2V6SA

Medium resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MAPLARLAANSARLLQLHKTVPQWHLTDGHLSIKRKFQFSDFNEAWGFMSRVALYADKVDHHPNWYNVYNTVDVELSTHDAAGLTEKDFALAKFMDDAAKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Toxoplasma Gondii Pterin-4A-Carbinolamine Dehydratase and Comparisons with Mammalian and Parasite Orthologues.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Lyase
molecule keywords PTERIN-4A-CARBINOLAMINE DEHYDRATASE
total genus 29
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 2v6sA00
1DCPA 1F93A 4WILA 2EBBA 2V6TA 2V6UA 1DCOA 1RU0A 2V6SA 1USMA 3HXAA 4LOWA 4C45A 3JSTA 1DCHA 1USOA
chains in the Genus database with same CATH superfamily
3RZOC 3T02A 3A8IA 1PJ5A 4YFKA 2ZUFA 3HOYC 5M3FK 4A3GK 1PJ6A 4GTBA 2PA8L 1TWFC 1WSRA 4PABA 1Y1VC 3GTQK 4A3CC 2P8TA 3T00A 5HL8A 4C3IK 3DXJA 4KMAA 5C4JC 4XCHA 1F7VA 2WAQD 3S1MC 3Q3QA 4QJVB 3HOUK 3I4MC 4QIWD 1Y1WK 2V6TA 4GTCA 2FQTA 3N0BA 4Y52C 2NVQK 1Y1WC 4BBRC 4BY1K 2YU9A 4G7HA 3SZYA 1WIHA 2W7VA 4G0WA 4BBRK 4BY1C 4G0VA 2JA5K 4A3BC 1WCMC 4RMFA 1ZQ1C 2VUMK 1WOSA 3JSTA 1TWAK 2Y3PA 3FKIC 4A3LK 1O24A 2XCQA 4KB4A 3RZOK 4XSZA 4BY7C 1XZPA 4A3KC 1O2BA 1IL2A 4BLAA 3G4AA 4A3KK 2PMZD 1O27A 2EBBA 1IW7A 3S14C 1IBAA 2JA6C 3FOEA 5C4JK 2RGRA 2NVYK 3TTGA 1ZVUA 3GTOA 3GEHA 3HOVC 3LPXA 2NVQC 1ZYRA 1IQ0A 1R9TA 2O5JA 1UV7A 3GTGK 1I6VA 4KN4A 2NVTC 5EGEA 3GTPA 3GTGC 2VUMA 5TJ3A 4G0UA 1TWAA 2CW0A 4GTEA 4KM8A 3S1MK 3S17C 1HI9A 1SFOK 4OIQA 3M3YC 1SFOC 4KC6A 3FKIK 1XXCA 3M3YK 1BJTA 1I6HC 4A3DK 3IPJA 2R92A 3S1RK 1K83A 4X6AC 3HOXC 5FLMK 3HOXK 1ISEA 3GTKK 3TFJA 3GTMK 3HXAA 4M1XA 4AYBL 3S16C 3S1NC 2R93K 2E2IK 3GTPC 2JA8C 1VJEA 1IE0A 1TWFK 2NVYA 4A93C 4KARA 4MEYA 4QJVA 1F93A 4C2MC 4Q4ZA 4GTFA 3FHZA 3GTLA 1YNNA 3EQLA 1DCHA 4Y52K 2NVXK 4P5AA 3LAJA 3H3VL 5D4DA 3HOZC 3GTQA 2CFAB 1WQGA 3HOZK 3GDZA 1J6VA 4A3FC 4C3JC 5M5WK 1C0AA 1F9NA 3CQZC 1JQWA 3M4OK 3S17K 1WQFA 4GTLA 4FM9A 5C4XC 4LOWA 1DCPA 4A3EC 3GIRA 2O5IA 5FJ8K 1TWAC 3GTJK 3S1QK 2KWAA 3V4GA 3TFIA 3A8JA 1VRQC 2GSNA 4WILA 5CJ9A 3AQPA 2R92C 4XLNA 3PO3C 4KAWX 4C2MK 2NVXA 5IP9C 4A3MC 1B4AA 1XPPA 5TMCA 3HOWC 1YX2A 4KN7A 3BP8C 1YNJA 4A3JC 2JA7C 3OPFA 3HOWK 5IOTA 2E2IC 1TWFA 2R7ZA 2JA7K 4G7ZA 1I3QK 3HKZL 4GT9A 4C45A 4MQ9A 3I4NC 2E2HC 5IYDC 2V6SA 1BS2A 1O26A 2XCOA 4A3BK 3S2HC 2RH6A 5IOQA 1B4BA 1USMA 1I50K 2B63C 4KASA 4P5BA 2YU9C 4KDDA 1Y1VA 1I3QA 1J6XA 3FKIA 2D6FC 1EK8A 2PHCB 5L46A 1IS1A 1K83K 4A3CK 2E2HA 1DCOA 2P5MA 3HOYK 4A3GC 3S14K 3L4KA 2GAHC 3I4NK 2JA6A 1VLOA 3AD8C 1TWCA 3L4JA 1WORA 4WJ4A 1EQRA 1O2AA 3LAPA 4A3IC 5IP7C 2E2IA 5C44C 1O29A 3H0GC 1O25A 3S2DC 5C44K 1I3QC 2GSUA 4OIOA 4LK0A 3S2DK 3GTJA 4KM9A 2E2HK 5C4XK 4C3JK 4X6AK 1TWGA 1XXAA 3AQOA 3GTOK 1I50C 1L0WA 4BY7K 1TWHC 4BXXC 5IYBK 4LK1A 1J6WA 4A3DC 1J98A 1K83C 3NUHA 4FZBA 4KMHA 4AYBD 3GTPK 1WOPA 2R92K 2R93A 4WJ3M 4LR2A 4A93K 3A8KA 4LQYA 4C3IC 4O2DA 3GTMC 2JA5A 3BUEA 4AH6A 3HOVK 4Q5SA 3RZDC 4A3MK 3OREA 2A6EA 3BP3A 1EI6A 4JK1A 2BE5A 1TWGC 5CHPA 4A3FK 1WQHA 4MEXA 3N3YA 1TWGK 3CQZK 4GZYA 3S2HK 2PA8D 4A3IK 5C3EC 4ZH4A 2NVXC 1X31C 3AD7C 3QX3A 3MMLB 5IYBC 2WAQL 1BGWA 1PJ7A 5JFEA 4QIWL 3H3VD 1R9TC 3CAGA 4GFQA 4KMDA 2JA5C 1R9TK 2A6HA 4LLGA 2VUMC 3GTGA 3GTLC 1VGXA 4G7OA 2ZUEA 1O28A 4DDQA 4P9SA 4XLPA 4A3LC 4BXXK 3GSIA 3GTKC 3SZZA 2ZFZA 1KQ4A 1TWCC 1YCLA 1EFWA 2PMZL 3S16K 3S1NK 1AB4A 2V6UA 4C3HK 2R93C 3CQZA 2WB1D 2PPBA 4KB2A 1HQMA 1WSVA 3N0CA 4Y7NC 3PO2C 3S15C 5IYDK 4J3NA 3AH5A 3S15K 5IOSA 3S0XA 3RZDK 3H0GK 4A3JK 2CFAA 1DD5A 4PAAA 3GTMA 2E2JC 1USOA 3TFHA 1I50A 2GAGC 2NVTK 2JH3A 1XZQB 3OEPA 1WCMK 3HKZD 4LJZA 5C3EK 3GTKA 4BBSK 1Y1WA 1TWHK 2B63K 1BDFA 4YFXA 1G51A 1ZXOA 2R7ZK 3GTOC 2YU9K 2JA7A 3H0GA 5IYCC 2Y0SL 2R7ZC 4KMUA 1GE9A 4YFNA 5EGHA 4BLBA 5M3MK 1Y1VK 3VA7A 3PO3K 3ADAC 1O2FB 3GTLK 2WB1L 1EH1A 1ZBSA 2NVYC 4Y7NK 3ERED 5IORA 4XSXA 1JVIA 3WODA 2JA6K 1XXBA 3AD9C 1TWCK 2FQOA 1TWHA 4OIRA 2XCRB 2JA8K 5TMFA 4C3HC 3GTQC 1WOOA 5M5YK 1WCMA 4BKWA 1F7UA 3G4CA 4KATA 3K7AK 4NOIA 4GTDA 3PO2K 3K7AC 1SMYA 3FOFA 1JOEA 3M4OC 1V5VA 5IP7K 3HOUC 3I4MK 5E68A 4A3EK 1INNA 4YG2A 1I6HK 2E2JK 2A69A 4GTAA 3GEIA 1XZQA 2A68A 5JVOA 3GTJC 4OINA 3S1QC 5IYCK 3GEEA 2Y0SD 4ILDA 5M5XK 1XZPB 3T01A 2GSOA 1SFOA 1VH2A 2B63A 3S1RC 4BBSC 4OIPA 5FLMC 1RU0A 5IP9K
chains in the Genus database with same CATH topology
1DCPA 1F93A 4WILA 2EBBA 2V6TA 2V6UA 1DCOA 1RU0A 2V6SA 1USMA 3HXAA 4LOWA 4C45A 3JSTA 1DCHA 1USOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  1F93 A;  4WIL A;  2EBB A;  2V6T A;  2V6U A;  1DCO A;  1RU0 A;  2V6S A;  1USM A;  3HXA A;  4LOW A;  4C45 A;  3JST A;  1DCH A;  1USO A; 
#chains in the Genus database with same CATH topology
 3RZO C;  3T02 A;  3A8I A;  1PJ5 A;  4YFK A;  2ZUF A;  3HOY C;  5M3F K;  4A3G K;  1PJ6 A;  4GTB A;  2PA8 L;  1TWF C;  1WSR A;  4PAB A;  1Y1V C;  3GTQ K;  4A3C C;  2P8T A;  3T00 A;  5HL8 A;  4C3I K;  3DXJ A;  4KMA A;  5C4J C;  4XCH A;  1F7V A;  2WAQ D;  3S1M C;  3Q3Q A;  4QJV B;  3HOU K;  3I4M C;  4QIW D;  1Y1W K;  2V6T A;  4GTC A;  2FQT A;  3N0B A;  4Y52 C;  2NVQ K;  1Y1W C;  4BBR C;  4BY1 K;  2YU9 A;  4G7H A;  3SZY A;  1WIH A;  2W7V A;  4G0W A;  4BBR K;  4BY1 C;  4G0V A;  2JA5 K;  4A3B C;  1WCM C;  4RMF A;  1ZQ1 C;  2VUM K;  1WOS A;  3JST A;  1TWA K;  2Y3P A;  3FKI C;  4A3L K;  1O24 A;  2XCQ A;  4KB4 A;  3RZO K;  4XSZ A;  4BY7 C;  1XZP A;  4A3K C;  1O2B A;  1IL2 A;  4BLA A;  3G4A A;  4A3K K;  2PMZ D;  1O27 A;  2EBB A;  1IW7 A;  3S14 C;  1IBA A;  2JA6 C;  3FOE A;  5C4J K;  2RGR A;  2NVY K;  3TTG A;  1ZVU A;  3GTO A;  3GEH A;  3HOV C;  3LPX A;  2NVQ C;  1ZYR A;  1IQ0 A;  1R9T A;  2O5J A;  1UV7 A;  3GTG K;  1I6V A;  4KN4 A;  2NVT C;  5EGE A;  3GTP A;  3GTG C;  2VUM A;  5TJ3 A;  4G0U A;  1TWA A;  2CW0 A;  4GTE A;  4KM8 A;  3S1M K;  3S17 C;  1HI9 A;  1SFO K;  4OIQ A;  3M3Y C;  1SFO C;  4KC6 A;  3FKI K;  1XXC A;  3M3Y K;  1BJT A;  1I6H C;  4A3D K;  3IPJ A;  2R92 A;  3S1R K;  1K83 A;  4X6A C;  3HOX C;  5FLM K;  3HOX K;  1ISE A;  3GTK K;  3TFJ A;  3GTM K;  3HXA A;  4M1X A;  4AYB L;  3S16 C;  3S1N C;  2R93 K;  2E2I K;  3GTP C;  2JA8 C;  1VJE A;  1IE0 A;  1TWF K;  2NVY A;  4A93 C;  4KAR A;  4MEY A;  4QJV A;  1F93 A;  4C2M C;  4Q4Z A;  4GTF A;  3FHZ A;  3GTL A;  1YNN A;  3EQL A;  1DCH A;  4Y52 K;  2NVX K;  4P5A A;  3LAJ A;  3H3V L;  5D4D A;  3HOZ C;  3GTQ A;  2CFA B;  1WQG A;  3HOZ K;  3GDZ A;  1J6V A;  4A3F C;  4C3J C;  5M5W K;  1C0A A;  1F9N A;  3CQZ C;  1JQW A;  3M4O K;  3S17 K;  1WQF A;  4GTL A;  4FM9 A;  5C4X C;  4LOW A;  1DCP A;  4A3E C;  3GIR A;  2O5I A;  5FJ8 K;  1TWA C;  3GTJ K;  3S1Q K;  2KWA A;  3V4G A;  3TFI A;  3A8J A;  1VRQ C;  2GSN A;  4WIL A;  5CJ9 A;  3AQP A;  2R92 C;  4XLN A;  3PO3 C;  4KAW X;  4C2M K;  2NVX A;  5IP9 C;  4A3M C;  1B4A A;  1XPP A;  5TMC A;  3HOW C;  1YX2 A;  4KN7 A;  3BP8 C;  1YNJ A;  4A3J C;  2JA7 C;  3OPF A;  3HOW K;  5IOT A;  2E2I C;  1TWF A;  2R7Z A;  2JA7 K;  4G7Z A;  1I3Q K;  3HKZ L;  4GT9 A;  4C45 A;  4MQ9 A;  3I4N C;  2E2H C;  5IYD C;  2V6S A;  1BS2 A;  1O26 A;  2XCO A;  4A3B K;  3S2H C;  2RH6 A;  5IOQ A;  1B4B A;  1USM A;  1I50 K;  2B63 C;  4KAS A;  4P5B A;  2YU9 C;  4KDD A;  1Y1V A;  1I3Q A;  1J6X A;  3FKI A;  2D6F C;  1EK8 A;  2PHC B;  5L46 A;  1IS1 A;  1K83 K;  4A3C K;  2E2H A;  1DCO A;  2P5M A;  3HOY K;  4A3G C;  3S14 K;  3L4K A;  2GAH C;  3I4N K;  2JA6 A;  1VLO A;  3AD8 C;  1TWC A;  3L4J A;  1WOR A;  4WJ4 A;  1EQR A;  1O2A A;  3LAP A;  4A3I C;  5IP7 C;  2E2I A;  5C44 C;  1O29 A;  3H0G C;  1O25 A;  3S2D C;  5C44 K;  1I3Q C;  2GSU A;  4OIO A;  4LK0 A;  3S2D K;  3GTJ A;  4KM9 A;  2E2H K;  5C4X K;  4C3J K;  4X6A K;  1TWG A;  1XXA A;  3AQO A;  3GTO K;  1I50 C;  1L0W A;  4BY7 K;  1TWH C;  4BXX C;  5IYB K;  4LK1 A;  1J6W A;  4A3D C;  1J98 A;  1K83 C;  3NUH A;  4FZB A;  4KMH A;  4AYB D;  3GTP K;  1WOP A;  2R92 K;  2R93 A;  4WJ3 M;  4LR2 A;  4A93 K;  3A8K A;  4LQY A;  4C3I C;  4O2D A;  3GTM C;  2JA5 A;  3BUE A;  4AH6 A;  3HOV K;  4Q5S A;  3RZD C;  4A3M K;  3ORE A;  2A6E A;  3BP3 A;  1EI6 A;  4JK1 A;  2BE5 A;  1TWG C;  5CHP A;  4A3F K;  1WQH A;  4MEX A;  3N3Y A;  1TWG K;  3CQZ K;  4GZY A;  3S2H K;  2PA8 D;  4A3I K;  5C3E C;  4ZH4 A;  2NVX C;  1X31 C;  3AD7 C;  3QX3 A;  3MML B;  5IYB C;  2WAQ L;  1BGW A;  1PJ7 A;  5JFE A;  4QIW L;  3H3V D;  1R9T C;  3CAG A;  4GFQ A;  4KMD A;  2JA5 C;  1R9T K;  2A6H A;  4LLG A;  2VUM C;  3GTG A;  3GTL C;  1VGX A;  4G7O A;  2ZUE A;  1O28 A;  4DDQ A;  4P9S A;  4XLP A;  4A3L C;  4BXX K;  3GSI A;  3GTK C;  3SZZ A;  2ZFZ A;  1KQ4 A;  1TWC C;  1YCL A;  1EFW A;  2PMZ L;  3S16 K;  3S1N K;  1AB4 A;  2V6U A;  4C3H K;  2R93 C;  3CQZ A;  2WB1 D;  2PPB A;  4KB2 A;  1HQM A;  1WSV A;  3N0C A;  4Y7N C;  3PO2 C;  3S15 C;  5IYD K;  4J3N A;  3AH5 A;  3S15 K;  5IOS A;  3S0X A;  3RZD K;  3H0G K;  4A3J K;  2CFA A;  1DD5 A;  4PAA A;  3GTM A;  2E2J C;  1USO A;  3TFH A;  1I50 A;  2GAG C;  2NVT K;  2JH3 A;  1XZQ B;  3OEP A;  1WCM K;  3HKZ D;  4LJZ A;  5C3E K;  3GTK A;  4BBS K;  1Y1W A;  1TWH K;  2B63 K;  1BDF A;  4YFX A;  1G51 A;  1ZXO A;  2R7Z K;  3GTO C;  2YU9 K;  2JA7 A;  3H0G A;  5IYC C;  2Y0S L;  2R7Z C;  4KMU A;  1GE9 A;  4YFN A;  5EGH A;  4BLB A;  5M3M K;  1Y1V K;  3VA7 A;  3PO3 K;  3ADA C;  1O2F B;  3GTL K;  2WB1 L;  1EH1 A;  1ZBS A;  2NVY C;  4Y7N K;  3ERE D;  5IOR A;  4XSX A;  1JVI A;  3WOD A;  2JA6 K;  1XXB A;  3AD9 C;  1TWC K;  2FQO A;  1TWH A;  4OIR A;  2XCR B;  2JA8 K;  5TMF A;  4C3H C;  3GTQ C;  1WOO A;  5M5Y K;  1WCM A;  4BKW A;  1F7U A;  3G4C A;  4KAT A;  3K7A K;  4NOI A;  4GTD A;  3PO2 K;  3K7A C;  1SMY A;  3FOF A;  1JOE A;  3M4O C;  1V5V A;  5IP7 K;  3HOU C;  3I4M K;  5E68 A;  4A3E K;  1INN A;  4YG2 A;  1I6H K;  2E2J K;  2A69 A;  4GTA A;  3GEI A;  1XZQ A;  2A68 A;  5JVO A;  3GTJ C;  4OIN A;  3S1Q C;  5IYC K;  3GEE A;  2Y0S D;  4ILD A;  5M5X K;  1XZP B;  3T01 A;  2GSO A;  1SFO A;  1VH2 A;  2B63 A;  3S1R C;  4BBS C;  4OIP A;  5FLM C;  1RU0 A;  5IP9 K; 
#chains in the Genus database with same CATH homology
 1DCP A;  1F93 A;  4WIL A;  2EBB A;  2V6T A;  2V6U A;  1DCO A;  1RU0 A;  2V6S A;  1USM A;  3HXA A;  4LOW A;  4C45 A;  3JST A;  1DCH A;  1USO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...