2V6SA

Medium resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
total genus 29
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6sA00
2V6SA 1RU0A 4C45A 2V6TA 2V6UA 4LOWA 3JSTA 1USMA 1F93A 2EBBA 1DCPA 1USOA 1DCOA 3HXAA 4WILA 1DCHA
chains in the Genus database with same CATH superfamily
3CAGA 4A3FK 4A3BC 3GEEA 1B4BA 1WCMK 1F93A 5HL8A 4AH6A 4A3KC 3HOWC 1IW7A 2XCQA 3ADAC 5C4JC 1O26A 3HOUK 4BBSK 5C3EK 3GTLA 2E2IK 1Y1WA 4OINA 3OEPA 3S2DK 3N3YA 4GTFA 4A93C 3AQOA 4FZBA 1TWFK 3GTKC 3FHZA 3DXJA 1TWGA 4KMHA 4YFNA 3RZOC 5D4DA 1IS1A 2B63A 3M3YK 1TWHK 5IYDK 1VGXA 4C2MK 4GZYA 4LJZA 3AH5A 4A3EC 2NVXK 2R93A 2ZFZA 4QIWD 1ZXOA 2WAQD 2Y3PA 1XZQA 3CQZC 3H0GC 5IP9C 1WQFA 4KM8A 1TWCA 3RZDK 3S1MK 2E2JC 4Q5SA 2NVTK 3V4GA 2PPBA 1TWGC 1VJEA 5TMFA 3FKIA 3S0XA 2R7ZK 2V6UA 1EQRA 2R92K 1DCPA 4QJVB 3M4OK 1I3QC 1O25A 4A3BK 1BDFA 3OPFA 2XCOA 2JA7A 4RMFA 4A3KK 1L0WA 3HOWK 3VA7A 3GTGC 5FJ8K 2NVYC 5C4JK 1ZVUA 1G51A 1I50A 2NVQC 2ZUEA 2JA5C 3GIRA 4OIQA 3L4JA 3PO2C 3BUEA 4A93K 2RH6A 4FM9A 2FQOA 3HOXC 3GTKK 3I4NC 2A6EA 3RZOK 1TWAA 4GTCA 5L46A 3GTPA 2RGRA 4A3EK 4A3JC 2P5MA 2WB1L 2GSOA 3GDZA 4BY7C 4JK1A 1XXBA 3CQZK 3H0GK 3AD9C 5IP9K 1ISEA 3GTOA 4OIOA 4XLPA 1BJTA 1EI6A 3S16C 4P5AA 4G7HA 4LLGA 4YFKA 1K83C 2E2JK 4PABA 1Y1VC 3JSTA 1J6VA 2O5IA 1TWGK 5IYCC 1J98A 2YU9C 3PO3C 3S14C 2O5JA 2VUMA 2CFAA 1I3QK 2E2HC 3S1QC 4G7ZA 3H3VL 3BP8C 2JA8C 1V5VA 5CJ9A 3GTGK 4XLNA 2Y0SL 4BLAA 1B4AA 1O24A 2NVYK 1IBAA 4BBRC 1ZYRA 2NVQK 1JQWA 2JA5K 3S17C 1R9TA 2GSUA 1SFOC 3PO2K 5M3FK 3HOXK 4LQYA 1EH1A 3I4NK 3GTJC 1BS2A 5FLMC 2PA8D 4A3JK 2KWAA 4MQ9A 1VH2A 2V6SA 3GTQC 4BY7K 1O27A 3TTGA 2FQTA 5C4XC 3GEHA 4BKWA 3S16K 4Y52C 1K83K 4KN4A 1Y1VK 3S1RC 5IYCK 3T00A 2YU9K 2A6HA 3PO3K 2JA6A 3Q3QA 3GTLC 4GFQA 3S14K 1Y1WC 3BP3A 4C3JC 1C0AA 3S1QK 2E2HK 5IOTA 4WJ4A 1F7VA 3G4AA 2JA8K 3TFHA 5TMCA 2P8TA 1YCLA 1XPPA 4BBRK 4KMUA 1DD5A 2B63C 3S17K 5TJ3A 2R93C 1SFOK 1DCHA 4LR2A 5JFEA 1IQ0A 5CHPA 1O28A 4A3DC 1O2BA 1ZQ1C 2PMZL 3HOVC 1IE0A 1TWCC 1XZQB 4BXXC 1XZPA 3GTJK 5FLMK 4GTBA 3GTMA 4C45A 3A8IA 1GE9A 3FKIC 3GTQK 3IPJA 5EGEA 1WCMA 4XSZA 4AYBL 4J3NA 5C4XK 3AQPA 3HKZL 4Y52K 2JA7C 1AB4A 4KB2A 1WQGA 4GTDA 4NOIA 4KM9A 4X6AC 2CW0A 2E2IA 3S1RK 4LK0A 1I50C 1HI9A 3LAJA 3GTLK 5IYBC 1YX2A 1F7UA 1Y1WK 4C3JK 1KQ4A 5C44C 4MEYA 4BLBA 1WOPA 1TWFA 3GEIA 5M5YK 1YNNA 4WILA 1JVIA 2BE5A 3EQLA 1TWHA 4LOWA 4GTEA 1WQHA 1TWAC 2NVXA 3N0CA 2B63K 3S15C 1I6HC 3GTPC 2D6FC 2R93K 5IP7C 4ILDA 3L4KA 3GTOC 2EBBA 4A3DK 4KN7A 3HOVK 1TWCK 4BXXK 2V6TA 1SMYA 1O2AA 2R7ZA 3K7AC 3QX3A 2R92A 3FKIK 4Y7NC 3N0BA 2WB1D 2VUMC 5EGHA 5E68A 2JA7K 1WIHA 2CFAB 1DCOA 4YG2A 4A3CC 1I6VA 4X6AK 3TFIA 4G0UA 1UV7A 1I50K 4QIWL 5IYBK 1R9TC 5C44K 4XCHA 1XXCA 4G0VA 3GTKA 1WSVA 4GTLA 1RU0A 3A8KA 4KARA 4O2DA 3H3VD 1JOEA 5IOSA 4G0WA 4KAWX 3S2HC 1TWAK 1X31C 2Y0SD 3WODA 3NUHA 3S15K 4BY1C 1I6HK 3GTPK 4A3MC 3HOZC 3CQZA 3H0GA 3T02A 1BGWA 4Q4ZA 1F9NA 1J6WA 1WORA 4ZH4A 4KB4A 5IP7K 4OIPA 3GTOK 1INNA 3TFJA 3OREA 5M5XK 4LK1A 1J6XA 3SZYA 4YFXA 2W7VA 1EK8A 4QJVA 4MEXA 3K7AK 4C3IC 4P9SA 2JA6C 1I3QA 4KDDA 3ERED 4Y7NK 4PAAA 4A3IC 1USOA 2VUMK 3GTGA 3LPXA 1ZBSA 2NVYA 1USMA 3G4CA 4A3CK 4G7OA 2JA5A 1VLOA 3I4MC 1IL2A 4OIRA 2GAHC 1WOOA 1R9TK 4C3HC 3S1NC 3HXAA 3T01A 1O29A 4A3GC 4GTAA 2ZUFA 5IORA 3S2HK 5M5WK 4BY1K 4KMAA 4A3LC 3GTMC 1XZPB 2A69A 4DDQA 4A3MK 3HOZK 3HOYC 3AD7C 4KASA 1PJ7A 4A3FC 3MMLB 4GT9A 1WCMC 1K83A 1O2FB 1Y1VA 3FOEA 2YU9A 2PMZD 3HOUC 1PJ5A 4BBSC 5C3EC 2E2IC 3FOFA 4C3IK 1XXAA 1YNJA 2JA6K 3S2DC 2E2HA 3AD8C 4A3IK 1TWFC 2PA8L 4AYBD 1PJ6A 1WSRA 3HKZD 2XCRB 3M3YC 1TWHC 5IYDC 4M1XA 4C2MC 1EFWA 2GSNA 3I4MK 2JH3A 3A8JA 2NVXC 1SFOA 2PHCB 2GAGC 5IOQA 2A68A 3LAPA 4KMDA 4P5BA 4C3HK 3S1NK 3GSIA 3RZDC 3S1MC 5JVOA 4A3GK 5M3MK 3GTJA 1HQMA 2NVTC 3SZZA 4XSXA 4KATA 2WAQL 4A3LK 3GTMK 2R7ZC 3GTQA 4KC6A 4WJ3M 2R92C 3HOYK 1VRQC 1WOSA 3M4OC
chains in the Genus database with same CATH topology
2V6SA 1RU0A 4C45A 2V6TA 2V6UA 4LOWA 3JSTA 1USMA 1F93A 2EBBA 1DCPA 1USOA 1DCOA 3HXAA 4WILA 1DCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6S A;  1RU0 A;  4C45 A;  2V6T A;  2V6U A;  4LOW A;  3JST A;  1USM A;  1F93 A;  2EBB A;  1DCP A;  1USO A;  1DCO A;  3HXA A;  4WIL A;  1DCH A; 
#chains in the Genus database with same CATH topology
 3CAG A;  4A3F K;  4A3B C;  3GEE A;  1B4B A;  1WCM K;  1F93 A;  5HL8 A;  4AH6 A;  4A3K C;  3HOW C;  1IW7 A;  2XCQ A;  3ADA C;  5C4J C;  1O26 A;  3HOU K;  4BBS K;  5C3E K;  3GTL A;  2E2I K;  1Y1W A;  4OIN A;  3OEP A;  3S2D K;  3N3Y A;  4GTF A;  4A93 C;  3AQO A;  4FZB A;  1TWF K;  3GTK C;  3FHZ A;  3DXJ A;  1TWG A;  4KMH A;  4YFN A;  3RZO C;  5D4D A;  1IS1 A;  2B63 A;  3M3Y K;  1TWH K;  5IYD K;  1VGX A;  4C2M K;  4GZY A;  4LJZ A;  3AH5 A;  4A3E C;  2NVX K;  2R93 A;  2ZFZ A;  4QIW D;  1ZXO A;  2WAQ D;  2Y3P A;  1XZQ A;  3CQZ C;  3H0G C;  5IP9 C;  1WQF A;  4KM8 A;  1TWC A;  3RZD K;  3S1M K;  2E2J C;  4Q5S A;  2NVT K;  3V4G A;  2PPB A;  1TWG C;  1VJE A;  5TMF A;  3FKI A;  3S0X A;  2R7Z K;  2V6U A;  1EQR A;  2R92 K;  1DCP A;  4QJV B;  3M4O K;  1I3Q C;  1O25 A;  4A3B K;  1BDF A;  3OPF A;  2XCO A;  2JA7 A;  4RMF A;  4A3K K;  1L0W A;  3HOW K;  3VA7 A;  3GTG C;  5FJ8 K;  2NVY C;  5C4J K;  1ZVU A;  1G51 A;  1I50 A;  2NVQ C;  2ZUE A;  2JA5 C;  3GIR A;  4OIQ A;  3L4J A;  3PO2 C;  3BUE A;  4A93 K;  2RH6 A;  4FM9 A;  2FQO A;  3HOX C;  3GTK K;  3I4N C;  2A6E A;  3RZO K;  1TWA A;  4GTC A;  5L46 A;  3GTP A;  2RGR A;  4A3E K;  4A3J C;  2P5M A;  2WB1 L;  2GSO A;  3GDZ A;  4BY7 C;  4JK1 A;  1XXB A;  3CQZ K;  3H0G K;  3AD9 C;  5IP9 K;  1ISE A;  3GTO A;  4OIO A;  4XLP A;  1BJT A;  1EI6 A;  3S16 C;  4P5A A;  4G7H A;  4LLG A;  4YFK A;  1K83 C;  2E2J K;  4PAB A;  1Y1V C;  3JST A;  1J6V A;  2O5I A;  1TWG K;  5IYC C;  1J98 A;  2YU9 C;  3PO3 C;  3S14 C;  2O5J A;  2VUM A;  2CFA A;  1I3Q K;  2E2H C;  3S1Q C;  4G7Z A;  3H3V L;  3BP8 C;  2JA8 C;  1V5V A;  5CJ9 A;  3GTG K;  4XLN A;  2Y0S L;  4BLA A;  1B4A A;  1O24 A;  2NVY K;  1IBA A;  4BBR C;  1ZYR A;  2NVQ K;  1JQW A;  2JA5 K;  3S17 C;  1R9T A;  2GSU A;  1SFO C;  3PO2 K;  5M3F K;  3HOX K;  4LQY A;  1EH1 A;  3I4N K;  3GTJ C;  1BS2 A;  5FLM C;  2PA8 D;  4A3J K;  2KWA A;  4MQ9 A;  1VH2 A;  2V6S A;  3GTQ C;  4BY7 K;  1O27 A;  3TTG A;  2FQT A;  5C4X C;  3GEH A;  4BKW A;  3S16 K;  4Y52 C;  1K83 K;  4KN4 A;  1Y1V K;  3S1R C;  5IYC K;  3T00 A;  2YU9 K;  2A6H A;  3PO3 K;  2JA6 A;  3Q3Q A;  3GTL C;  4GFQ A;  3S14 K;  1Y1W C;  3BP3 A;  4C3J C;  1C0A A;  3S1Q K;  2E2H K;  5IOT A;  4WJ4 A;  1F7V A;  3G4A A;  2JA8 K;  3TFH A;  5TMC A;  2P8T A;  1YCL A;  1XPP A;  4BBR K;  4KMU A;  1DD5 A;  2B63 C;  3S17 K;  5TJ3 A;  2R93 C;  1SFO K;  1DCH A;  4LR2 A;  5JFE A;  1IQ0 A;  5CHP A;  1O28 A;  4A3D C;  1O2B A;  1ZQ1 C;  2PMZ L;  3HOV C;  1IE0 A;  1TWC C;  1XZQ B;  4BXX C;  1XZP A;  3GTJ K;  5FLM K;  4GTB A;  3GTM A;  4C45 A;  3A8I A;  1GE9 A;  3FKI C;  3GTQ K;  3IPJ A;  5EGE A;  1WCM A;  4XSZ A;  4AYB L;  4J3N A;  5C4X K;  3AQP A;  3HKZ L;  4Y52 K;  2JA7 C;  1AB4 A;  4KB2 A;  1WQG A;  4GTD A;  4NOI A;  4KM9 A;  4X6A C;  2CW0 A;  2E2I A;  3S1R K;  4LK0 A;  1I50 C;  1HI9 A;  3LAJ A;  3GTL K;  5IYB C;  1YX2 A;  1F7U A;  1Y1W K;  4C3J K;  1KQ4 A;  5C44 C;  4MEY A;  4BLB A;  1WOP A;  1TWF A;  3GEI A;  5M5Y K;  1YNN A;  4WIL A;  1JVI A;  2BE5 A;  3EQL A;  1TWH A;  4LOW A;  4GTE A;  1WQH A;  1TWA C;  2NVX A;  3N0C A;  2B63 K;  3S15 C;  1I6H C;  3GTP C;  2D6F C;  2R93 K;  5IP7 C;  4ILD A;  3L4K A;  3GTO C;  2EBB A;  4A3D K;  4KN7 A;  3HOV K;  1TWC K;  4BXX K;  2V6T A;  1SMY A;  1O2A A;  2R7Z A;  3K7A C;  3QX3 A;  2R92 A;  3FKI K;  4Y7N C;  3N0B A;  2WB1 D;  2VUM C;  5EGH A;  5E68 A;  2JA7 K;  1WIH A;  2CFA B;  1DCO A;  4YG2 A;  4A3C C;  1I6V A;  4X6A K;  3TFI A;  4G0U A;  1UV7 A;  1I50 K;  4QIW L;  5IYB K;  1R9T C;  5C44 K;  4XCH A;  1XXC A;  4G0V A;  3GTK A;  1WSV A;  4GTL A;  1RU0 A;  3A8K A;  4KAR A;  4O2D A;  3H3V D;  1JOE A;  5IOS A;  4G0W A;  4KAW X;  3S2H C;  1TWA K;  1X31 C;  2Y0S D;  3WOD A;  3NUH A;  3S15 K;  4BY1 C;  1I6H K;  3GTP K;  4A3M C;  3HOZ C;  3CQZ A;  3H0G A;  3T02 A;  1BGW A;  4Q4Z A;  1F9N A;  1J6W A;  1WOR A;  4ZH4 A;  4KB4 A;  5IP7 K;  4OIP A;  3GTO K;  1INN A;  3TFJ A;  3ORE A;  5M5X K;  4LK1 A;  1J6X A;  3SZY A;  4YFX A;  2W7V A;  1EK8 A;  4QJV A;  4MEX A;  3K7A K;  4C3I C;  4P9S A;  2JA6 C;  1I3Q A;  4KDD A;  3ERE D;  4Y7N K;  4PAA A;  4A3I C;  1USO A;  2VUM K;  3GTG A;  3LPX A;  1ZBS A;  2NVY A;  1USM A;  3G4C A;  4A3C K;  4G7O A;  2JA5 A;  1VLO A;  3I4M C;  1IL2 A;  4OIR A;  2GAH C;  1WOO A;  1R9T K;  4C3H C;  3S1N C;  3HXA A;  3T01 A;  1O29 A;  4A3G C;  4GTA A;  2ZUF A;  5IOR A;  3S2H K;  5M5W K;  4BY1 K;  4KMA A;  4A3L C;  3GTM C;  1XZP B;  2A69 A;  4DDQ A;  4A3M K;  3HOZ K;  3HOY C;  3AD7 C;  4KAS A;  1PJ7 A;  4A3F C;  3MML B;  4GT9 A;  1WCM C;  1K83 A;  1O2F B;  1Y1V A;  3FOE A;  2YU9 A;  2PMZ D;  3HOU C;  1PJ5 A;  4BBS C;  5C3E C;  2E2I C;  3FOF A;  4C3I K;  1XXA A;  1YNJ A;  2JA6 K;  3S2D C;  2E2H A;  3AD8 C;  4A3I K;  1TWF C;  2PA8 L;  4AYB D;  1PJ6 A;  1WSR A;  3HKZ D;  2XCR B;  3M3Y C;  1TWH C;  5IYD C;  4M1X A;  4C2M C;  1EFW A;  2GSN A;  3I4M K;  2JH3 A;  3A8J A;  2NVX C;  1SFO A;  2PHC B;  2GAG C;  5IOQ A;  2A68 A;  3LAP A;  4KMD A;  4P5B A;  4C3H K;  3S1N K;  3GSI A;  3RZD C;  3S1M C;  5JVO A;  4A3G K;  5M3M K;  3GTJ A;  1HQM A;  2NVT C;  3SZZ A;  4XSX A;  4KAT A;  2WAQ L;  4A3L K;  3GTM K;  2R7Z C;  3GTQ A;  4KC6 A;  4WJ3 M;  2R92 C;  3HOY K;  1VRQ C;  1WOS A;  3M4O C; 
#chains in the Genus database with same CATH homology
 2V6S A;  1RU0 A;  4C45 A;  2V6T A;  2V6U A;  4LOW A;  3JST A;  1USM A;  1F93 A;  2EBB A;  1DCP A;  1USO A;  1DCO A;  3HXA A;  4WIL A;  1DCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...