2WAQL

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2waqL00
3K7AC 3HOUC 1TWAK 3GTOC 1TWCK 5IYBC 3S16K 4A3CC 1I50K 1IW7A 4A3KK 3EQLA 4A3IK 4BBSC 4QJVA 1YNNA 3HKZL 3GTKC 4G7OA 3FKIK 3HOWK 4QIWD 4AYBD 3H0GK 5M5WK 3GTMC 3PO2K 3M3YK 1Y1VC 3S1MK 1BDFA 5IYCK 2Y0SD 2R92K 4A93K 4A3JC 2PMZL 3I4MC 2NVTC 3S2HK 5C4XC 3S2DK 4Y7NC 3S1NC 4XSZA 5M3MK 4QIWL 2E2JK 3S14C 2O5JA 5IP9K 4LLGA 1TWGK 3GTPK 5M5YK 2YU9C 3GTMK 4Y52C 4OIQA 4A3JK 1TWCC 3S16C 4A3GK 1I50C 4JK1A 4C3IK 4A3EK 4A3IC 4ZH4A 3FKIC 4XLNA 3HOWC 3HKZD 3H0GC 3DXJA 4YFNA 4A3FK 2JA6K 3M3YC 4LK1A 3PO2C 4BY7K 1I6HK 3S1MC 3CQZK 4QJVB 5IYCC 4A93C 5TMFA 4A3MC 2R92C 1WCMK 5IYDC 3S2HC 2PMZD 4G7HA 1TWFK 3S2DC 2E2JC 5M5XK 1K83K 2VUMK 5IP9C 4BY1K 1TWGC 3GTPC 4KMUA 3HOZC 3S1RK 2WB1D 4KN4A 1I6VA 4A3MK 5C4JC 2R7ZK 4A3BK 4Q5SA 2NVXK 4A3GC 4A3EC 1R9TK 5IYDK 1SFOK 2YU9K 4YFXA 4GZYA 4OIOA 3HOXK 1HQMA 2WB1L 3HOZK 4A3FC 2JA6C 2E2HK 4BY7C 3S17K 1YNJA 1I6HC 5C4JK 3CQZC 2BE5A 1TWHK 1WCMC 4YFKA 2JA5C 4BXXK 5IP7K 4XLPA 4Q4ZA 3PO3K 4A3DK 2A69A 1TWFC 4OINA 3HOYK 3I4NK 1K83C 2E2IK 2B63K 2NVYK 5D4DA 4BY1C 2JA8K 2VUMC 3S1QK 4C3HK 4OIPA 3S1RC 2NVQK 4LK0A 2PA8L 2R7ZC 1XPPA 2WAQL 4X6AC 2JA5K 4A3BC 2NVXC 1R9TC 3RZOK 1SFOC 2O5IA 4KN7A 3HOXC 3RZDK 3GTQK 4Y52K 4C2MK 3GTJK 4OIRA 2E2HC 3S17C 4X6AK 4BBRK 5C44K 1TWHC 4YG2A 4MEXA 3HOVK 4BXXC 5IP7C 3PO3C 4A3DC 3HOYC 5C3EK 2A68A 1I3QC 4NOIA 2A6HA 3I4NC 2E2IC 3H3VL 1SMYA 2NVYC 2B63C 3M4OK 2JA8C 3S1QC 3GTLK 4MEYA 2NVQC 2PA8D 3S15K 2WAQD 5M3FK 3WODA 5TMCA 3RZOC 4A3LK 3GTGK 1I3QK 2R93K 3GTQC 3RZDC 1Y1WK 5FJ8K 1ZYRA 4C3JK 3GTJC 5FLMK 3K7AK 4BBRC 5C44C 4MQ9A 3HOUK 3HOVC 4A3CK 3GTOK 5IYBK 2JA7C 5C3EC 2PPBA 4BBSK 3M4OC 4AYBL 3GTKK 3H3VD 3GTLC 1Y1VK 2Y0SL 3S15C 2CW0A 4XSXA 1TWAC 4A3LC 2JA7K 4G7ZA 2NVTK 5C4XK 3GTGC 3I4MK 4Y7NK 3S1NK 2R93C 4A3KC 1Y1WC 3S14K 5FLMC 4LJZA 2A6EA
chains in the Genus database with same CATH superfamily
2NVYA 2GSOA 1WSVA 1IBAA 4A3KK 4BBSC 3GTKC 3HOWK 4QIWD 3PO2K 3M3YK 3OREA 1Y1VC 3GTQA 1F7VA 1XXCA 4KB4A 2Y0SD 1VH2A 3GEEA 2R92K 3CAGA 3I4MC 1ZBSA 3S2HK 3S1NC 4GTCA 1J98A 3GTPK 5M5YK 4P9SA 4OIQA 1TWCC 1I50C 3BP3A 4JK1A 4A3IC 1TWAA 4ZH4A 3MMLB 3ADAC 3H0GC 1O28A 4PABA 1Y1WA 5JFEA 3LPXA 2PMZD 4G7HA 3S2DC 2E2JC 1K83K 3AH5A 1IS1A 3OEPA 2WB1D 1I6VA 1RU0A 5C4JC 3TFJA 4A3MK 4A3BK 3GTMA 4A3GC 5IYDK 4C3IC 4YFXA 1WQHA 4LQYA 1KQ4A 4A3FC 4BY7C 3S17K 3TFHA 1TWHK 1WCMC 2JA5C 2YU9A 5IP7K 1VRQC 2RH6A 4Q4ZA 3AD8C 4J3NA 2A69A 2W7VA 3HOYK 4A3DK 2E2IK 3LAJA 4BY1C 3S1QK 1GE9A 4C3HK 2NVQK 1TWFA 2PHCB 3T01A 3AD7C 1DCHA 1R9TC 2O5IA 1O26A 4KN7A 2R7ZA 3HOXC 3RZDK 2V6TA 3GEHA 4X6AK 5C44K 4MEXA 3HOVK 3PO3C 5C3EK 4NOIA 2A6HA 3I4NC 2NVYC 3TFIA 4MEYA 1O2BA 1USOA 3WODA 3GTGK 3CQZA 3GTQC 5EGHA 4C2MC 1C0AA 4BBRC 4MQ9A 1UV7A 1WQFA 1XXAA 4GTDA 4BBSK 3M4OC 1J6VA 3BP8C 3GEIA 3GTKK 1SFOA 2V6SA 1AB4A 1Y1VK 3TTGA 3S15C 2CW0A 4XSXA 2E2HA 1TWAC 2JA7K 4G7ZA 3I4MK 4KDDA 3L4KA 3AQPA 3S1NK 2P5MA 1Y1WC 3FHZA 1I3QA 2A6EA 5CHPA 4A3CC 1TWCK 1DD5A 1I50K 3EQLA 4A3IK 4G7OA 3H0GK 3N0CA 3GTMC 4DDQA 2Y3PA 4A3JC 3S2DK 4Y7NC 2O5JA 4XSZA 2E2JK 2JH3A 1VJEA 2YU9C 1EQRA 1BGWA 3GTLA 4A3GK 4AH6A 4C3IK 1O2AA 2CFAB 2V6UA 3SZYA 3OPFA 1JQWA 3HKZD 4A3FK 4Y52K 4BY7K 2R93A 4QJVB 1F9NA 5IOTA 1WCMK 5IP9C 4BY1K 4GT9A 1R9TK 1WORA 4OIOA 3HOXK 3HOZK 2JA6C 3CQZC 2BE5A 3PO3K 3A8IA 3I4NK 4C45A 2NVYK 5L46A 1DCOA 3FKIA 1XPPA 1K83A 4WJ4A 1SFOC 3GTQK 3N0BA 5IOSA 4G0VA 4C2MK 2E2HC 2GAHC 1YCLA 4BBRK 1ZQ1C 1TWGA 4BXXC 5CJ9A 2A68A 1I3QC 3H3VL 3M4OK 3ERED 1XZQA 4KATA 2PA8D 3S15K 2WAQD 3RZOC 4P5AA 4P5BA 1Y1WK 3VA7A 2VUMA 1O25A 1VLOA 1EI6A 4A3CK 5TJ3A 1ZXOA 1XZPB 2NVXA 3BUEA 3GTLC 2EBBA 2Y0SL 4KMDA 4A3LC 2GSUA 4Y7NK 2R93C 4A3KC 2XCOA 2ZUFA 1PJ6A 5FLMC 2YU9K 3K7AC 2B63A 4GFQA 3HOUC 3S0XA 5IYBC 2GAGC 4GTBA 4AYBD 1BDFA 3GTJA 2PMZL 5HL8A 5C4XC 5M3MK 4RMFA 1O29A 4LR2A 5IP9K 2JA7A 3FOEA 1V5VA 3S16C 4KM8A 3Q3QA 4KAWX 1TWCA 3FKIC 1I50A 1O24A 3G4AA 3DXJA 4YFNA 2JA6K 2FQOA 3S1MC 3CQZK 5IYCC 4A93C 3GIRA 5TMFA 4A3MC 1B4BA 1IQ0A 5IYDC 2FQTA 1YX2A 3GTOA 2P8TA 3GDZA 1TWGC 4KN4A 4Q5SA 4A3EC 1SFOK 4GZYA 4GTFA 2E2HK 1I6HC 3LAPA 1YNJA 5C4JK 2GSNA 4YFKA 4BXXK 4XLPA 1TWFC 1WQGA 2VUMC 1WSRA 3S1RC 5EGEA 2R7ZC 4X6AC 2JA5K 3G4CA 2NVXC 3RZOK 2R92A 4WJ3M 1PJ7A 3IPJA 4OIRA 3GTPA 4YG2A 4BLBA 1O2FB 1IE0A 4KB2A 1SMYA 2B63C 2JA8C 3GTLK 3JSTA 5M3FK 4A3LK 3T02A 4G0WA 2R93K 2ZUEA 5FJ8K 4O2DA 3GTJC 5FLMK 3A8KA 1BJTA 3K7AK 3HOUK 5IYBK 4KC6A 1VGXA 2JA7C 1HI9A 2PPBA 1X31C 2D6FC 1WOSA 4GTEA 3NUHA 4KMHA 1IL2A 1JVIA 5E68A 5C4XK 1TWHA 1PJ5A 1JOEA 4C3JC 5JVOA 3GSIA 2E2IA 2CFAA 4GTAA 1TWAK 3GTOC 3S16K 1EK8A 4FZBA 3V4GA 1IW7A 3AQOA 4QJVA 1YNNA 1BS2A 3HKZL 3FKIK 4BLAA 5M5WK 1L0WA 3S1MK 5IYCK 4A93K 1EFWA 2NVTC 4QIWL 5IOQA 3S14C 1DCPA 4LLGA 1TWGK 3GTMK 2ZFZA 4Y52C 1O27A 1WOOA 4A3JK 4A3EK 3QX3A 4XLNA 3GTGA 3HOWC 3PO2C 3M3YC 1I6HK 4LK1A 3FOFA 4M1XA 2KWAA 2R92C 3S2HC 1TWFK 4FM9A 1J6XA 1F93A 5M5XK 2VUMK 1ISEA 3GTPC 4KMUA 3HOZC 3A8JA 4KM9A 3S1RK 3GTKA 4LOWA 2R7ZK 1USMA 2NVXK 1Y1VA 4G0UA 2XCQA 1HQMA 2WB1L 4BKWA 2JA6A 4OINA 4ILDA 1K83C 2B63K 1WIHA 5D4DA 2JA8K 4OIPA 4LK0A 2PA8L 4KASA 1WOPA 2WAQL 4A3BC 3H0GA 3T00A 1F7UA 1B4AA 1J6WA 1G51A 3AD9C 3GTJK 3S17C 1XZPA 1TWHC 5IP7C 2XCRB 4XCHA 4A3DC 3HOYC 2E2IC 3S1QC 4C3HC 2NVQC 3L4JA 4GTLA 5TMCA 3N3YA 1I3QK 1WCMA 4KARA 2JA5A 3RZDC 1INNA 1ZYRA 4C3JK 4WILA 5C44C 3HXAA 3HOVC 3GTOK 3SZZA 5C3EC 5IORA 1ZVUA 4AYBL 1R9TA 3H3VD 1XXBA 4KMAA 4PAAA 2NVTK 1XZQB 3GTGC 3S14K 2RGRA 1EH1A 4LJZA
chains in the Genus database with same CATH topology
3K7AC 3HOUC 1TWAK 3GTOC 1TWCK 5IYBC 3S16K 4A3CC 1I50K 1IW7A 4A3KK 3EQLA 4A3IK 4BBSC 4QJVA 1YNNA 3HKZL 3GTKC 4G7OA 3FKIK 3HOWK 4QIWD 4AYBD 3H0GK 5M5WK 3GTMC 3PO2K 3M3YK 1Y1VC 3S1MK 1BDFA 5IYCK 2Y0SD 2R92K 4A93K 4A3JC 2PMZL 3I4MC 2NVTC 3S2HK 5C4XC 3S2DK 4Y7NC 3S1NC 4XSZA 5M3MK 4QIWL 2E2JK 3S14C 2O5JA 5IP9K 4LLGA 1TWGK 3GTPK 5M5YK 2YU9C 3GTMK 4Y52C 4OIQA 4A3JK 1TWCC 3S16C 4A3GK 1I50C 4JK1A 4C3IK 4A3EK 4A3IC 4ZH4A 3FKIC 4XLNA 3HOWC 3HKZD 3H0GC 3DXJA 4YFNA 4A3FK 2JA6K 3M3YC 4LK1A 3PO2C 4BY7K 1I6HK 3S1MC 3CQZK 4QJVB 5IYCC 4A93C 5TMFA 4A3MC 2R92C 1WCMK 5IYDC 3S2HC 2PMZD 4G7HA 1TWFK 3S2DC 2E2JC 5M5XK 1K83K 2VUMK 5IP9C 4BY1K 1TWGC 3GTPC 4KMUA 3HOZC 3S1RK 2WB1D 4KN4A 1I6VA 4A3MK 5C4JC 2R7ZK 4A3BK 4Q5SA 2NVXK 4A3GC 4A3EC 1R9TK 5IYDK 1SFOK 2YU9K 4YFXA 4GZYA 4OIOA 3HOXK 1HQMA 2WB1L 3HOZK 4A3FC 2JA6C 2E2HK 4BY7C 3S17K 1YNJA 1I6HC 5C4JK 3CQZC 2BE5A 1TWHK 1WCMC 4YFKA 2JA5C 4BXXK 5IP7K 4XLPA 4Q4ZA 3PO3K 4A3DK 2A69A 1TWFC 4OINA 3HOYK 3I4NK 1K83C 2E2IK 2B63K 2NVYK 5D4DA 4BY1C 2JA8K 2VUMC 3S1QK 4C3HK 4OIPA 3S1RC 2NVQK 4LK0A 2PA8L 2R7ZC 1XPPA 2WAQL 4X6AC 2JA5K 4A3BC 2NVXC 1R9TC 3RZOK 1SFOC 2O5IA 4KN7A 3HOXC 3RZDK 3GTQK 4Y52K 4C2MK 3GTJK 4OIRA 2E2HC 3S17C 4X6AK 4BBRK 5C44K 1TWHC 4YG2A 4MEXA 3HOVK 4BXXC 5IP7C 3PO3C 4A3DC 3HOYC 5C3EK 2A68A 1I3QC 4NOIA 2A6HA 3I4NC 2E2IC 3H3VL 1SMYA 2NVYC 2B63C 3M4OK 2JA8C 3S1QC 3GTLK 4MEYA 2NVQC 2PA8D 3S15K 2WAQD 5M3FK 3WODA 5TMCA 3RZOC 4A3LK 3GTGK 1I3QK 2R93K 3GTQC 3RZDC 1Y1WK 5FJ8K 1ZYRA 4C3JK 3GTJC 5FLMK 3K7AK 4BBRC 5C44C 4MQ9A 3HOUK 3HOVC 4A3CK 3GTOK 5IYBK 2JA7C 5C3EC 2PPBA 4BBSK 3M4OC 4AYBL 3GTKK 3H3VD 3GTLC 1Y1VK 2Y0SL 3S15C 2CW0A 4XSXA 1TWAC 4A3LC 2JA7K 4G7ZA 2NVTK 5C4XK 3GTGC 3I4MK 4Y7NK 3S1NK 2R93C 4A3KC 1Y1WC 3S14K 5FLMC 4LJZA 2A6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A C;  3HOU C;  1TWA K;  3GTO C;  1TWC K;  5IYB C;  3S16 K;  4A3C C;  1I50 K;  1IW7 A;  4A3K K;  3EQL A;  4A3I K;  4BBS C;  4QJV A;  1YNN A;  3HKZ L;  3GTK C;  4G7O A;  3FKI K;  3HOW K;  4QIW D;  4AYB D;  3H0G K;  5M5W K;  3GTM C;  3PO2 K;  3M3Y K;  1Y1V C;  3S1M K;  1BDF A;  5IYC K;  2Y0S D;  2R92 K;  4A93 K;  4A3J C;  2PMZ L;  3I4M C;  2NVT C;  3S2H K;  5C4X C;  3S2D K;  4Y7N C;  3S1N C;  4XSZ A;  5M3M K;  4QIW L;  2E2J K;  3S14 C;  2O5J A;  5IP9 K;  4LLG A;  1TWG K;  3GTP K;  5M5Y K;  2YU9 C;  3GTM K;  4Y52 C;  4OIQ A;  4A3J K;  1TWC C;  3S16 C;  4A3G K;  1I50 C;  4JK1 A;  4C3I K;  4A3E K;  4A3I C;  4ZH4 A;  3FKI C;  4XLN A;  3HOW C;  3HKZ D;  3H0G C;  3DXJ A;  4YFN A;  4A3F K;  2JA6 K;  3M3Y C;  4LK1 A;  3PO2 C;  4BY7 K;  1I6H K;  3S1M C;  3CQZ K;  4QJV B;  5IYC C;  4A93 C;  5TMF A;  4A3M C;  2R92 C;  1WCM K;  5IYD C;  3S2H C;  2PMZ D;  4G7H A;  1TWF K;  3S2D C;  2E2J C;  5M5X K;  1K83 K;  2VUM K;  5IP9 C;  4BY1 K;  1TWG C;  3GTP C;  4KMU A;  3HOZ C;  3S1R K;  2WB1 D;  4KN4 A;  1I6V A;  4A3M K;  5C4J C;  2R7Z K;  4A3B K;  4Q5S A;  2NVX K;  4A3G C;  4A3E C;  1R9T K;  5IYD K;  1SFO K;  2YU9 K;  4YFX A;  4GZY A;  4OIO A;  3HOX K;  1HQM A;  2WB1 L;  3HOZ K;  4A3F C;  2JA6 C;  2E2H K;  4BY7 C;  3S17 K;  1YNJ A;  1I6H C;  5C4J K;  3CQZ C;  2BE5 A;  1TWH K;  1WCM C;  4YFK A;  2JA5 C;  4BXX K;  5IP7 K;  4XLP A;  4Q4Z A;  3PO3 K;  4A3D K;  2A69 A;  1TWF C;  4OIN A;  3HOY K;  3I4N K;  1K83 C;  2E2I K;  2B63 K;  2NVY K;  5D4D A;  4BY1 C;  2JA8 K;  2VUM C;  3S1Q K;  4C3H K;  4OIP A;  3S1R C;  2NVQ K;  4LK0 A;  2PA8 L;  2R7Z C;  1XPP A;  2WAQ L;  4X6A C;  2JA5 K;  4A3B C;  2NVX C;  1R9T C;  3RZO K;  1SFO C;  2O5I A;  4KN7 A;  3HOX C;  3RZD K;  3GTQ K;  4Y52 K;  4C2M K;  3GTJ K;  4OIR A;  2E2H C;  3S17 C;  4X6A K;  4BBR K;  5C44 K;  1TWH C;  4YG2 A;  4MEX A;  3HOV K;  4BXX C;  5IP7 C;  3PO3 C;  4A3D C;  3HOY C;  5C3E K;  2A68 A;  1I3Q C;  4NOI A;  2A6H A;  3I4N C;  2E2I C;  3H3V L;  1SMY A;  2NVY C;  2B63 C;  3M4O K;  2JA8 C;  3S1Q C;  3GTL K;  4MEY A;  2NVQ C;  2PA8 D;  3S15 K;  2WAQ D;  5M3F K;  3WOD A;  5TMC A;  3RZO C;  4A3L K;  3GTG K;  1I3Q K;  2R93 K;  3GTQ C;  3RZD C;  1Y1W K;  5FJ8 K;  1ZYR A;  4C3J K;  3GTJ C;  5FLM K;  3K7A K;  4BBR C;  5C44 C;  4MQ9 A;  3HOU K;  3HOV C;  4A3C K;  3GTO K;  5IYB K;  2JA7 C;  5C3E C;  2PPB A;  4BBS K;  3M4O C;  4AYB L;  3GTK K;  3H3V D;  3GTL C;  1Y1V K;  2Y0S L;  3S15 C;  2CW0 A;  4XSX A;  1TWA C;  4A3L C;  2JA7 K;  4G7Z A;  2NVT K;  5C4X K;  3GTG C;  3I4M K;  4Y7N K;  3S1N K;  2R93 C;  4A3K C;  1Y1W C;  3S14 K;  5FLM C;  4LJZ A;  2A6E A; 
#chains in the Genus database with same CATH topology
 2NVY A;  2GSO A;  1WSV A;  1IBA A;  4A3K K;  4BBS C;  3GTK C;  3HOW K;  4QIW D;  3PO2 K;  3M3Y K;  3ORE A;  1Y1V C;  3GTQ A;  1F7V A;  1XXC A;  4KB4 A;  2Y0S D;  1VH2 A;  3GEE A;  2R92 K;  3CAG A;  3I4M C;  1ZBS A;  3S2H K;  3S1N C;  4GTC A;  1J98 A;  3GTP K;  5M5Y K;  4P9S A;  4OIQ A;  1TWC C;  1I50 C;  3BP3 A;  4JK1 A;  4A3I C;  1TWA A;  4ZH4 A;  3MML B;  3ADA C;  3H0G C;  1O28 A;  4PAB A;  1Y1W A;  5JFE A;  3LPX A;  2PMZ D;  4G7H A;  3S2D C;  2E2J C;  1K83 K;  3AH5 A;  1IS1 A;  3OEP A;  2WB1 D;  1I6V A;  1RU0 A;  5C4J C;  3TFJ A;  4A3M K;  4A3B K;  3GTM A;  4A3G C;  5IYD K;  4C3I C;  4YFX A;  1WQH A;  4LQY A;  1KQ4 A;  4A3F C;  4BY7 C;  3S17 K;  3TFH A;  1TWH K;  1WCM C;  2JA5 C;  2YU9 A;  5IP7 K;  1VRQ C;  2RH6 A;  4Q4Z A;  3AD8 C;  4J3N A;  2A69 A;  2W7V A;  3HOY K;  4A3D K;  2E2I K;  3LAJ A;  4BY1 C;  3S1Q K;  1GE9 A;  4C3H K;  2NVQ K;  1TWF A;  2PHC B;  3T01 A;  3AD7 C;  1DCH A;  1R9T C;  2O5I A;  1O26 A;  4KN7 A;  2R7Z A;  3HOX C;  3RZD K;  2V6T A;  3GEH A;  4X6A K;  5C44 K;  4MEX A;  3HOV K;  3PO3 C;  5C3E K;  4NOI A;  2A6H A;  3I4N C;  2NVY C;  3TFI A;  4MEY A;  1O2B A;  1USO A;  3WOD A;  3GTG K;  3CQZ A;  3GTQ C;  5EGH A;  4C2M C;  1C0A A;  4BBR C;  4MQ9 A;  1UV7 A;  1WQF A;  1XXA A;  4GTD A;  4BBS K;  3M4O C;  1J6V A;  3BP8 C;  3GEI A;  3GTK K;  1SFO A;  2V6S A;  1AB4 A;  1Y1V K;  3TTG A;  3S15 C;  2CW0 A;  4XSX A;  2E2H A;  1TWA C;  2JA7 K;  4G7Z A;  3I4M K;  4KDD A;  3L4K A;  3AQP A;  3S1N K;  2P5M A;  1Y1W C;  3FHZ A;  1I3Q A;  2A6E A;  5CHP A;  4A3C C;  1TWC K;  1DD5 A;  1I50 K;  3EQL A;  4A3I K;  4G7O A;  3H0G K;  3N0C A;  3GTM C;  4DDQ A;  2Y3P A;  4A3J C;  3S2D K;  4Y7N C;  2O5J A;  4XSZ A;  2E2J K;  2JH3 A;  1VJE A;  2YU9 C;  1EQR A;  1BGW A;  3GTL A;  4A3G K;  4AH6 A;  4C3I K;  1O2A A;  2CFA B;  2V6U A;  3SZY A;  3OPF A;  1JQW A;  3HKZ D;  4A3F K;  4Y52 K;  4BY7 K;  2R93 A;  4QJV B;  1F9N A;  5IOT A;  1WCM K;  5IP9 C;  4BY1 K;  4GT9 A;  1R9T K;  1WOR A;  4OIO A;  3HOX K;  3HOZ K;  2JA6 C;  3CQZ C;  2BE5 A;  3PO3 K;  3A8I A;  3I4N K;  4C45 A;  2NVY K;  5L46 A;  1DCO A;  3FKI A;  1XPP A;  1K83 A;  4WJ4 A;  1SFO C;  3GTQ K;  3N0B A;  5IOS A;  4G0V A;  4C2M K;  2E2H C;  2GAH C;  1YCL A;  4BBR K;  1ZQ1 C;  1TWG A;  4BXX C;  5CJ9 A;  2A68 A;  1I3Q C;  3H3V L;  3M4O K;  3ERE D;  1XZQ A;  4KAT A;  2PA8 D;  3S15 K;  2WAQ D;  3RZO C;  4P5A A;  4P5B A;  1Y1W K;  3VA7 A;  2VUM A;  1O25 A;  1VLO A;  1EI6 A;  4A3C K;  5TJ3 A;  1ZXO A;  1XZP B;  2NVX A;  3BUE A;  3GTL C;  2EBB A;  2Y0S L;  4KMD A;  4A3L C;  2GSU A;  4Y7N K;  2R93 C;  4A3K C;  2XCO A;  2ZUF A;  1PJ6 A;  5FLM C;  2YU9 K;  3K7A C;  2B63 A;  4GFQ A;  3HOU C;  3S0X A;  5IYB C;  2GAG C;  4GTB A;  4AYB D;  1BDF A;  3GTJ A;  2PMZ L;  5HL8 A;  5C4X C;  5M3M K;  4RMF A;  1O29 A;  4LR2 A;  5IP9 K;  2JA7 A;  3FOE A;  1V5V A;  3S16 C;  4KM8 A;  3Q3Q A;  4KAW X;  1TWC A;  3FKI C;  1I50 A;  1O24 A;  3G4A A;  3DXJ A;  4YFN A;  2JA6 K;  2FQO A;  3S1M C;  3CQZ K;  5IYC C;  4A93 C;  3GIR A;  5TMF A;  4A3M C;  1B4B A;  1IQ0 A;  5IYD C;  2FQT A;  1YX2 A;  3GTO A;  2P8T A;  3GDZ A;  1TWG C;  4KN4 A;  4Q5S A;  4A3E C;  1SFO K;  4GZY A;  4GTF A;  2E2H K;  1I6H C;  3LAP A;  1YNJ A;  5C4J K;  2GSN A;  4YFK A;  4BXX K;  4XLP A;  1TWF C;  1WQG A;  2VUM C;  1WSR A;  3S1R C;  5EGE A;  2R7Z C;  4X6A C;  2JA5 K;  3G4C A;  2NVX C;  3RZO K;  2R92 A;  4WJ3 M;  1PJ7 A;  3IPJ A;  4OIR A;  3GTP A;  4YG2 A;  4BLB A;  1O2F B;  1IE0 A;  4KB2 A;  1SMY A;  2B63 C;  2JA8 C;  3GTL K;  3JST A;  5M3F K;  4A3L K;  3T02 A;  4G0W A;  2R93 K;  2ZUE A;  5FJ8 K;  4O2D A;  3GTJ C;  5FLM K;  3A8K A;  1BJT A;  3K7A K;  3HOU K;  5IYB K;  4KC6 A;  1VGX A;  2JA7 C;  1HI9 A;  2PPB A;  1X31 C;  2D6F C;  1WOS A;  4GTE A;  3NUH A;  4KMH A;  1IL2 A;  1JVI A;  5E68 A;  5C4X K;  1TWH A;  1PJ5 A;  1JOE A;  4C3J C;  5JVO A;  3GSI A;  2E2I A;  2CFA A;  4GTA A;  1TWA K;  3GTO C;  3S16 K;  1EK8 A;  4FZB A;  3V4G A;  1IW7 A;  3AQO A;  4QJV A;  1YNN A;  1BS2 A;  3HKZ L;  3FKI K;  4BLA A;  5M5W K;  1L0W A;  3S1M K;  5IYC K;  4A93 K;  1EFW A;  2NVT C;  4QIW L;  5IOQ A;  3S14 C;  1DCP A;  4LLG A;  1TWG K;  3GTM K;  2ZFZ A;  4Y52 C;  1O27 A;  1WOO A;  4A3J K;  4A3E K;  3QX3 A;  4XLN A;  3GTG A;  3HOW C;  3PO2 C;  3M3Y C;  1I6H K;  4LK1 A;  3FOF A;  4M1X A;  2KWA A;  2R92 C;  3S2H C;  1TWF K;  4FM9 A;  1J6X A;  1F93 A;  5M5X K;  2VUM K;  1ISE A;  3GTP C;  4KMU A;  3HOZ C;  3A8J A;  4KM9 A;  3S1R K;  3GTK A;  4LOW A;  2R7Z K;  1USM A;  2NVX K;  1Y1V A;  4G0U A;  2XCQ A;  1HQM A;  2WB1 L;  4BKW A;  2JA6 A;  4OIN A;  4ILD A;  1K83 C;  2B63 K;  1WIH A;  5D4D A;  2JA8 K;  4OIP A;  4LK0 A;  2PA8 L;  4KAS A;  1WOP A;  2WAQ L;  4A3B C;  3H0G A;  3T00 A;  1F7U A;  1B4A A;  1J6W A;  1G51 A;  3AD9 C;  3GTJ K;  3S17 C;  1XZP A;  1TWH C;  5IP7 C;  2XCR B;  4XCH A;  4A3D C;  3HOY C;  2E2I C;  3S1Q C;  4C3H C;  2NVQ C;  3L4J A;  4GTL A;  5TMC A;  3N3Y A;  1I3Q K;  1WCM A;  4KAR A;  2JA5 A;  3RZD C;  1INN A;  1ZYR A;  4C3J K;  4WIL A;  5C44 C;  3HXA A;  3HOV C;  3GTO K;  3SZZ A;  5C3E C;  5IOR A;  1ZVU A;  4AYB L;  1R9T A;  3H3V D;  1XXB A;  4KMA A;  4PAA A;  2NVT K;  1XZQ B;  3GTG C;  3S14 K;  2RGR A;  1EH1 A;  4LJZ A; 
#chains in the Genus database with same CATH homology
 3K7A C;  3HOU C;  1TWA K;  3GTO C;  1TWC K;  5IYB C;  3S16 K;  4A3C C;  1I50 K;  1IW7 A;  4A3K K;  3EQL A;  4A3I K;  4BBS C;  4QJV A;  1YNN A;  3HKZ L;  3GTK C;  4G7O A;  3FKI K;  3HOW K;  4QIW D;  4AYB D;  3H0G K;  5M5W K;  3GTM C;  3PO2 K;  3M3Y K;  1Y1V C;  3S1M K;  1BDF A;  5IYC K;  2Y0S D;  2R92 K;  4A93 K;  4A3J C;  2PMZ L;  3I4M C;  2NVT C;  3S2H K;  5C4X C;  3S2D K;  4Y7N C;  3S1N C;  4XSZ A;  5M3M K;  4QIW L;  2E2J K;  3S14 C;  2O5J A;  5IP9 K;  4LLG A;  1TWG K;  3GTP K;  5M5Y K;  2YU9 C;  3GTM K;  4Y52 C;  4OIQ A;  4A3J K;  1TWC C;  3S16 C;  4A3G K;  1I50 C;  4JK1 A;  4C3I K;  4A3E K;  4A3I C;  4ZH4 A;  3FKI C;  4XLN A;  3HOW C;  3HKZ D;  3H0G C;  3DXJ A;  4YFN A;  4A3F K;  2JA6 K;  3M3Y C;  4LK1 A;  3PO2 C;  4BY7 K;  1I6H K;  3S1M C;  3CQZ K;  4QJV B;  5IYC C;  4A93 C;  5TMF A;  4A3M C;  2R92 C;  1WCM K;  5IYD C;  3S2H C;  2PMZ D;  4G7H A;  1TWF K;  3S2D C;  2E2J C;  5M5X K;  1K83 K;  2VUM K;  5IP9 C;  4BY1 K;  1TWG C;  3GTP C;  4KMU A;  3HOZ C;  3S1R K;  2WB1 D;  4KN4 A;  1I6V A;  4A3M K;  5C4J C;  2R7Z K;  4A3B K;  4Q5S A;  2NVX K;  4A3G C;  4A3E C;  1R9T K;  5IYD K;  1SFO K;  2YU9 K;  4YFX A;  4GZY A;  4OIO A;  3HOX K;  1HQM A;  2WB1 L;  3HOZ K;  4A3F C;  2JA6 C;  2E2H K;  4BY7 C;  3S17 K;  1YNJ A;  1I6H C;  5C4J K;  3CQZ C;  2BE5 A;  1TWH K;  1WCM C;  4YFK A;  2JA5 C;  4BXX K;  5IP7 K;  4XLP A;  4Q4Z A;  3PO3 K;  4A3D K;  2A69 A;  1TWF C;  4OIN A;  3HOY K;  3I4N K;  1K83 C;  2E2I K;  2B63 K;  2NVY K;  5D4D A;  4BY1 C;  2JA8 K;  2VUM C;  3S1Q K;  4C3H K;  4OIP A;  3S1R C;  2NVQ K;  4LK0 A;  2PA8 L;  2R7Z C;  1XPP A;  2WAQ L;  4X6A C;  2JA5 K;  4A3B C;  2NVX C;  1R9T C;  3RZO K;  1SFO C;  2O5I A;  4KN7 A;  3HOX C;  3RZD K;  3GTQ K;  4Y52 K;  4C2M K;  3GTJ K;  4OIR A;  2E2H C;  3S17 C;  4X6A K;  4BBR K;  5C44 K;  1TWH C;  4YG2 A;  4MEX A;  3HOV K;  4BXX C;  5IP7 C;  3PO3 C;  4A3D C;  3HOY C;  5C3E K;  2A68 A;  1I3Q C;  4NOI A;  2A6H A;  3I4N C;  2E2I C;  3H3V L;  1SMY A;  2NVY C;  2B63 C;  3M4O K;  2JA8 C;  3S1Q C;  3GTL K;  4MEY A;  2NVQ C;  2PA8 D;  3S15 K;  2WAQ D;  5M3F K;  3WOD A;  5TMC A;  3RZO C;  4A3L K;  3GTG K;  1I3Q K;  2R93 K;  3GTQ C;  3RZD C;  1Y1W K;  5FJ8 K;  1ZYR A;  4C3J K;  3GTJ C;  5FLM K;  3K7A K;  4BBR C;  5C44 C;  4MQ9 A;  3HOU K;  3HOV C;  4A3C K;  3GTO K;  5IYB K;  2JA7 C;  5C3E C;  2PPB A;  4BBS K;  3M4O C;  4AYB L;  3GTK K;  3H3V D;  3GTL C;  1Y1V K;  2Y0S L;  3S15 C;  2CW0 A;  4XSX A;  1TWA C;  4A3L C;  2JA7 K;  4G7Z A;  2NVT K;  5C4X K;  3GTG C;  3I4M K;  4Y7N K;  3S1N K;  2R93 C;  4A3K C;  1Y1W C;  3S14 K;  5FLM C;  4LJZ A;  2A6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...