2V6SA

Medium resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
total genus 29
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6sA00
3JSTA 4C45A 4WILA 2EBBA 1DCPA 1RU0A 2V6TA 2V6UA 1USOA 1DCHA 3HXAA 4LOWA 1F93A 2V6SA 1USMA 1DCOA
chains in the Genus database with same CATH superfamily
4OIRA 4ZH4A 3S1QK 4P5BA 5IYBK 3L4JA 4KAWX 5C44K 4GTDA 3FKIA 1G51A 4OIQA 2BE5A 2W7VA 1F9NA 4G7OA 4P5AA 4WJ4A 4KN7A 4OIPA 1O26A 4Y52K 3S2HC 3HKZD 1YCLA 2PMZL 3RZOC 4GTFA 3I4NC 3PO2C 3SZYA 3MMLB 5D4DA 3GTKC 1GE9A 2GSNA 3S1RC 4BBRK 2E2HC 1XZPA 1KQ4A 3OPFA 3GTGK 3I4NK 3AD9C 2ZUEA 1I50C 3CQZK 1ZXOA 4KB2A 1WQHA 4Q5SA 3Q3QA 3QX3A 2R92C 2JH3A 3BP3A 1IW7A 4A3CC 1TWAA 3GEEA 1ZQ1C 4G7ZA 3TFJA 2E2IK 3GTJA 5IP9K 2GSOA 1J98A 2V6UA 2FQOA 2CFAB 1YX2A 2NVYC 2WB1D 4KARA 4X6AC 1EH1A 2EBBA 2VUMC 4XSXA 4LLGA 3BP8C 5E68A 2GAGC 3K7AK 4BKWA 1JVIA 1WOSA 2NVYK 5IORA 5IOTA 3S16C 1VRQC 4X6AK 2E2HA 4C2MK 1VGXA 2B63A 2VUMK 3HOYC 4A3BK 1WQGA 1WOOA 1XXBA 1X31C 4O2DA 4C3JC 3SZZA 1O29A 5IP7C 3LAJA 4KMUA 1EK8A 2NVXC 5EGHA 1IBAA 3RZDC 3GTQC 4BXXC 4KC6A 4A3KK 1TWGC 1K83K 3G4AA 4GTCA 2NVQK 2ZFZA 1I3QC 4MEXA 2FQTA 3N3YA 3GTQK 1I6HK 3FKIC 1F7UA 1USOA 3GTMA 4A3EK 3H0GK 5HL8A 3S14K 3HOVK 3S15C 1ISEA 3FKIK 1RU0A 1ZVUA 4LOWA 3WODA 3FOEA 1IS1A 3JSTA 4G0UA 1I6VA 2Y0SD 1DCHA 4C3HC 4A3DC 2NVXA 3S15K 3S1MK 2NVTK 4OIOA 3M4OC 1SMYA 4A3GK 2D6FC 4AYBL 5M3FK 4GZYA 3ADAC 3AQPA 3AD8C 3EQLA 1I3QA 1PJ5A 3T02A 3M3YC 1TWAC 4MQ9A 4KN4A 4KM8A 3M4OK 4A3LC 5CJ9A 3TFIA 3FHZA 3HOWK 4G0VA 4GTLA 5C4XK 3GTJC 4XLNA 3S1NC 1DCPA 3GEIA 1O27A 1WIHA 3DXJA 1SFOA 1J6WA 2WAQL 1TWCC 2JA8C 4WILA 5L46A 2PMZD 1ZBSA 2A6EA 4Y7NC 1JOEA 3S2HK 1ZYRA 2B63C 3RZOK 1EFWA 3PO2K 1F93A 3TTGA 3GTKK 3HXAA 3N0BA 2XCRB 2PA8L 4GTEA 3S1RK 1USMA 3GTOC 2E2HK 2A6HA 3HOUC 2P8TA 2R7ZC 1I50K 4BBSC 3T01A 3OEPA 3A8KA 4GTBA 1Y1VA 2R92K 1L0WA 1VJEA 3FOFA 2V6SA 4A3CK 3GEHA 1TWCA 3GTMC 2XCQA 5IYCC 4XSZA 4PAAA 1TWHA 4PABA 4BLBA 2Y3PA 4QIWL 3TFHA 1XZQB 3LPXA 3HOXC 1VH2A 1HI9A 3GTMK 4BY7C 4KMDA 3GSIA 1IE0A 4KMAA 3GTOA 3S16K 3PO3C 2YU9A 1TWFC 3GTGA 2JA6A 3HOYK 3LAPA 3CQZA 2GAHC 3V4GA 2R7ZA 4LQYA 1XXAA 4C3JK 5IP7K 4A3FC 1WCMC 3OREA 3GTPC 3AQOA 2NVXK 3S17C 4YFXA 4G7HA 3RZDK 4XLPA 5C4JC 2RGRA 4BXXK 4BLAA 2JA7A 5TMFA 1EQRA 5JVOA 1TWGK 2E2JC 2O5IA 5C3EC 1I3QK 1B4AA 1J6XA 3GTLA 3S17K 1O28A 1WORA 1XXCA 1SFOC 1R9TC 1VLOA 3L4KA 1O2FB 4FZBA 4YFKA 2E2JK 4JK1A 4A3JC 3G4CA 1SFOK 1Y1WC 1TWFA 4GTAA 4QJVB 5M5XK 1IL2A 4A93C 3HOZC 2JA5A 4ILDA 1WCMA 4C3HK 3GTPA 1DD5A 4A3DK 4LJZA 1V5VA 4AYBD 4BY1C 2CFAA 3H3VL 1IQ0A 1INNA 1AB4A 1Y1VC 4KMHA 5IYBC 4A3MC 4A3IC 2KWAA 5C44C 3M3YK 1TWAK 1HQMA 1R9TA 4A3LK 4GT9A 1XZQA 2P5MA 3H0GA 1O25A 1TWHC 1PJ6A 4Q4ZA 4XCHA 1Y1VK 3GTJK 4OINA 3S1NK 5M3MK 4A3MK 4Y52C 4M1XA 4A3IK 2WAQD 4YG2A 1WQFA 3HKZL 1Y1WA 1TWCK 1B4BA 2RH6A 2JA8K 1C0AA 1TWHK 3BUEA 4BBRC 4Y7NK 4C45A 2YU9C 3GTGC 4NOIA 2B63K 2JA6C 3IPJA 3CQZC 2PPBA 2R93A 2CW0A 4AH6A 3T00A 1F7VA 2PA8D 2XCOA 3ERED 3S0XA 5JFEA 3GTOK 3AD7C 4J3NA 2YU9K 2JA6K 3HOUK 5IYDC 2JA7C 2E2IC 3S2DC 2R7ZK 1EI6A 4BBSK 4DDQA 5IP9C 1WSRA 2GSUA 3GTLC 5EGEA 2A68A 4KDDA 2PHCB 4MEYA 5IYDK 2WB1L 1BGWA 2JA7K 2O5JA 3S2DK 5IYCK 3K7AC 4QIWD 4G0WA 4QJVA 1BDFA 1JQWA 3GTLK 4LK0A 2A69A 4LR2A 4C2MC 5M5WK 4A3BC 4RMFA 3HOXK 3GTKA 2JA5C 4BY7K 5FLMC 3PO3K 1TWFK 4A3KC 1YNNA 1I50A 1J6VA 1K83C 3GIRA 2E2IA 2NVQC 2JA5K 1XZPB 2R92A 2ZUFA 5M5YK 4A3FK 1WCMK 5FLMK 1WSVA 3GTPK 4GFQA 1I6HC 3N0CA 5CHPA 3NUHA 1O2BA 1XPPA 2V6TA 4KM9A 5C4JK 4KATA 5IOSA 1PJ7A 4A3EC 5TMCA 3I4MC 4KASA 3H0GC 3VA7A 3S14C 4FM9A 3HOVC 5C3EK 4YFNA 5TJ3A 2NVYA 5IOQA 4KB4A 1O2AA 1BS2A 1R9TK 4C3IC 2VUMA 1O24A 3I4MK 5FJ8K 3CAGA 4LK1A 4P9SA 4A3JK 1UV7A 2NVTC 3S1MC 2Y0SL 4WJ3M 3A8JA 4C3IK 1Y1WK 4A3GC 2R93C 1K83A 4A93K 3HOZK 1YNJA 3AH5A 3S1QC 1WOPA 1BJTA 3A8IA 3GTQA 3GDZA 3H3VD 4BY1K 3HOWC 2R93K 5C4XC 1TWGA 1DCOA
chains in the Genus database with same CATH topology
3JSTA 4C45A 4WILA 2EBBA 1DCPA 1RU0A 2V6TA 2V6UA 1USOA 1DCHA 3HXAA 4LOWA 1F93A 2V6SA 1USMA 1DCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JST A;  4C45 A;  4WIL A;  2EBB A;  1DCP A;  1RU0 A;  2V6T A;  2V6U A;  1USO A;  1DCH A;  3HXA A;  4LOW A;  1F93 A;  2V6S A;  1USM A;  1DCO A; 
#chains in the Genus database with same CATH topology
 4OIR A;  4ZH4 A;  3S1Q K;  4P5B A;  5IYB K;  3L4J A;  4KAW X;  5C44 K;  4GTD A;  3FKI A;  1G51 A;  4OIQ A;  2BE5 A;  2W7V A;  1F9N A;  4G7O A;  4P5A A;  4WJ4 A;  4KN7 A;  4OIP A;  1O26 A;  4Y52 K;  3S2H C;  3HKZ D;  1YCL A;  2PMZ L;  3RZO C;  4GTF A;  3I4N C;  3PO2 C;  3SZY A;  3MML B;  5D4D A;  3GTK C;  1GE9 A;  2GSN A;  3S1R C;  4BBR K;  2E2H C;  1XZP A;  1KQ4 A;  3OPF A;  3GTG K;  3I4N K;  3AD9 C;  2ZUE A;  1I50 C;  3CQZ K;  1ZXO A;  4KB2 A;  1WQH A;  4Q5S A;  3Q3Q A;  3QX3 A;  2R92 C;  2JH3 A;  3BP3 A;  1IW7 A;  4A3C C;  1TWA A;  3GEE A;  1ZQ1 C;  4G7Z A;  3TFJ A;  2E2I K;  3GTJ A;  5IP9 K;  2GSO A;  1J98 A;  2V6U A;  2FQO A;  2CFA B;  1YX2 A;  2NVY C;  2WB1 D;  4KAR A;  4X6A C;  1EH1 A;  2EBB A;  2VUM C;  4XSX A;  4LLG A;  3BP8 C;  5E68 A;  2GAG C;  3K7A K;  4BKW A;  1JVI A;  1WOS A;  2NVY K;  5IOR A;  5IOT A;  3S16 C;  1VRQ C;  4X6A K;  2E2H A;  4C2M K;  1VGX A;  2B63 A;  2VUM K;  3HOY C;  4A3B K;  1WQG A;  1WOO A;  1XXB A;  1X31 C;  4O2D A;  4C3J C;  3SZZ A;  1O29 A;  5IP7 C;  3LAJ A;  4KMU A;  1EK8 A;  2NVX C;  5EGH A;  1IBA A;  3RZD C;  3GTQ C;  4BXX C;  4KC6 A;  4A3K K;  1TWG C;  1K83 K;  3G4A A;  4GTC A;  2NVQ K;  2ZFZ A;  1I3Q C;  4MEX A;  2FQT A;  3N3Y A;  3GTQ K;  1I6H K;  3FKI C;  1F7U A;  1USO A;  3GTM A;  4A3E K;  3H0G K;  5HL8 A;  3S14 K;  3HOV K;  3S15 C;  1ISE A;  3FKI K;  1RU0 A;  1ZVU A;  4LOW A;  3WOD A;  3FOE A;  1IS1 A;  3JST A;  4G0U A;  1I6V A;  2Y0S D;  1DCH A;  4C3H C;  4A3D C;  2NVX A;  3S15 K;  3S1M K;  2NVT K;  4OIO A;  3M4O C;  1SMY A;  4A3G K;  2D6F C;  4AYB L;  5M3F K;  4GZY A;  3ADA C;  3AQP A;  3AD8 C;  3EQL A;  1I3Q A;  1PJ5 A;  3T02 A;  3M3Y C;  1TWA C;  4MQ9 A;  4KN4 A;  4KM8 A;  3M4O K;  4A3L C;  5CJ9 A;  3TFI A;  3FHZ A;  3HOW K;  4G0V A;  4GTL A;  5C4X K;  3GTJ C;  4XLN A;  3S1N C;  1DCP A;  3GEI A;  1O27 A;  1WIH A;  3DXJ A;  1SFO A;  1J6W A;  2WAQ L;  1TWC C;  2JA8 C;  4WIL A;  5L46 A;  2PMZ D;  1ZBS A;  2A6E A;  4Y7N C;  1JOE A;  3S2H K;  1ZYR A;  2B63 C;  3RZO K;  1EFW A;  3PO2 K;  1F93 A;  3TTG A;  3GTK K;  3HXA A;  3N0B A;  2XCR B;  2PA8 L;  4GTE A;  3S1R K;  1USM A;  3GTO C;  2E2H K;  2A6H A;  3HOU C;  2P8T A;  2R7Z C;  1I50 K;  4BBS C;  3T01 A;  3OEP A;  3A8K A;  4GTB A;  1Y1V A;  2R92 K;  1L0W A;  1VJE A;  3FOF A;  2V6S A;  4A3C K;  3GEH A;  1TWC A;  3GTM C;  2XCQ A;  5IYC C;  4XSZ A;  4PAA A;  1TWH A;  4PAB A;  4BLB A;  2Y3P A;  4QIW L;  3TFH A;  1XZQ B;  3LPX A;  3HOX C;  1VH2 A;  1HI9 A;  3GTM K;  4BY7 C;  4KMD A;  3GSI A;  1IE0 A;  4KMA A;  3GTO A;  3S16 K;  3PO3 C;  2YU9 A;  1TWF C;  3GTG A;  2JA6 A;  3HOY K;  3LAP A;  3CQZ A;  2GAH C;  3V4G A;  2R7Z A;  4LQY A;  1XXA A;  4C3J K;  5IP7 K;  4A3F C;  1WCM C;  3ORE A;  3GTP C;  3AQO A;  2NVX K;  3S17 C;  4YFX A;  4G7H A;  3RZD K;  4XLP A;  5C4J C;  2RGR A;  4BXX K;  4BLA A;  2JA7 A;  5TMF A;  1EQR A;  5JVO A;  1TWG K;  2E2J C;  2O5I A;  5C3E C;  1I3Q K;  1B4A A;  1J6X A;  3GTL A;  3S17 K;  1O28 A;  1WOR A;  1XXC A;  1SFO C;  1R9T C;  1VLO A;  3L4K A;  1O2F B;  4FZB A;  4YFK A;  2E2J K;  4JK1 A;  4A3J C;  3G4C A;  1SFO K;  1Y1W C;  1TWF A;  4GTA A;  4QJV B;  5M5X K;  1IL2 A;  4A93 C;  3HOZ C;  2JA5 A;  4ILD A;  1WCM A;  4C3H K;  3GTP A;  1DD5 A;  4A3D K;  4LJZ A;  1V5V A;  4AYB D;  4BY1 C;  2CFA A;  3H3V L;  1IQ0 A;  1INN A;  1AB4 A;  1Y1V C;  4KMH A;  5IYB C;  4A3M C;  4A3I C;  2KWA A;  5C44 C;  3M3Y K;  1TWA K;  1HQM A;  1R9T A;  4A3L K;  4GT9 A;  1XZQ A;  2P5M A;  3H0G A;  1O25 A;  1TWH C;  1PJ6 A;  4Q4Z A;  4XCH A;  1Y1V K;  3GTJ K;  4OIN A;  3S1N K;  5M3M K;  4A3M K;  4Y52 C;  4M1X A;  4A3I K;  2WAQ D;  4YG2 A;  1WQF A;  3HKZ L;  1Y1W A;  1TWC K;  1B4B A;  2RH6 A;  2JA8 K;  1C0A A;  1TWH K;  3BUE A;  4BBR C;  4Y7N K;  4C45 A;  2YU9 C;  3GTG C;  4NOI A;  2B63 K;  2JA6 C;  3IPJ A;  3CQZ C;  2PPB A;  2R93 A;  2CW0 A;  4AH6 A;  3T00 A;  1F7V A;  2PA8 D;  2XCO A;  3ERE D;  3S0X A;  5JFE A;  3GTO K;  3AD7 C;  4J3N A;  2YU9 K;  2JA6 K;  3HOU K;  5IYD C;  2JA7 C;  2E2I C;  3S2D C;  2R7Z K;  1EI6 A;  4BBS K;  4DDQ A;  5IP9 C;  1WSR A;  2GSU A;  3GTL C;  5EGE A;  2A68 A;  4KDD A;  2PHC B;  4MEY A;  5IYD K;  2WB1 L;  1BGW A;  2JA7 K;  2O5J A;  3S2D K;  5IYC K;  3K7A C;  4QIW D;  4G0W A;  4QJV A;  1BDF A;  1JQW A;  3GTL K;  4LK0 A;  2A69 A;  4LR2 A;  4C2M C;  5M5W K;  4A3B C;  4RMF A;  3HOX K;  3GTK A;  2JA5 C;  4BY7 K;  5FLM C;  3PO3 K;  1TWF K;  4A3K C;  1YNN A;  1I50 A;  1J6V A;  1K83 C;  3GIR A;  2E2I A;  2NVQ C;  2JA5 K;  1XZP B;  2R92 A;  2ZUF A;  5M5Y K;  4A3F K;  1WCM K;  5FLM K;  1WSV A;  3GTP K;  4GFQ A;  1I6H C;  3N0C A;  5CHP A;  3NUH A;  1O2B A;  1XPP A;  2V6T A;  4KM9 A;  5C4J K;  4KAT A;  5IOS A;  1PJ7 A;  4A3E C;  5TMC A;  3I4M C;  4KAS A;  3H0G C;  3VA7 A;  3S14 C;  4FM9 A;  3HOV C;  5C3E K;  4YFN A;  5TJ3 A;  2NVY A;  5IOQ A;  4KB4 A;  1O2A A;  1BS2 A;  1R9T K;  4C3I C;  2VUM A;  1O24 A;  3I4M K;  5FJ8 K;  3CAG A;  4LK1 A;  4P9S A;  4A3J K;  1UV7 A;  2NVT C;  3S1M C;  2Y0S L;  4WJ3 M;  3A8J A;  4C3I K;  1Y1W K;  4A3G C;  2R93 C;  1K83 A;  4A93 K;  3HOZ K;  1YNJ A;  3AH5 A;  3S1Q C;  1WOP A;  1BJT A;  3A8I A;  3GTQ A;  3GDZ A;  3H3V D;  4BY1 K;  3HOW C;  2R93 K;  5C4X C;  1TWG A;  1DCO A; 
#chains in the Genus database with same CATH homology
 3JST A;  4C45 A;  4WIL A;  2EBB A;  1DCP A;  1RU0 A;  2V6T A;  2V6U A;  1USO A;  1DCH A;  3HXA A;  4LOW A;  1F93 A;  2V6S A;  1USM A;  1DCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...