3GTMK

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtmK00
1YNNA 3HOWK 2R7ZK 4Y52K 3GTOC 3PO3C 1K83C 1Y1WC 5M5YK 1TWGC 4OINA 1Y1VC 5M3MK 3S2DK 1XPPA 3CQZC 4BBRC 4A3IC 3S1NK 5C44C 5IP9K 1WCMK 4Y7NK 2B63C 3S1QC 2PA8D 3HOUC 2Y0SL 1TWHC 4A3JC 2R93C 3HOYK 3I4MK 2NVTC 2JA6C 5C4XC 2PMZL 2O5JA 1I6HK 2E2IC 2O5IA 4QJVA 4YFXA 2PPBA 3RZOC 3GTPK 1R9TK 5M5XK 4NOIA 3EQLA 4A3GK 3S1MC 4BY1K 3S15C 3HOXK 1HQMA 4QIWD 4MEXA 5TMFA 3GTOK 3PO3K 4A93C 1K83K 1Y1WK 4A3LC 1TWGK 3GTKC 4C3IK 1Y1VK 4A3KC 4GZYA 3CQZK 3I4NC 4BBRK 4Q5SA 4A3IK 4A3MC 4BY7C 4BBSC 5C44K 1TWCC 4A3CC 2B63K 3GTMC 2WB1D 3HOUK 1SFOC 3S1QK 4G7OA 3GTLC 4A3DC 4G7ZA 3GTJC 3S17C 4XLNA 1TWHK 2PA8L 5C3EC 4A3JK 2BE5A 2WAQD 5C4XK 2NVTK 2JA6K 2WAQL 5FJ8K 2R93K 2E2HC 2R92C 3RZOK 3WODA 4C3HK 4KN7A 4A3BC 3S1MK 3RZDC 2NVQC 3S14C 3S15K 4XSXA 3HKZD 2JA7C 4A3LK 4A93K 4LLGA 1TWAC 4A3KK 3GTKK 4XSZA 4QIWL 2JA5C 5IYCC 3K7AC 2JA8C 3H3VD 3HOWC 3I4NK 3S1RC 3HOZC 4A3MK 4BXXC 4G7HA 4BBSK 4BY7K 5IP7C 1TWCK 4JK1A 1I50C 4A3CK 4Q4ZA 4OIOA 3GTMK 3H0GC 4C2MK 1IW7A 2A68A 1SFOK 3M3YC 3FKIC 5FLMC 5M3FK 3GTLK 3GTJK 2NVXC 3S17K 4A3DK 2WB1L 5C3EK 2NVYC 1BDFA 1TWFC 4OIQA 2VUMC 4YG2A 5IYDC 4X6AC 3S2HC 2E2HK 1I6VA 4YFKA 2R92K 4A3EC 1YNJA 4A3FC 2E2IK 3PO2C 2E2JC 3GTQC 3M4OC 4A3BK 1I3QC 3RZDK 2NVQK 3S14K 3S16C 1ZYRA 3GTGC 5IYBC 4LJZA 5C4JC 2A6EA 2JA7K 4XLPA 4KN4A 2YU9C 2CW0A 1TWAK 4MQ9A 4AYBD 4YFNA 3HOVC 3DXJA 2JA5K 3HKZL 3K7AK 5IYCK 2JA8K 3S1RK 3HOZK 4BXXK 5IP7K 4OIPA 1I50K 2R7ZC 4Y52C 3H3VL 3H0GK 3M3YK 3FKIK 5TMCA 5FLMK 2NVXK 4QJVB 3S2DC 2NVYK 2VUMK 1TWFK 3S1NC 2Y0SD 5IP9C 5IYDK 1WCMC 4X6AK 4Y7NC 3S2HK 4MEYA 1SMYA 5D4DA 4LK0A 4A3EK 4LK1A 2A69A 2PMZD 4A3FK 3PO2K 2E2JK 3GTQK 3M4OK 1I3QK 2A6HA 4OIRA 3S16K 4ZH4A 3GTGK 3HOYC 3I4MC 5IYBK 5C4JK 1I6HC 2YU9K 5M5WK 4C3JK 4KMUA 1R9TC 3GTPC 3HOVK 4A3GC 4BY1C 3HOXC 4AYBL
chains in the Genus database with same CATH superfamily
1ZBSA 3HOWK 3AQOA 5M5YK 4OINA 3H0GA 1X31C 1WQFA 2NVXA 1TWFA 4Y7NK 1UV7A 4DDQA 2ZFZA 2Y0SL 1EQRA 1B4BA 2JA6C 1I6HK 4ILDA 4QJVA 2O5IA 4C3HC 1R9TK 3EQLA 3N0BA 3AD7C 1O2AA 3PO3K 4A93C 1Y1WK 4G0UA 3GTKC 4WILA 4AH6A 1O25A 4A3IK 4A3MC 4BY7C 3CAGA 4A3CC 2B63K 1F93A 1WQHA 3HOUK 1VGXA 4KB2A 2VUMA 3S17C 4A3JK 3GDZA 1HI9A 2R92C 2ZUFA 1KQ4A 2ZUEA 3WODA 4A3BC 5EGEA 3A8IA 4XCHA 1TWAC 4QIWL 2JA5C 3HOWC 4G7OA 3I4NK 2GAHC 1XXBA 2R7ZA 1I50C 4OIOA 1EK8A 4C2MK 1SFOK 2A68A 3M3YC 4KB4A 3FKIC 5EGHA 5FLMC 1JOEA 1WORA 5C3EK 2FQTA 4WJ4A 3TFJA 4YG2A 5IYDC 4X6AC 3S2HC 1BGWA 2JA6A 4YFKA 4A3EC 1YNJA 1C0AA 1ZVUA 2E2IK 3PO2C 3RZDK 2NVQK 4KN4A 2CW0A 4KMAA 1J98A 4C3JC 5IOSA 3DXJA 5IYCK 4KMHA 3HOZK 4LQYA 5IP7K 4PABA 1JVIA 2VUMK 1V5VA 2W7VA 1WCMC 4MEYA 1SMYA 3N0CA 3LPXA 2GSUA 2FQOA 3V4GA 3GTQK 3M4OK 4OIRA 3I4MC 1WSRA 5M5WK 3GTPC 1TWAA 4A3GC 4BY1C 3HOXC 2R7ZK 4Y52K 3S0XA 4KAWX 1TWGC 4GTDA 4C3IC 1Y1VC 5M3MK 1I50A 2RH6A 3S2DK 1XPPA 3CQZC 3FKIA 3VA7A 1VRQC 4FM9A 5C44C 2PA8D 4C45A 1ISEA 3BP3A 2NVTC 2PMZL 3A8JA 3JSTA 2O5JA 2E2IC 1IE0A 2RGRA 2KWAA 1O24A 1WOSA 5E68A 4MEXA 4P9SA 3GTOK 1K83K 1J6WA 3MMLB 4GZYA 4G0WA 4A3KC 5JFEA 4BBRK 1XZPA 4BBSC 1RU0A 3GTMC 3S1QK 3ADAC 1O28A 1YX2A 3GTJC 4P5BA 3Q3QA 1TWHK 3TFHA 1J6VA 5C4XK 2R93K 2GSNA 4RMFA 2E2HC 3RZOK 1I3QA 4KN7A 3GTGA 3S1MK 3S15K 4XSXA 3G4CA 3T01A 4A3LK 3GEHA 3N3YA 2XCOA 2JA8C 1EI6A 1Y1VA 4GTBA 3S1RC 4G7HA 3CQZA 1TWCK 4KASA 3GTLK 4A3DK 2JH3A 4OIQA 2NVYC 1BDFA 1XZQB 1WSVA 4A3FC 3S16C 3S14K 1WQGA 1ZYRA 4G0VA 4J3NA 4LJZA 5C4JC 1O26A 2JA7K 2Y3PA 2YU9C 4GTFA 4AYBD 3HOVC 3OEPA 3K7AK 1BS2A 4BXXK 3H0GK 3GTMA 2NVXK 3GSIA 1TWFK 3GTJA 1ZQ1C 2XCRB 4GTAA 4Y7NC 1VLOA 5D4DA 4LK0A 1IBAA 2E2HA 4KDDA 5IOTA 2E2JK 1USOA 1I3QK 3AD8C 3ERED 3GTGK 5IYBK 1DCPA 5IOQA 1I6HC 1R9TC 1GE9A 3GTKA 3PO3C 1Y1WC 3QX3A 4A3IC 3S1NK 5IP9K 2NVYA 2B63C 1F7VA 3HOUC 3AD9C 3OPFA 4KM9A 3T00A 4A3JC 5HL8A 3HOYK 2R92A 1IS1A 4YFXA 4M1XA 1VH2A 5M5XK 1O27A 4BKWA 1WOPA 2JA5A 2CFAB 4GTLA 3I4NC 3HXAA 4PAAA 2WB1D 1SFOC 4C2MC 4WJ3M 1WOOA 2CFAA 2PA8L 5C3EC 2WAQD 2JA6K 2WAQL 4LOWA 4C3HK 3RZDC 2NVQC 3FOFA 3HKZD 4A93K 4LLGA 3GTKK 1Y1WA 5IYCC 3H3VD 3LAPA 3HOZC 4KMDA 4A3MK 4BY7K 5IP7C 4A3CK 4Q4ZA 3AQPA 3TTGA 2B63A 5M3FK 3S17K 1BJTA 1WCMA 2VUMC 1I6VA 2R92K 3M4OC 3GTQC 4A3BK 4KM8A 3BUEA 1B4AA 3GTPA 1JQWA 1TWAK 5CHPA 1AB4A 2V6UA 2JA5K 1TWGA 1I50K 2R7ZC 4Y52C 3M3YK 3FKIK 3NUHA 5FLMK 1SFOA 2GSOA 4QJVB 3S2DC 4BLAA 1INNA 2Y0SD 3FOEA 5IYDK 4GTEA 4X6AK 3GEEA 3S2HK 1O2FB 4A3EK 4LR2A 4LK1A 1J6XA 3PO2K 5L46A 2A6HA 2E2IA 1PJ5A 2P8TA 1F9NA 3GEIA 4C3JK 1PJ6A 1XZQA 4AYBL 1YNNA 3GTOC 1K83C 3OREA 4BBRC 1WIHA 5JVOA 1USMA 1WCMK 3S1QC 1XXCA 1TWHC 2R93C 3I4MK 5C4XC 3GTQA 4GFQA 3AH5A 3IPJA 2PPBA 2D6FC 3SZZA 3RZOC 3GTPK 4NOIA 4A3GK 3S1MC 4BY1K 3S15C 3HOXK 1HQMA 4QIWD 5TMFA 4A3LC 1TWGK 4GT9A 4C3IK 1Y1VK 3LAJA 3CQZK 1F7UA 4Q5SA 1EFWA 5C44K 1XXAA 1TWCC 3TFIA 3SZYA 1O29A 3GTLC 4A3DC 4G7ZA 1DCOA 4XLNA 2BE5A 3GIRA 2NVTK 5FJ8K 3T02A 3S14C 2GAGC 2YU9A 3A8KA 4KATA 2JA7C 4FZBA 4A3KK 1IQ0A 3GTOA 4XSZA 1K83A 4KARA 3FHZA 3K7AC 1IL2A 4BXXC 4BBSK 4JK1A 3GTMK 3H0GC 1IW7A 2V6SA 4BLBA 5CJ9A 3GTJK 2NVXC 2V6TA 2WB1L 4O2DA 1O2BA 1TWFC 1TWHA 1G51A 3BP8C 2R93A 2E2HK 1DD5A 2PHCB 2E2JC 1YCLA 1I3QC 2EBBA 3GTGC 5IYBC 2A6EA 1EH1A 1R9TA 4XLPA 4KC6A 4MQ9A 4YFNA 3HKZL 2P5MA 2JA8K 3S1RK 4OIPA 3G4AA 3H3VL 1TWCA 5TJ3A 5TMCA 3L4JA 3GTLA 2NVYK 2XCQA 3S1NC 5IP9C 4GTCA 2A69A 1L0WA 2PMZD 4A3FK 1PJ7A 5IORA 1VJEA 3S16K 4ZH4A 3HOYC 5C4JK 1XZPB 2YU9K 3L4KA 1DCHA 2JA7A 3HOVK 4KMUA 1ZXOA 4P5AA
chains in the Genus database with same CATH topology
1YNNA 3HOWK 2R7ZK 4Y52K 3GTOC 3PO3C 1K83C 1Y1WC 5M5YK 1TWGC 4OINA 1Y1VC 5M3MK 3S2DK 1XPPA 3CQZC 4BBRC 4A3IC 3S1NK 5C44C 5IP9K 1WCMK 4Y7NK 2B63C 3S1QC 2PA8D 3HOUC 2Y0SL 1TWHC 4A3JC 2R93C 3HOYK 3I4MK 2NVTC 2JA6C 5C4XC 2PMZL 2O5JA 1I6HK 2E2IC 2O5IA 4QJVA 4YFXA 2PPBA 3RZOC 3GTPK 1R9TK 5M5XK 4NOIA 3EQLA 4A3GK 3S1MC 4BY1K 3S15C 3HOXK 1HQMA 4QIWD 4MEXA 5TMFA 3GTOK 3PO3K 4A93C 1K83K 1Y1WK 4A3LC 1TWGK 3GTKC 4C3IK 1Y1VK 4A3KC 4GZYA 3CQZK 3I4NC 4BBRK 4Q5SA 4A3IK 4A3MC 4BY7C 4BBSC 5C44K 1TWCC 4A3CC 2B63K 3GTMC 2WB1D 3HOUK 1SFOC 3S1QK 4G7OA 3GTLC 4A3DC 4G7ZA 3GTJC 3S17C 4XLNA 1TWHK 2PA8L 5C3EC 4A3JK 2BE5A 2WAQD 5C4XK 2NVTK 2JA6K 2WAQL 5FJ8K 2R93K 2E2HC 2R92C 3RZOK 3WODA 4C3HK 4KN7A 4A3BC 3S1MK 3RZDC 2NVQC 3S14C 3S15K 4XSXA 3HKZD 2JA7C 4A3LK 4A93K 4LLGA 1TWAC 4A3KK 3GTKK 4XSZA 4QIWL 2JA5C 5IYCC 3K7AC 2JA8C 3H3VD 3HOWC 3I4NK 3S1RC 3HOZC 4A3MK 4BXXC 4G7HA 4BBSK 4BY7K 5IP7C 1TWCK 4JK1A 1I50C 4A3CK 4Q4ZA 4OIOA 3GTMK 3H0GC 4C2MK 1IW7A 2A68A 1SFOK 3M3YC 3FKIC 5FLMC 5M3FK 3GTLK 3GTJK 2NVXC 3S17K 4A3DK 2WB1L 5C3EK 2NVYC 1BDFA 1TWFC 4OIQA 2VUMC 4YG2A 5IYDC 4X6AC 3S2HC 2E2HK 1I6VA 4YFKA 2R92K 4A3EC 1YNJA 4A3FC 2E2IK 3PO2C 2E2JC 3GTQC 3M4OC 4A3BK 1I3QC 3RZDK 2NVQK 3S14K 3S16C 1ZYRA 3GTGC 5IYBC 4LJZA 5C4JC 2A6EA 2JA7K 4XLPA 4KN4A 2YU9C 2CW0A 1TWAK 4MQ9A 4AYBD 4YFNA 3HOVC 3DXJA 2JA5K 3HKZL 3K7AK 5IYCK 2JA8K 3S1RK 3HOZK 4BXXK 5IP7K 4OIPA 1I50K 2R7ZC 4Y52C 3H3VL 3H0GK 3M3YK 3FKIK 5TMCA 5FLMK 2NVXK 4QJVB 3S2DC 2NVYK 2VUMK 1TWFK 3S1NC 2Y0SD 5IP9C 5IYDK 1WCMC 4X6AK 4Y7NC 3S2HK 4MEYA 1SMYA 5D4DA 4LK0A 4A3EK 4LK1A 2A69A 2PMZD 4A3FK 3PO2K 2E2JK 3GTQK 3M4OK 1I3QK 2A6HA 4OIRA 3S16K 4ZH4A 3GTGK 3HOYC 3I4MC 5IYBK 5C4JK 1I6HC 2YU9K 5M5WK 4C3JK 4KMUA 1R9TC 3GTPC 3HOVK 4A3GC 4BY1C 3HOXC 4AYBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNN A;  3HOW K;  2R7Z K;  4Y52 K;  3GTO C;  3PO3 C;  1K83 C;  1Y1W C;  5M5Y K;  1TWG C;  4OIN A;  1Y1V C;  5M3M K;  3S2D K;  1XPP A;  3CQZ C;  4BBR C;  4A3I C;  3S1N K;  5C44 C;  5IP9 K;  1WCM K;  4Y7N K;  2B63 C;  3S1Q C;  2PA8 D;  3HOU C;  2Y0S L;  1TWH C;  4A3J C;  2R93 C;  3HOY K;  3I4M K;  2NVT C;  2JA6 C;  5C4X C;  2PMZ L;  2O5J A;  1I6H K;  2E2I C;  2O5I A;  4QJV A;  4YFX A;  2PPB A;  3RZO C;  3GTP K;  1R9T K;  5M5X K;  4NOI A;  3EQL A;  4A3G K;  3S1M C;  4BY1 K;  3S15 C;  3HOX K;  1HQM A;  4QIW D;  4MEX A;  5TMF A;  3GTO K;  3PO3 K;  4A93 C;  1K83 K;  1Y1W K;  4A3L C;  1TWG K;  3GTK C;  4C3I K;  1Y1V K;  4A3K C;  4GZY A;  3CQZ K;  3I4N C;  4BBR K;  4Q5S A;  4A3I K;  4A3M C;  4BY7 C;  4BBS C;  5C44 K;  1TWC C;  4A3C C;  2B63 K;  3GTM C;  2WB1 D;  3HOU K;  1SFO C;  3S1Q K;  4G7O A;  3GTL C;  4A3D C;  4G7Z A;  3GTJ C;  3S17 C;  4XLN A;  1TWH K;  2PA8 L;  5C3E C;  4A3J K;  2BE5 A;  2WAQ D;  5C4X K;  2NVT K;  2JA6 K;  2WAQ L;  5FJ8 K;  2R93 K;  2E2H C;  2R92 C;  3RZO K;  3WOD A;  4C3H K;  4KN7 A;  4A3B C;  3S1M K;  3RZD C;  2NVQ C;  3S14 C;  3S15 K;  4XSX A;  3HKZ D;  2JA7 C;  4A3L K;  4A93 K;  4LLG A;  1TWA C;  4A3K K;  3GTK K;  4XSZ A;  4QIW L;  2JA5 C;  5IYC C;  3K7A C;  2JA8 C;  3H3V D;  3HOW C;  3I4N K;  3S1R C;  3HOZ C;  4A3M K;  4BXX C;  4G7H A;  4BBS K;  4BY7 K;  5IP7 C;  1TWC K;  4JK1 A;  1I50 C;  4A3C K;  4Q4Z A;  4OIO A;  3GTM K;  3H0G C;  4C2M K;  1IW7 A;  2A68 A;  1SFO K;  3M3Y C;  3FKI C;  5FLM C;  5M3F K;  3GTL K;  3GTJ K;  2NVX C;  3S17 K;  4A3D K;  2WB1 L;  5C3E K;  2NVY C;  1BDF A;  1TWF C;  4OIQ A;  2VUM C;  4YG2 A;  5IYD C;  4X6A C;  3S2H C;  2E2H K;  1I6V A;  4YFK A;  2R92 K;  4A3E C;  1YNJ A;  4A3F C;  2E2I K;  3PO2 C;  2E2J C;  3GTQ C;  3M4O C;  4A3B K;  1I3Q C;  3RZD K;  2NVQ K;  3S14 K;  3S16 C;  1ZYR A;  3GTG C;  5IYB C;  4LJZ A;  5C4J C;  2A6E A;  2JA7 K;  4XLP A;  4KN4 A;  2YU9 C;  2CW0 A;  1TWA K;  4MQ9 A;  4AYB D;  4YFN A;  3HOV C;  3DXJ A;  2JA5 K;  3HKZ L;  3K7A K;  5IYC K;  2JA8 K;  3S1R K;  3HOZ K;  4BXX K;  5IP7 K;  4OIP A;  1I50 K;  2R7Z C;  4Y52 C;  3H3V L;  3H0G K;  3M3Y K;  3FKI K;  5TMC A;  5FLM K;  2NVX K;  4QJV B;  3S2D C;  2NVY K;  2VUM K;  1TWF K;  3S1N C;  2Y0S D;  5IP9 C;  5IYD K;  1WCM C;  4X6A K;  4Y7N C;  3S2H K;  4MEY A;  1SMY A;  5D4D A;  4LK0 A;  4A3E K;  4LK1 A;  2A69 A;  2PMZ D;  4A3F K;  3PO2 K;  2E2J K;  3GTQ K;  3M4O K;  1I3Q K;  2A6H A;  4OIR A;  3S16 K;  4ZH4 A;  3GTG K;  3HOY C;  3I4M C;  5IYB K;  5C4J K;  1I6H C;  2YU9 K;  5M5W K;  4C3J K;  4KMU A;  1R9T C;  3GTP C;  3HOV K;  4A3G C;  4BY1 C;  3HOX C;  4AYB L; 
#chains in the Genus database with same CATH topology
 1ZBS A;  3HOW K;  3AQO A;  5M5Y K;  4OIN A;  3H0G A;  1X31 C;  1WQF A;  2NVX A;  1TWF A;  4Y7N K;  1UV7 A;  4DDQ A;  2ZFZ A;  2Y0S L;  1EQR A;  1B4B A;  2JA6 C;  1I6H K;  4ILD A;  4QJV A;  2O5I A;  4C3H C;  1R9T K;  3EQL A;  3N0B A;  3AD7 C;  1O2A A;  3PO3 K;  4A93 C;  1Y1W K;  4G0U A;  3GTK C;  4WIL A;  4AH6 A;  1O25 A;  4A3I K;  4A3M C;  4BY7 C;  3CAG A;  4A3C C;  2B63 K;  1F93 A;  1WQH A;  3HOU K;  1VGX A;  4KB2 A;  2VUM A;  3S17 C;  4A3J K;  3GDZ A;  1HI9 A;  2R92 C;  2ZUF A;  1KQ4 A;  2ZUE A;  3WOD A;  4A3B C;  5EGE A;  3A8I A;  4XCH A;  1TWA C;  4QIW L;  2JA5 C;  3HOW C;  4G7O A;  3I4N K;  2GAH C;  1XXB A;  2R7Z A;  1I50 C;  4OIO A;  1EK8 A;  4C2M K;  1SFO K;  2A68 A;  3M3Y C;  4KB4 A;  3FKI C;  5EGH A;  5FLM C;  1JOE A;  1WOR A;  5C3E K;  2FQT A;  4WJ4 A;  3TFJ A;  4YG2 A;  5IYD C;  4X6A C;  3S2H C;  1BGW A;  2JA6 A;  4YFK A;  4A3E C;  1YNJ A;  1C0A A;  1ZVU A;  2E2I K;  3PO2 C;  3RZD K;  2NVQ K;  4KN4 A;  2CW0 A;  4KMA A;  1J98 A;  4C3J C;  5IOS A;  3DXJ A;  5IYC K;  4KMH A;  3HOZ K;  4LQY A;  5IP7 K;  4PAB A;  1JVI A;  2VUM K;  1V5V A;  2W7V A;  1WCM C;  4MEY A;  1SMY A;  3N0C A;  3LPX A;  2GSU A;  2FQO A;  3V4G A;  3GTQ K;  3M4O K;  4OIR A;  3I4M C;  1WSR A;  5M5W K;  3GTP C;  1TWA A;  4A3G C;  4BY1 C;  3HOX C;  2R7Z K;  4Y52 K;  3S0X A;  4KAW X;  1TWG C;  4GTD A;  4C3I C;  1Y1V C;  5M3M K;  1I50 A;  2RH6 A;  3S2D K;  1XPP A;  3CQZ C;  3FKI A;  3VA7 A;  1VRQ C;  4FM9 A;  5C44 C;  2PA8 D;  4C45 A;  1ISE A;  3BP3 A;  2NVT C;  2PMZ L;  3A8J A;  3JST A;  2O5J A;  2E2I C;  1IE0 A;  2RGR A;  2KWA A;  1O24 A;  1WOS A;  5E68 A;  4MEX A;  4P9S A;  3GTO K;  1K83 K;  1J6W A;  3MML B;  4GZY A;  4G0W A;  4A3K C;  5JFE A;  4BBR K;  1XZP A;  4BBS C;  1RU0 A;  3GTM C;  3S1Q K;  3ADA C;  1O28 A;  1YX2 A;  3GTJ C;  4P5B A;  3Q3Q A;  1TWH K;  3TFH A;  1J6V A;  5C4X K;  2R93 K;  2GSN A;  4RMF A;  2E2H C;  3RZO K;  1I3Q A;  4KN7 A;  3GTG A;  3S1M K;  3S15 K;  4XSX A;  3G4C A;  3T01 A;  4A3L K;  3GEH A;  3N3Y A;  2XCO A;  2JA8 C;  1EI6 A;  1Y1V A;  4GTB A;  3S1R C;  4G7H A;  3CQZ A;  1TWC K;  4KAS A;  3GTL K;  4A3D K;  2JH3 A;  4OIQ A;  2NVY C;  1BDF A;  1XZQ B;  1WSV A;  4A3F C;  3S16 C;  3S14 K;  1WQG A;  1ZYR A;  4G0V A;  4J3N A;  4LJZ A;  5C4J C;  1O26 A;  2JA7 K;  2Y3P A;  2YU9 C;  4GTF A;  4AYB D;  3HOV C;  3OEP A;  3K7A K;  1BS2 A;  4BXX K;  3H0G K;  3GTM A;  2NVX K;  3GSI A;  1TWF K;  3GTJ A;  1ZQ1 C;  2XCR B;  4GTA A;  4Y7N C;  1VLO A;  5D4D A;  4LK0 A;  1IBA A;  2E2H A;  4KDD A;  5IOT A;  2E2J K;  1USO A;  1I3Q K;  3AD8 C;  3ERE D;  3GTG K;  5IYB K;  1DCP A;  5IOQ A;  1I6H C;  1R9T C;  1GE9 A;  3GTK A;  3PO3 C;  1Y1W C;  3QX3 A;  4A3I C;  3S1N K;  5IP9 K;  2NVY A;  2B63 C;  1F7V A;  3HOU C;  3AD9 C;  3OPF A;  4KM9 A;  3T00 A;  4A3J C;  5HL8 A;  3HOY K;  2R92 A;  1IS1 A;  4YFX A;  4M1X A;  1VH2 A;  5M5X K;  1O27 A;  4BKW A;  1WOP A;  2JA5 A;  2CFA B;  4GTL A;  3I4N C;  3HXA A;  4PAA A;  2WB1 D;  1SFO C;  4C2M C;  4WJ3 M;  1WOO A;  2CFA A;  2PA8 L;  5C3E C;  2WAQ D;  2JA6 K;  2WAQ L;  4LOW A;  4C3H K;  3RZD C;  2NVQ C;  3FOF A;  3HKZ D;  4A93 K;  4LLG A;  3GTK K;  1Y1W A;  5IYC C;  3H3V D;  3LAP A;  3HOZ C;  4KMD A;  4A3M K;  4BY7 K;  5IP7 C;  4A3C K;  4Q4Z A;  3AQP A;  3TTG A;  2B63 A;  5M3F K;  3S17 K;  1BJT A;  1WCM A;  2VUM C;  1I6V A;  2R92 K;  3M4O C;  3GTQ C;  4A3B K;  4KM8 A;  3BUE A;  1B4A A;  3GTP A;  1JQW A;  1TWA K;  5CHP A;  1AB4 A;  2V6U A;  2JA5 K;  1TWG A;  1I50 K;  2R7Z C;  4Y52 C;  3M3Y K;  3FKI K;  3NUH A;  5FLM K;  1SFO A;  2GSO A;  4QJV B;  3S2D C;  4BLA A;  1INN A;  2Y0S D;  3FOE A;  5IYD K;  4GTE A;  4X6A K;  3GEE A;  3S2H K;  1O2F B;  4A3E K;  4LR2 A;  4LK1 A;  1J6X A;  3PO2 K;  5L46 A;  2A6H A;  2E2I A;  1PJ5 A;  2P8T A;  1F9N A;  3GEI A;  4C3J K;  1PJ6 A;  1XZQ A;  4AYB L;  1YNN A;  3GTO C;  1K83 C;  3ORE A;  4BBR C;  1WIH A;  5JVO A;  1USM A;  1WCM K;  3S1Q C;  1XXC A;  1TWH C;  2R93 C;  3I4M K;  5C4X C;  3GTQ A;  4GFQ A;  3AH5 A;  3IPJ A;  2PPB A;  2D6F C;  3SZZ A;  3RZO C;  3GTP K;  4NOI A;  4A3G K;  3S1M C;  4BY1 K;  3S15 C;  3HOX K;  1HQM A;  4QIW D;  5TMF A;  4A3L C;  1TWG K;  4GT9 A;  4C3I K;  1Y1V K;  3LAJ A;  3CQZ K;  1F7U A;  4Q5S A;  1EFW A;  5C44 K;  1XXA A;  1TWC C;  3TFI A;  3SZY A;  1O29 A;  3GTL C;  4A3D C;  4G7Z A;  1DCO A;  4XLN A;  2BE5 A;  3GIR A;  2NVT K;  5FJ8 K;  3T02 A;  3S14 C;  2GAG C;  2YU9 A;  3A8K A;  4KAT A;  2JA7 C;  4FZB A;  4A3K K;  1IQ0 A;  3GTO A;  4XSZ A;  1K83 A;  4KAR A;  3FHZ A;  3K7A C;  1IL2 A;  4BXX C;  4BBS K;  4JK1 A;  3GTM K;  3H0G C;  1IW7 A;  2V6S A;  4BLB A;  5CJ9 A;  3GTJ K;  2NVX C;  2V6T A;  2WB1 L;  4O2D A;  1O2B A;  1TWF C;  1TWH A;  1G51 A;  3BP8 C;  2R93 A;  2E2H K;  1DD5 A;  2PHC B;  2E2J C;  1YCL A;  1I3Q C;  2EBB A;  3GTG C;  5IYB C;  2A6E A;  1EH1 A;  1R9T A;  4XLP A;  4KC6 A;  4MQ9 A;  4YFN A;  3HKZ L;  2P5M A;  2JA8 K;  3S1R K;  4OIP A;  3G4A A;  3H3V L;  1TWC A;  5TJ3 A;  5TMC A;  3L4J A;  3GTL A;  2NVY K;  2XCQ A;  3S1N C;  5IP9 C;  4GTC A;  2A69 A;  1L0W A;  2PMZ D;  4A3F K;  1PJ7 A;  5IOR A;  1VJE A;  3S16 K;  4ZH4 A;  3HOY C;  5C4J K;  1XZP B;  2YU9 K;  3L4K A;  1DCH A;  2JA7 A;  3HOV K;  4KMU A;  1ZXO A;  4P5A A; 
#chains in the Genus database with same CATH homology
 1YNN A;  3HOW K;  2R7Z K;  4Y52 K;  3GTO C;  3PO3 C;  1K83 C;  1Y1W C;  5M5Y K;  1TWG C;  4OIN A;  1Y1V C;  5M3M K;  3S2D K;  1XPP A;  3CQZ C;  4BBR C;  4A3I C;  3S1N K;  5C44 C;  5IP9 K;  1WCM K;  4Y7N K;  2B63 C;  3S1Q C;  2PA8 D;  3HOU C;  2Y0S L;  1TWH C;  4A3J C;  2R93 C;  3HOY K;  3I4M K;  2NVT C;  2JA6 C;  5C4X C;  2PMZ L;  2O5J A;  1I6H K;  2E2I C;  2O5I A;  4QJV A;  4YFX A;  2PPB A;  3RZO C;  3GTP K;  1R9T K;  5M5X K;  4NOI A;  3EQL A;  4A3G K;  3S1M C;  4BY1 K;  3S15 C;  3HOX K;  1HQM A;  4QIW D;  4MEX A;  5TMF A;  3GTO K;  3PO3 K;  4A93 C;  1K83 K;  1Y1W K;  4A3L C;  1TWG K;  3GTK C;  4C3I K;  1Y1V K;  4A3K C;  4GZY A;  3CQZ K;  3I4N C;  4BBR K;  4Q5S A;  4A3I K;  4A3M C;  4BY7 C;  4BBS C;  5C44 K;  1TWC C;  4A3C C;  2B63 K;  3GTM C;  2WB1 D;  3HOU K;  1SFO C;  3S1Q K;  4G7O A;  3GTL C;  4A3D C;  4G7Z A;  3GTJ C;  3S17 C;  4XLN A;  1TWH K;  2PA8 L;  5C3E C;  4A3J K;  2BE5 A;  2WAQ D;  5C4X K;  2NVT K;  2JA6 K;  2WAQ L;  5FJ8 K;  2R93 K;  2E2H C;  2R92 C;  3RZO K;  3WOD A;  4C3H K;  4KN7 A;  4A3B C;  3S1M K;  3RZD C;  2NVQ C;  3S14 C;  3S15 K;  4XSX A;  3HKZ D;  2JA7 C;  4A3L K;  4A93 K;  4LLG A;  1TWA C;  4A3K K;  3GTK K;  4XSZ A;  4QIW L;  2JA5 C;  5IYC C;  3K7A C;  2JA8 C;  3H3V D;  3HOW C;  3I4N K;  3S1R C;  3HOZ C;  4A3M K;  4BXX C;  4G7H A;  4BBS K;  4BY7 K;  5IP7 C;  1TWC K;  4JK1 A;  1I50 C;  4A3C K;  4Q4Z A;  4OIO A;  3GTM K;  3H0G C;  4C2M K;  1IW7 A;  2A68 A;  1SFO K;  3M3Y C;  3FKI C;  5FLM C;  5M3F K;  3GTL K;  3GTJ K;  2NVX C;  3S17 K;  4A3D K;  2WB1 L;  5C3E K;  2NVY C;  1BDF A;  1TWF C;  4OIQ A;  2VUM C;  4YG2 A;  5IYD C;  4X6A C;  3S2H C;  2E2H K;  1I6V A;  4YFK A;  2R92 K;  4A3E C;  1YNJ A;  4A3F C;  2E2I K;  3PO2 C;  2E2J C;  3GTQ C;  3M4O C;  4A3B K;  1I3Q C;  3RZD K;  2NVQ K;  3S14 K;  3S16 C;  1ZYR A;  3GTG C;  5IYB C;  4LJZ A;  5C4J C;  2A6E A;  2JA7 K;  4XLP A;  4KN4 A;  2YU9 C;  2CW0 A;  1TWA K;  4MQ9 A;  4AYB D;  4YFN A;  3HOV C;  3DXJ A;  2JA5 K;  3HKZ L;  3K7A K;  5IYC K;  2JA8 K;  3S1R K;  3HOZ K;  4BXX K;  5IP7 K;  4OIP A;  1I50 K;  2R7Z C;  4Y52 C;  3H3V L;  3H0G K;  3M3Y K;  3FKI K;  5TMC A;  5FLM K;  2NVX K;  4QJV B;  3S2D C;  2NVY K;  2VUM K;  1TWF K;  3S1N C;  2Y0S D;  5IP9 C;  5IYD K;  1WCM C;  4X6A K;  4Y7N C;  3S2H K;  4MEY A;  1SMY A;  5D4D A;  4LK0 A;  4A3E K;  4LK1 A;  2A69 A;  2PMZ D;  4A3F K;  3PO2 K;  2E2J K;  3GTQ K;  3M4O K;  1I3Q K;  2A6H A;  4OIR A;  3S16 K;  4ZH4 A;  3GTG K;  3HOY C;  3I4M C;  5IYB K;  5C4J K;  1I6H C;  2YU9 K;  5M5W K;  4C3J K;  4KMU A;  1R9T C;  3GTP C;  3HOV K;  4A3G C;  4BY1 C;  3HOX C;  4AYB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...