E2H K;  3M3Y C;  4GTE A;  3BP3 A;  4M1X A;  5IYC K;  2JA6 K;  5C4X C;  3PO2 K;  3M4O K;  2RGR A;  4AH6 A;  3S17 C;  1XZP A;  1BDF A;  5C44 K;  1YX2 A;  5TMC A;  1VGX A;  3S15 C;  4ZH4 A;  1VH2 A;  3GTQ A;  3S1M C;  2O5I A;  3GTP C;  3S1R C;  1O2B A;  1J6X A;  1TWF C;  4KB2 A;  5IYD K;  2E2I C;  1O25 A;  2NVY C;  3S1Q K;  3A8I A;  1V5V A;  4BBS C;  1XXC A;  2Y0S D;  3HOW K;  1B4A A;  4LOW A;  1XXA A;  5C3E C; 
#chains in the Genus database with same CATH homology
 5TMF A;  2A6H A;  3GTO K;  1WCM C;  3H3V L;  1TWG K;  4XSX A;  5D4D A;  4G7O A;  3I4M K;  3FKI K;  2E2H C;  3HKZ L;  2R93 K;  2BE5 A;  3GTK K;  4A3B K;  4A3K C;  2JA5 K;  4XSZ A;  4A3C K;  5M5Y K;  3S2H K;  5IP7 K;  1I6V A;  1R9T C;  4OIP A;  4BBR C;  3S14 K;  1I3Q K;  3WOD A;  3RZD C;  1SFO C;  5IYC C;  4OIR A;  3GTO C;  2JA6 C;  1TWH K;  3RZO K;  4G7H A;  3PO2 C;  4JK1 A;  2WB1 L;  5IP9 K;  4MQ9 A;  2PMZ D;  5C44 C;  4QJV A;  2A69 A;  2WAQ D;  3GTK C;  4KN7 A;  2NVT K;  1Y1W C;  3GTL C;  4LLG A;  2VUM C;  3S1N C;  5C4J K;  4A3M C;  4C3J K;  3H0G C;  5M3F K;  4XLN A;  5IYD C;  3HOV K;  3S2D K;  2JA8 K;  1Y1V K;  4A3J K;  2E2J K;  3M3Y K;  3RZO C;  4BY1 C;  4LJZ A;  4NOI A;  3I4N K;  1K83 K;  3S1Q C;  4GZY A;  4A3E C;  3K7A K;  3GTM K;  5IYB C;  3HOY C;  1TWC C;  1YNN A;  4A3G K;  2PPB A;  4A3F K;  3GTQ K;  2R92 C;  2A6E A;  4QJV B;  5C4X K;  3HOW C;  3CQZ C;  4XLP A;  2NVT C;  3S16 C;  4YFK A;  4G7Z A;  5FLM C;  2R7Z C;  2B63 C;  3PO3 C;  4A3L K;  2NVQ K;  2JA7 K;  3HOV C;  4AYB D;  1TWG C;  4YFX A;  3S15 K;  4AYB L;  4C3H K;  4LK1 A;  3I4M C;  3FKI C;  3S1M K;  4A93 K;  4Y52 K;  1YNJ A;  2A68 A;  3GTJ K;  3GTP K;  2PMZ L;  3GTG K;  3S1R K;  2R93 C;  1TWF K;  4A3B C;  2JA5 C;  3PO3 K;  2WAQ L;  4A3C C;  2O5J A;  4QIW D;  3HOU K;  3HOX K;  2E2I K;  2YU9 K;  2NVY K;  5IP7 C;  3HOZ K;  4OIQ A;  4MEY A;  4BBS K;  4KN4 A;  4X6A K;  3S14 C;  1I3Q C;  4A3D C;  3S2H C;  1I6H K;  1TWH C;  2NVX K;  1I50 K;  4A3I K;  1TWA K;  4BY7 K;  5IP9 C;  1SMY A;  2R7Z K;  4BXX K;  5C3E K;  4Q5S A;  1HQM A;  1XPP A;  5C3E C;  4YFN A;  2PA8 D;  5C4J C;  3HOZ C;  2E2H K;  3S17 K;  4YG2 A;  3S2D C;  2JA8 C;  1Y1V C;  4A3J C;  2E2J C;  4A3K K;  3M3Y C;  5M3M K;  3I4N C;  1IW7 A;  1K83 C;  4MEX A;  3K7A C;  1R9T K;  3GTM C;  3H3V D;  4A3G C;  2CW0 A;  3RZD K;  4A3F C;  5IYC K;  1SFO K;  3GTQ C;  2JA6 K;  5C4X C;  3PO2 K;  5M5W K;  4Q4Z A;  1ZYR A;  4QIW L;  3M4O K;  3HKZ D;  3S17 C;  1BDF A;  4A3L C;  5C44 K;  2NVQ C;  2JA7 C;  5TMC A;  3S15 C;  4ZH4 A;  1Y1W K;  3GTL K;  2VUM K;  4KMU A;  3S1N K;  4Y7N K;  4A3M K;  4Y52 C;  3S1M C;  4A93 C;  3H0G K;  3DXJ A;  2O5I A;  3GTJ C;  3GTP C;  5FJ8 K;  3S1R C;  3GTG C;  1TWF C;  4A3D K;  1WCM K;  5IYD K;  5M5X K;  4BY1 K;  3HOU C;  3EQL A;  3HOX C;  2E2I C;  2YU9 C;  2NVY C;  2WB1 D;  3S1Q K;  4A3E K;  3M4O C;  2PA8 L;  5IYB K;  4BBS C;  3HOY K;  4X6A C;  1TWC K;  4C3I K;  2Y0S D;  1I6H C;  2Y0S L;  2NVX C;  2R92 K;  4C2M K;  1I50 C;  4A3I C;  3CQZ K;  1TWA C;  4OIN A;  3HOW K;  4LK0 A;  3S16 K;  4OIO A;  4Y7N C;  4BY7 C;  5FLM K;  4BXX C;  2B63 K;  4BBR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...