2V6SA

Medium resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
total genus 29
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6sA00
4LOWA 1DCOA 1USMA 2EBBA 1F93A 4C45A 1RU0A 2V6SA 2V6TA 3JSTA 4WILA 1USOA 1DCPA 2V6UA 3HXAA 1DCHA
chains in the Genus database with same CATH superfamily
3T00A 2Y0SD 5L46A 1ZXOA 3H0GK 3GDZA 3RZOK 1F9NA 4C3JK 3GSIA 4Y7NK 3GTQC 3PO3K 1TWAK 1I50K 2V6UA 2A68A 1VRQC 3DXJA 3A8IA 4YFKA 4KMUA 4RMFA 3GTKC 2WAQD 4A93C 3ERED 2GSOA 5IYBK 3WODA 1R9TK 1EI6A 3S16C 4LR2A 1YX2A 5IOSA 5JFEA 1INNA 2JA5C 2R92C 5TJ3A 4GTEA 2E2JK 3M3YK 5EGHA 3I4NK 3RZDC 4BLBA 4JK1A 1VLOA 2VUMK 5FLMC 3T02A 3L4KA 4WJ3M 4WILA 3GTOA 1HQMA 1TWFC 2CW0A 3S2DC 2P5MA 4C3IK 5IP7C 1USMA 3S1MK 4OIRA 1BS2A 3GTJK 3S14C 1J6WA 3H0GC 3RZOC 4J3NA 5IYCK 1SMYA 3CAGA 4C3JC 3S17K 4Y7NC 3PO3C 4KM9A 4NOIA 1TWAC 1I50C 1C0AA 2PMZL 1WOSA 3HKZD 2B63A 4A3GK 1IW7A 2JA7K 1X31C 3GTMK 1WQHA 5IYBC 4KATA 1YCLA 2CFAB 2YU9C 5IYDK 1VGXA 1R9TC 1I3QA 1WQGA 3LPXA 3A8JA 4FM9A 4A3KK 2NVYK 4LOWA 2E2JC 4C2MC 3M3YC 1WOPA 4P5AA 3GIRA 1WORA 2GAHC 3AQPA 1J98A 3FOEA 3GTGA 4Y52K 2VUMC 2JA6A 1O29A 4OINA 1WCMA 2WAQL 1TWCA 4C3IC 1DCOA 1XXCA 3GTLA 3S1MC 1DCHA 3GTJC 4OIPA 5M3FK 1O24A 5IYCC 2WB1L 3H3VL 3S17C 1XZPB 4MEYA 5TMFA 1EK8A 3GEHA 2Y3PA 4A3GC 1IE0A 2JA7C 4OIOA 3GTMC 4GTCA 5IYDC 3V4GA 3HOZK 2E2HK 3FOFA 4A3KC 2NVYC 5IORA 1VJEA 2R7ZA 2V6SA 4KB4A 1J6VA 1J6XA 2PA8D 5M5XK 4FZBA 3OREA 4Q4ZA 2PHCB 4A3IK 1Y1VA 4Y52C 3GTOK 4G7OA 4QIWL 2CFAA 1JQWA 3HKZL 1AB4A 4KAWX 1UV7A 3A8KA 1XZQB 4LK1A 4A3FK 4XLPA 2GSNA 3AH5A 2E2HA 1ZBSA 2KWAA 1IQ0A 2XCQA 3NUHA 1TWGK 4A3EK 1WQFA 2B63K 1EQRA 3HOYK 2GSUA 5IP9K 1BJTA 2P8TA 3FKIA 4Q5SA 3G4AA 4KN4A 1I3QK 3GTPA 4C45A 3QX3A 4A3MK 4A3DK 3S2HK 1BGWA 5M5YK 3HOZC 4BXXK 4GTDA 2NVTK 1O27A 5C4XC 4AYBD 4ZH4A 2E2IA 4KM8A 4M1XA 4WJ4A 4BKWA 5C4JK 1XZPA 3GTGK 2JA6K 4KDDA 3M4OK 3IPJA 4BBSK 3N0CA 4C3HK 1TWGA 3GEIA 1O26A 4A3IC 1WCMK 3GTOC 3K7AK 4A3CK 1TWCK 5M5WK 3GTLK 4GTFA 2JH3A 1DCPA 3HXAA 1DD5A 2FQOA 3S0XA 1F7UA 5C3EK 4A3FC 1WSVA 4X6AK 4LQYA 3I4MK 1O2AA 1I6VA 4XSZA 1Y1WK 3PO2K 1YNNA 4BY1K 3S15K 3I4NC 3G4CA 4A3EC 2Y0SL 2B63C 2NVXA 1O25A 3OEPA 2D6FC 1K83A 3HOYC 4G0WA 3S1RK 1YNJA 2PA8L 1SFOA 5IP9C 2PPBA 4A3LK 2ZFZA 1F7VA 4GTAA 1XPPA 1XZQA 1IS1A 1I3QC 1O2BA 3N0BA 2V6TA 4A3MC 3N3YA 2R93A 4A3DC 3FHZA 4GTBA 2R7ZK 4BXXC 2NVTC 3BUEA 3HOWK 1O28A 2JA8K 1VH2A 5C4JC 1PJ7A 1Y1VK 4QJVB 3GTGC 2JA6C 1Y1WA 3GEEA 4KASA 3M4OC 1PJ6A 4BBSC 4C3HC 3EQLA 4P5BA 1WCMC 3CQZA 1EFWA 1ZVUA 2W7VA 3K7AC 4KC6A 3S16K 3TFIA 4A3CC 1TWCC 3HOUK 3GTLC 4PAAA 2EBBA 1O2FB 4KN7A 5C3EC 2NVQK 4BY7K 4X6AC 2PMZD 4MEXA 5TMCA 3BP8C 1Y1WC 3PO2C 4AH6A 4BY1C 3S15C 3GTQA 4KMAA 4XCHA 3FKIK 3GTPK 3S1RC 4BLAA 4O2DA 4A3LC 3GTKA 3AQOA 1B4AA 5JVOA 5D4DA 1TWHK 4MQ9A 3LAJA 2E2IK 4G0VA 3S14K 2R7ZC 4A3BK 2JA5A 1USOA 1I6HK 2R92A 4YFXA 3HOWC 2JA8C 4XSXA 1EH1A 1Y1VC 3MMLB 1JOEA 5CHPA 2YU9K 4A3JK 3AD7C 3HOXK 3S1QK 1TWFA 3HOUC 2WB1D 5FJ8K 3H3VD 3L4JA 1WIHA 2E2HC 4C2MK 3BP3A 5EGEA 1TWHA 2BE5A 3VA7A 5M3MK 2NVQC 4BY7C 4QJVA 4PABA 2NVXK 2GAGC 4BBRK 2XCRB 3H0GA 4KMHA 1K83K 1SFOK 5IOTA 1JVIA 1TWAA 1I50A 3FKIC 3ADAC 1ZYRA 1IBAA 1KQ4A 3GTPC 2XCOA 1WSRA 2R93K 1V5VA 2A6EA 4ILDA 4LK0A 1GE9A 2ZUFA 4XLNA 2YU9A 1R9TA 1TWHC 3HOVK 2E2IC 2A6HA 1PJ5A 4A3BC 1I6HC 4LLGA 5C44K 4QIWD 1WOOA 1TWGC 4G0UA 3CQZK 5IOQA 1ISEA 5HL8A 2VUMA 5CJ9A 4KB2A 4OIQA 2RH6A 4GFQA 4KARA 4A3JC 3S1NK 3HOXC 3S1QC 1G51A 5E68A 3S2HC 2FQTA 1RU0A 4DDQA 1XXBA 3SZYA 4P9SA 2ZUEA 3GTQK 3OPFA 2NVXC 3GTJA 4BBRC 2O5JA 1K83C 3TFHA 4GT9A 1SFOC 2RGRA 1F93A 3GTKK 4A93K 3Q3QA 4GZYA 4KMDA 1XXAA 2R93C 3SZZA 4YFNA 2JA7A 3GTMA 2JA5K 1IL2A 2R92K 3HOVC 3JSTA 3LAPA 1BDFA 2NVYA 3I4MC 3S1NC 3RZDK 3T01A 5C44C 4AYBL 4GTLA 5FLMK 2A69A 1B4BA 3TFJA 3CQZC 2O5IA 4G7HA 4YG2A 1ZQ1C 4LJZA 3AD8C 1L0WA 1TWFK 4G7ZA 3S2DK 5C4XK 3TTGA 5IP7K 3AD9C 1HI9A
chains in the Genus database with same CATH topology
4LOWA 1DCOA 1USMA 2EBBA 1F93A 4C45A 1RU0A 2V6SA 2V6TA 3JSTA 4WILA 1USOA 1DCPA 2V6UA 3HXAA 1DCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LOW A;  1DCO A;  1USM A;  2EBB A;  1F93 A;  4C45 A;  1RU0 A;  2V6S A;  2V6T A;  3JST A;  4WIL A;  1USO A;  1DCP A;  2V6U A;  3HXA A;  1DCH A; 
#chains in the Genus database with same CATH topology
 3T00 A;  2Y0S D;  5L46 A;  1ZXO A;  3H0G K;  3GDZ A;  3RZO K;  1F9N A;  4C3J K;  3GSI A;  4Y7N K;  3GTQ C;  3PO3 K;  1TWA K;  1I50 K;  2V6U A;  2A68 A;  1VRQ C;  3DXJ A;  3A8I A;  4YFK A;  4KMU A;  4RMF A;  3GTK C;  2WAQ D;  4A93 C;  3ERE D;  2GSO A;  5IYB K;  3WOD A;  1R9T K;  1EI6 A;  3S16 C;  4LR2 A;  1YX2 A;  5IOS A;  5JFE A;  1INN A;  2JA5 C;  2R92 C;  5TJ3 A;  4GTE A;  2E2J K;  3M3Y K;  5EGH A;  3I4N K;  3RZD C;  4BLB A;  4JK1 A;  1VLO A;  2VUM K;  5FLM C;  3T02 A;  3L4K A;  4WJ3 M;  4WIL A;  3GTO A;  1HQM A;  1TWF C;  2CW0 A;  3S2D C;  2P5M A;  4C3I K;  5IP7 C;  1USM A;  3S1M K;  4OIR A;  1BS2 A;  3GTJ K;  3S14 C;  1J6W A;  3H0G C;  3RZO C;  4J3N A;  5IYC K;  1SMY A;  3CAG A;  4C3J C;  3S17 K;  4Y7N C;  3PO3 C;  4KM9 A;  4NOI A;  1TWA C;  1I50 C;  1C0A A;  2PMZ L;  1WOS A;  3HKZ D;  2B63 A;  4A3G K;  1IW7 A;  2JA7 K;  1X31 C;  3GTM K;  1WQH A;  5IYB C;  4KAT A;  1YCL A;  2CFA B;  2YU9 C;  5IYD K;  1VGX A;  1R9T C;  1I3Q A;  1WQG A;  3LPX A;  3A8J A;  4FM9 A;  4A3K K;  2NVY K;  4LOW A;  2E2J C;  4C2M C;  3M3Y C;  1WOP A;  4P5A A;  3GIR A;  1WOR A;  2GAH C;  3AQP A;  1J98 A;  3FOE A;  3GTG A;  4Y52 K;  2VUM C;  2JA6 A;  1O29 A;  4OIN A;  1WCM A;  2WAQ L;  1TWC A;  4C3I C;  1DCO A;  1XXC A;  3GTL A;  3S1M C;  1DCH A;  3GTJ C;  4OIP A;  5M3F K;  1O24 A;  5IYC C;  2WB1 L;  3H3V L;  3S17 C;  1XZP B;  4MEY A;  5TMF A;  1EK8 A;  3GEH A;  2Y3P A;  4A3G C;  1IE0 A;  2JA7 C;  4OIO A;  3GTM C;  4GTC A;  5IYD C;  3V4G A;  3HOZ K;  2E2H K;  3FOF A;  4A3K C;  2NVY C;  5IOR A;  1VJE A;  2R7Z A;  2V6S A;  4KB4 A;  1J6V A;  1J6X A;  2PA8 D;  5M5X K;  4FZB A;  3ORE A;  4Q4Z A;  2PHC B;  4A3I K;  1Y1V A;  4Y52 C;  3GTO K;  4G7O A;  4QIW L;  2CFA A;  1JQW A;  3HKZ L;  1AB4 A;  4KAW X;  1UV7 A;  3A8K A;  1XZQ B;  4LK1 A;  4A3F K;  4XLP A;  2GSN A;  3AH5 A;  2E2H A;  1ZBS A;  2KWA A;  1IQ0 A;  2XCQ A;  3NUH A;  1TWG K;  4A3E K;  1WQF A;  2B63 K;  1EQR A;  3HOY K;  2GSU A;  5IP9 K;  1BJT A;  2P8T A;  3FKI A;  4Q5S A;  3G4A A;  4KN4 A;  1I3Q K;  3GTP A;  4C45 A;  3QX3 A;  4A3M K;  4A3D K;  3S2H K;  1BGW A;  5M5Y K;  3HOZ C;  4BXX K;  4GTD A;  2NVT K;  1O27 A;  5C4X C;  4AYB D;  4ZH4 A;  2E2I A;  4KM8 A;  4M1X A;  4WJ4 A;  4BKW A;  5C4J K;  1XZP A;  3GTG K;  2JA6 K;  4KDD A;  3M4O K;  3IPJ A;  4BBS K;  3N0C A;  4C3H K;  1TWG A;  3GEI A;  1O26 A;  4A3I C;  1WCM K;  3GTO C;  3K7A K;  4A3C K;  1TWC K;  5M5W K;  3GTL K;  4GTF A;  2JH3 A;  1DCP A;  3HXA A;  1DD5 A;  2FQO A;  3S0X A;  1F7U A;  5C3E K;  4A3F C;  1WSV A;  4X6A K;  4LQY A;  3I4M K;  1O2A A;  1I6V A;  4XSZ A;  1Y1W K;  3PO2 K;  1YNN A;  4BY1 K;  3S15 K;  3I4N C;  3G4C A;  4A3E C;  2Y0S L;  2B63 C;  2NVX A;  1O25 A;  3OEP A;  2D6F C;  1K83 A;  3HOY C;  4G0W A;  3S1R K;  1YNJ A;  2PA8 L;  1SFO A;  5IP9 C;  2PPB A;  4A3L K;  2ZFZ A;  1F7V A;  4GTA A;  1XPP A;  1XZQ A;  1IS1 A;  1I3Q C;  1O2B A;  3N0B A;  2V6T A;  4A3M C;  3N3Y A;  2R93 A;  4A3D C;  3FHZ A;  4GTB A;  2R7Z K;  4BXX C;  2NVT C;  3BUE A;  3HOW K;  1O28 A;  2JA8 K;  1VH2 A;  5C4J C;  1PJ7 A;  1Y1V K;  4QJV B;  3GTG C;  2JA6 C;  1Y1W A;  3GEE A;  4KAS A;  3M4O C;  1PJ6 A;  4BBS C;  4C3H C;  3EQL A;  4P5B A;  1WCM C;  3CQZ A;  1EFW A;  1ZVU A;  2W7V A;  3K7A C;  4KC6 A;  3S16 K;  3TFI A;  4A3C C;  1TWC C;  3HOU K;  3GTL C;  4PAA A;  2EBB A;  1O2F B;  4KN7 A;  5C3E C;  2NVQ K;  4BY7 K;  4X6A C;  2PMZ D;  4MEX A;  5TMC A;  3BP8 C;  1Y1W C;  3PO2 C;  4AH6 A;  4BY1 C;  3S15 C;  3GTQ A;  4KMA A;  4XCH A;  3FKI K;  3GTP K;  3S1R C;  4BLA A;  4O2D A;  4A3L C;  3GTK A;  3AQO A;  1B4A A;  5JVO A;  5D4D A;  1TWH K;  4MQ9 A;  3LAJ A;  2E2I K;  4G0V A;  3S14 K;  2R7Z C;  4A3B K;  2JA5 A;  1USO A;  1I6H K;  2R92 A;  4YFX A;  3HOW C;  2JA8 C;  4XSX A;  1EH1 A;  1Y1V C;  3MML B;  1JOE A;  5CHP A;  2YU9 K;  4A3J K;  3AD7 C;  3HOX K;  3S1Q K;  1TWF A;  3HOU C;  2WB1 D;  5FJ8 K;  3H3V D;  3L4J A;  1WIH A;  2E2H C;  4C2M K;  3BP3 A;  5EGE A;  1TWH A;  2BE5 A;  3VA7 A;  5M3M K;  2NVQ C;  4BY7 C;  4QJV A;  4PAB A;  2NVX K;  2GAG C;  4BBR K;  2XCR B;  3H0G A;  4KMH A;  1K83 K;  1SFO K;  5IOT A;  1JVI A;  1TWA A;  1I50 A;  3FKI C;  3ADA C;  1ZYR A;  1IBA A;  1KQ4 A;  3GTP C;  2XCO A;  1WSR A;  2R93 K;  1V5V A;  2A6E A;  4ILD A;  4LK0 A;  1GE9 A;  2ZUF A;  4XLN A;  2YU9 A;  1R9T A;  1TWH C;  3HOV K;  2E2I C;  2A6H A;  1PJ5 A;  4A3B C;  1I6H C;  4LLG A;  5C44 K;  4QIW D;  1WOO A;  1TWG C;  4G0U A;  3CQZ K;  5IOQ A;  1ISE A;  5HL8 A;  2VUM A;  5CJ9 A;  4KB2 A;  4OIQ A;  2RH6 A;  4GFQ A;  4KAR A;  4A3J C;  3S1N K;  3HOX C;  3S1Q C;  1G51 A;  5E68 A;  3S2H C;  2FQT A;  1RU0 A;  4DDQ A;  1XXB A;  3SZY A;  4P9S A;  2ZUE A;  3GTQ K;  3OPF A;  2NVX C;  3GTJ A;  4BBR C;  2O5J A;  1K83 C;  3TFH A;  4GT9 A;  1SFO C;  2RGR A;  1F93 A;  3GTK K;  4A93 K;  3Q3Q A;  4GZY A;  4KMD A;  1XXA A;  2R93 C;  3SZZ A;  4YFN A;  2JA7 A;  3GTM A;  2JA5 K;  1IL2 A;  2R92 K;  3HOV C;  3JST A;  3LAP A;  1BDF A;  2NVY A;  3I4M C;  3S1N C;  3RZD K;  3T01 A;  5C44 C;  4AYB L;  4GTL A;  5FLM K;  2A69 A;  1B4B A;  3TFJ A;  3CQZ C;  2O5I A;  4G7H A;  4YG2 A;  1ZQ1 C;  4LJZ A;  3AD8 C;  1L0W A;  1TWF K;  4G7Z A;  3S2D K;  5C4X K;  3TTG A;  5IP7 K;  3AD9 C;  1HI9 A; 
#chains in the Genus database with same CATH homology
 4LOW A;  1DCO A;  1USM A;  2EBB A;  1F93 A;  4C45 A;  1RU0 A;  2V6S A;  2V6T A;  3JST A;  4WIL A;  1USO A;  1DCP A;  2V6U A;  3HXA A;  1DCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...