2V6SA

Medium resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
total genus 29
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6sA00
1DCPA 1DCOA 2V6TA 3JSTA 1USOA 3HXAA 2V6SA 4WILA 2EBBA 4C45A 4LOWA 1DCHA 1F93A 1USMA 2V6UA 1RU0A
chains in the Genus database with same CATH superfamily
2WAQL 4XLNA 3PO2K 3GIRA 4BXXK 4GTAA 1WQFA 4GTBA 2P5MA 1GE9A 2CFAB 1X31C 3S0XA 3HOUK 1O28A 1RU0A 3GTPC 4KAWX 3BP3A 3HOYC 1XXBA 4PABA 3S1MC 1INNA 1WCMC 3AD8C 3S15C 3FKIC 1XPPA 3GTJK 4A3CC 3CQZC 3L4JA 2WAQD 3GTLC 1WOSA 1F9NA 5E68A 1TWHK 4KASA 4QIWL 3TFHA 5IYDK 1I6HC 2Y3PA 4BXXC 4A3LK 4XSXA 1L0WA 4AYBL 4LOWA 4YG2A 3T00A 1YX2A 3I4MK 3GTKK 1WOOA 1IW7A 3S1MK 2B63K 1YNNA 2XCOA 3PO2C 1IBAA 4MEXA 1I6VA 4KM8A 4QIWD 1Y1VC 4BY1K 1SMYA 2R93K 3SZYA 2GAGC 1EH1A 3HOYK 4A3DK 1J6VA 1F93A 4A3IC 1ZVUA 4G7ZA 2PMZL 3FOFA 1O26A 2ZUFA 1EK8A 3DXJA 4Q5SA 2XCRB 3HOZK 1Y1WA 2NVXK 4A3KC 5TJ3A 1WQGA 3CAGA 1F7VA 1TWFA 4FZBA 4KMUA 3OREA 3TFIA 1TWCC 4A3EK 3M3YC 5IP7C 2O5JA 3S2DC 4BY1C 3HKZL 3RZDK 1I6HK 5M5WK 1USMA 3VA7A 4A3IK 1XXAA 2GSUA 3A8IA 3CQZK 1VH2A 5C4XC 3S15K 1TWHC 4WILA 3OEPA 1SFOC 1BS2A 3A8JA 5EGEA 2Y0SL 4BBRC 1XZQB 3GEEA 1TWAC 1ZBSA 3HKZD 2PMZD 3SZZA 4KARA 1WSRA 3GTQC 4PAAA 2V6UA 2GSNA 3I4MC 2NVYC 2O5IA 4AYBD 5JVOA 2VUMC 1JQWA 4A3FK 3GTLA 2A68A 2ZUEA 2JA5K 1VRQC 4Q4ZA 2JA7A 1HQMA 1KQ4A 2PHCB 1WCMK 4GTDA 3HXAA 3LAPA 4A3EC 1G51A 1R9TC 1EFWA 2JH3A 2GSOA 2JA8C 5IYCC 5C44K 1TWFK 2NVXC 1TWCA 2WB1L 5D4DA 5M5XK 3BUEA 3GTOK 3N0BA 3S2HC 4OINA 1UV7A 3S1RK 1ZXOA 1IE0A 3GTGK 4KMHA 5FJ8K 2E2HK 1V5VA 1R9TA 3GSIA 3H0GK 3K7AC 2P8TA 1I50C 3N0CA 1O2AA 3S1QC 3S17K 4A3DC 3AQOA 4KMDA 3A8KA 2Y0SD 3S16K 5IYBC 1TWGA 3HOVC 2E2JC 3S14C 4A3GK 2PA8D 2D6FC 5FLMC 4KN7A 2E2IK 3GTQA 3WODA 5C3EK 3I4NC 1BGWA 4WJ4A 3S1NC 1K83K 1TWAK 1TWHA 2YU9K 2A69A 5C4JK 1B4AA 2W7VA 4LQYA 1IS1A 1VLOA 4C45A 3ERED 4J3NA 4BLBA 3AH5A 1AB4A 1JVIA 2NVQC 1O2FB 1ISEA 3RZOC 5IYDC 3FHZA 3TTGA 2WB1D 1WORA 3GTMC 1JOEA 5M3MK 3MMLB 3H0GC 2JA7C 1ZYRA 2CW0A 4G7OA 3FKIK 3OPFA 4GTCA 5IP7K 3ADAC 3GTOA 3S1QK 5TMFA 2R93A 1DCPA 4BBSK 5IOTA 3FOEA 4G7HA 1R9TK 5IP9C 2E2JK 4YFKA 4A3GC 1DD5A 1B4BA 4XLPA 3GTPA 4BY7C 3PO3K 3AQPA 4Y52C 1TWFC 4LR2A 4GFQA 1IQ0A 2V6TA 4KDDA 1TWGC 3V4GA 2A6EA 4Y7NK 4FM9A 4G0WA 4LJZA 3GEHA 2VUMK 1I50A 2R92K 2NVYK 3EQLA 4KN4A 2E2IA 5L46A 4C3HK 1XXCA 4OIQA 1Y1VA 4LK1A 3GTQK 3M4OC 4A3JK 4C3JK 1F7UA 4KATA 3TFJA 1O2BA 3AD9C 2JA6C 3T02A 3GTGC 2YU9A 4BY7K 3QX3A 2JA8K 4A3MC 1WIHA 3BP8C 4C2MK 1VGXA 3L4KA 4LK0A 2NVTK 2PA8L 1EQRA 3I4NK 1ZQ1C 3HOXC 1PJ5A 4G0VA 1WOPA 4P5AA 2KWAA 4Y52K 1PJ7A 2R7ZC 4GTFA 4MEYA 1O29A 3GTMK 2NVQK 3HOVK 3S14K 1I3QK 2YU9C 5C4XK 3FKIA 1J6XA 2XCQA 2RH6A 3LPXA 4BBRK 4AH6A 4YFXA 3LAJA 4C3IK 5M5YK 3RZDC 1K83C 1XZPA 4YFNA 3HOWC 1I3QC 2ZFZA 2FQTA 5IYBK 1XZQA 1SFOA 2R7ZK 3IPJA 2JA7K 5C3EC 5JFEA 3K7AK 5IYCK 1J6WA 4BKWA 3G4AA 4ZH4A 4BLAA 3RZOK 1VJEA 2NVTC 4JK1A 2CFAA 1I50K 3H3VD 2R92A 2R93C 4A3BC 1J98A 1TWCK 5FLMK 4KC6A 1HI9A 4O2DA 4OIOA 2JA6K 3GTGA 3T01A 4A93C 1O27A 5TMCA 4DDQA 2E2HA 3S1NK 3H3VL 5CJ9A 5IP9K 4A3MK 3H0GA 5IOSA 1WSVA 4ILDA 3N3YA 4QJVB 4OIPA 3GTOC 2RGRA 2E2HC 1TWGK 3S1RC 1Y1WK 1YNJA 4C3JC 2NVXA 4A3BK 4KB4A 3PO3C 3S2HK 4C3HC 3M4OK 1DCHA 3S17C 2B63C 2GAHC 2FQOA 2R92C 2V6SA 3GTMA 1BJTA 1I3QA 1IL2A 4BBSC 1K83A 1DCOA 1TWAA 1C0AA 1O24A 1XZPB 5C4JC 4KB2A 3S2DK 4RMFA 3HOWK 4G0UA 1EI6A 3NUHA 3GEIA 3CQZA 4C3IC 1SFOK 2R7ZA 3JSTA 2EBBA 3GTKC 3GTJA 4M1XA 5IORA 3AD7C 4P9SA 1WQHA 1YCLA 3GDZA 4A3LC 4NOIA 4GT9A 1O25A 1USOA 3HOXK 4A3CK 4GTEA 3S16C 3M3YK 2JA6A 4A3KK 4C2MC 4X6AK 3G4CA 3Q3QA 2PPBA 3GTLK 5EGHA 3HOZC 1Y1WC 2JA5A 2E2IC 3GTJC 3GTKA 4XSZA 3GTPK 1BDFA 1WCMA 4XCHA 2A6HA 2B63A 3HOUC 4KMAA 4OIRA 1PJ6A 4A3JC 5HL8A 4LLGA 4QJVA 4GZYA 4X6AC 4WJ3M 2VUMA 4MQ9A 4P5BA 4A93K 2NVYA 5C44C 5IOQA 4KM9A 4GTLA 5CHPA 1Y1VK 2JA5C 4Y7NC 2BE5A 5M3FK 4A3FC
chains in the Genus database with same CATH topology
1DCPA 1DCOA 2V6TA 3JSTA 1USOA 3HXAA 2V6SA 4WILA 2EBBA 4C45A 4LOWA 1DCHA 1F93A 1USMA 2V6UA 1RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  1DCO A;  2V6T A;  3JST A;  1USO A;  3HXA A;  2V6S A;  4WIL A;  2EBB A;  4C45 A;  4LOW A;  1DCH A;  1F93 A;  1USM A;  2V6U A;  1RU0 A; 
#chains in the Genus database with same CATH topology
 2WAQ L;  4XLN A;  3PO2 K;  3GIR A;  4BXX K;  4GTA A;  1WQF A;  4GTB A;  2P5M A;  1GE9 A;  2CFA B;  1X31 C;  3S0X A;  3HOU K;  1O28 A;  1RU0 A;  3GTP C;  4KAW X;  3BP3 A;  3HOY C;  1XXB A;  4PAB A;  3S1M C;  1INN A;  1WCM C;  3AD8 C;  3S15 C;  3FKI C;  1XPP A;  3GTJ K;  4A3C C;  3CQZ C;  3L4J A;  2WAQ D;  3GTL C;  1WOS A;  1F9N A;  5E68 A;  1TWH K;  4KAS A;  4QIW L;  3TFH A;  5IYD K;  1I6H C;  2Y3P A;  4BXX C;  4A3L K;  4XSX A;  1L0W A;  4AYB L;  4LOW A;  4YG2 A;  3T00 A;  1YX2 A;  3I4M K;  3GTK K;  1WOO A;  1IW7 A;  3S1M K;  2B63 K;  1YNN A;  2XCO A;  3PO2 C;  1IBA A;  4MEX A;  1I6V A;  4KM8 A;  4QIW D;  1Y1V C;  4BY1 K;  1SMY A;  2R93 K;  3SZY A;  2GAG C;  1EH1 A;  3HOY K;  4A3D K;  1J6V A;  1F93 A;  4A3I C;  1ZVU A;  4G7Z A;  2PMZ L;  3FOF A;  1O26 A;  2ZUF A;  1EK8 A;  3DXJ A;  4Q5S A;  2XCR B;  3HOZ K;  1Y1W A;  2NVX K;  4A3K C;  5TJ3 A;  1WQG A;  3CAG A;  1F7V A;  1TWF A;  4FZB A;  4KMU A;  3ORE A;  3TFI A;  1TWC C;  4A3E K;  3M3Y C;  5IP7 C;  2O5J A;  3S2D C;  4BY1 C;  3HKZ L;  3RZD K;  1I6H K;  5M5W K;  1USM A;  3VA7 A;  4A3I K;  1XXA A;  2GSU A;  3A8I A;  3CQZ K;  1VH2 A;  5C4X C;  3S15 K;  1TWH C;  4WIL A;  3OEP A;  1SFO C;  1BS2 A;  3A8J A;  5EGE A;  2Y0S L;  4BBR C;  1XZQ B;  3GEE A;  1TWA C;  1ZBS A;  3HKZ D;  2PMZ D;  3SZZ A;  4KAR A;  1WSR A;  3GTQ C;  4PAA A;  2V6U A;  2GSN A;  3I4M C;  2NVY C;  2O5I A;  4AYB D;  5JVO A;  2VUM C;  1JQW A;  4A3F K;  3GTL A;  2A68 A;  2ZUE A;  2JA5 K;  1VRQ C;  4Q4Z A;  2JA7 A;  1HQM A;  1KQ4 A;  2PHC B;  1WCM K;  4GTD A;  3HXA A;  3LAP A;  4A3E C;  1G51 A;  1R9T C;  1EFW A;  2JH3 A;  2GSO A;  2JA8 C;  5IYC C;  5C44 K;  1TWF K;  2NVX C;  1TWC A;  2WB1 L;  5D4D A;  5M5X K;  3BUE A;  3GTO K;  3N0B A;  3S2H C;  4OIN A;  1UV7 A;  3S1R K;  1ZXO A;  1IE0 A;  3GTG K;  4KMH A;  5FJ8 K;  2E2H K;  1V5V A;  1R9T A;  3GSI A;  3H0G K;  3K7A C;  2P8T A;  1I50 C;  3N0C A;  1O2A A;  3S1Q C;  3S17 K;  4A3D C;  3AQO A;  4KMD A;  3A8K A;  2Y0S D;  3S16 K;  5IYB C;  1TWG A;  3HOV C;  2E2J C;  3S14 C;  4A3G K;  2PA8 D;  2D6F C;  5FLM C;  4KN7 A;  2E2I K;  3GTQ A;  3WOD A;  5C3E K;  3I4N C;  1BGW A;  4WJ4 A;  3S1N C;  1K83 K;  1TWA K;  1TWH A;  2YU9 K;  2A69 A;  5C4J K;  1B4A A;  2W7V A;  4LQY A;  1IS1 A;  1VLO A;  4C45 A;  3ERE D;  4J3N A;  4BLB A;  3AH5 A;  1AB4 A;  1JVI A;  2NVQ C;  1O2F B;  1ISE A;  3RZO C;  5IYD C;  3FHZ A;  3TTG A;  2WB1 D;  1WOR A;  3GTM C;  1JOE A;  5M3M K;  3MML B;  3H0G C;  2JA7 C;  1ZYR A;  2CW0 A;  4G7O A;  3FKI K;  3OPF A;  4GTC A;  5IP7 K;  3ADA C;  3GTO A;  3S1Q K;  5TMF A;  2R93 A;  1DCP A;  4BBS K;  5IOT A;  3FOE A;  4G7H A;  1R9T K;  5IP9 C;  2E2J K;  4YFK A;  4A3G C;  1DD5 A;  1B4B A;  4XLP A;  3GTP A;  4BY7 C;  3PO3 K;  3AQP A;  4Y52 C;  1TWF C;  4LR2 A;  4GFQ A;  1IQ0 A;  2V6T A;  4KDD A;  1TWG C;  3V4G A;  2A6E A;  4Y7N K;  4FM9 A;  4G0W A;  4LJZ A;  3GEH A;  2VUM K;  1I50 A;  2R92 K;  2NVY K;  3EQL A;  4KN4 A;  2E2I A;  5L46 A;  4C3H K;  1XXC A;  4OIQ A;  1Y1V A;  4LK1 A;  3GTQ K;  3M4O C;  4A3J K;  4C3J K;  1F7U A;  4KAT A;  3TFJ A;  1O2B A;  3AD9 C;  2JA6 C;  3T02 A;  3GTG C;  2YU9 A;  4BY7 K;  3QX3 A;  2JA8 K;  4A3M C;  1WIH A;  3BP8 C;  4C2M K;  1VGX A;  3L4K A;  4LK0 A;  2NVT K;  2PA8 L;  1EQR A;  3I4N K;  1ZQ1 C;  3HOX C;  1PJ5 A;  4G0V A;  1WOP A;  4P5A A;  2KWA A;  4Y52 K;  1PJ7 A;  2R7Z C;  4GTF A;  4MEY A;  1O29 A;  3GTM K;  2NVQ K;  3HOV K;  3S14 K;  1I3Q K;  2YU9 C;  5C4X K;  3FKI A;  1J6X A;  2XCQ A;  2RH6 A;  3LPX A;  4BBR K;  4AH6 A;  4YFX A;  3LAJ A;  4C3I K;  5M5Y K;  3RZD C;  1K83 C;  1XZP A;  4YFN A;  3HOW C;  1I3Q C;  2ZFZ A;  2FQT A;  5IYB K;  1XZQ A;  1SFO A;  2R7Z K;  3IPJ A;  2JA7 K;  5C3E C;  5JFE A;  3K7A K;  5IYC K;  1J6W A;  4BKW A;  3G4A A;  4ZH4 A;  4BLA A;  3RZO K;  1VJE A;  2NVT C;  4JK1 A;  2CFA A;  1I50 K;  3H3V D;  2R92 A;  2R93 C;  4A3B C;  1J98 A;  1TWC K;  5FLM K;  4KC6 A;  1HI9 A;  4O2D A;  4OIO A;  2JA6 K;  3GTG A;  3T01 A;  4A93 C;  1O27 A;  5TMC A;  4DDQ A;  2E2H A;  3S1N K;  3H3V L;  5CJ9 A;  5IP9 K;  4A3M K;  3H0G A;  5IOS A;  1WSV A;  4ILD A;  3N3Y A;  4QJV B;  4OIP A;  3GTO C;  2RGR A;  2E2H C;  1TWG K;  3S1R C;  1Y1W K;  1YNJ A;  4C3J C;  2NVX A;  4A3B K;  4KB4 A;  3PO3 C;  3S2H K;  4C3H C;  3M4O K;  1DCH A;  3S17 C;  2B63 C;  2GAH C;  2FQO A;  2R92 C;  2V6S A;  3GTM A;  1BJT A;  1I3Q A;  1IL2 A;  4BBS C;  1K83 A;  1DCO A;  1TWA A;  1C0A A;  1O24 A;  1XZP B;  5C4J C;  4KB2 A;  3S2D K;  4RMF A;  3HOW K;  4G0U A;  1EI6 A;  3NUH A;  3GEI A;  3CQZ A;  4C3I C;  1SFO K;  2R7Z A;  3JST A;  2EBB A;  3GTK C;  3GTJ A;  4M1X A;  5IOR A;  3AD7 C;  4P9S A;  1WQH A;  1YCL A;  3GDZ A;  4A3L C;  4NOI A;  4GT9 A;  1O25 A;  1USO A;  3HOX K;  4A3C K;  4GTE A;  3S16 C;  3M3Y K;  2JA6 A;  4A3K K;  4C2M C;  4X6A K;  3G4C A;  3Q3Q A;  2PPB A;  3GTL K;  5EGH A;  3HOZ C;  1Y1W C;  2JA5 A;  2E2I C;  3GTJ C;  3GTK A;  4XSZ A;  3GTP K;  1BDF A;  1WCM A;  4XCH A;  2A6H A;  2B63 A;  3HOU C;  4KMA A;  4OIR A;  1PJ6 A;  4A3J C;  5HL8 A;  4LLG A;  4QJV A;  4GZY A;  4X6A C;  4WJ3 M;  2VUM A;  4MQ9 A;  4P5B A;  4A93 K;  2NVY A;  5C44 C;  5IOQ A;  4KM9 A;  4GTL A;  5CHP A;  1Y1V K;  2JA5 C;  4Y7N C;  2BE5 A;  5M3F K;  4A3F C; 
#chains in the Genus database with same CATH homology
 1DCP A;  1DCO A;  2V6T A;  3JST A;  1USO A;  3HXA A;  2V6S A;  4WIL A;  2EBB A;  4C45 A;  4LOW A;  1DCH A;  1F93 A;  1USM A;  2V6U A;  1RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...