3GTMK

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtmK00
4Y7NK 3HOUK 5C4XK 2WAQL 2B63C 3GTPC 4YFNA 5M5XK 1Y1WC 1HQMA 4C3HK 4A3IC 4A3CC 5IYDK 2A68A 4Y52K 1Y1VC 2VUMC 1TWHC 4X6AC 2NVTK 1I3QK 1YNNA 3K7AK 4LK1A 4Q5SA 3S2DC 3S17K 3S1QC 4BY1K 3M3YC 2R93K 4ZH4A 4BBRK 2JA6C 2JA8C 3H3VL 3RZOC 1I6HK 3M4OC 1BDFA 3DXJA 4LJZA 2A6HA 1R9TK 4A3DC 4QIWD 4AYBL 3GTJC 4G7ZA 4OINA 3GTGC 3PO3K 4A3FK 3S2HC 1TWCK 4A3GK 3HOZC 3S16K 1TWGK 1TWAC 2Y0SL 2NVYK 4BXXC 4A3JK 1SMYA 5IP9K 5IP7C 2JA5C 3GTMC 3HOVK 2R7ZC 2E2IK 3I4MC 3PO2K 5IYCC 3S14K 4XSXA 5C4JK 1SFOK 3S15K 3S1RC 1K83K 2YU9K 2E2HK 4BBSC 3S1NK 5TMFA 5C44C 2PA8D 4G7OA 4QIWL 4AYBD 4Y52C 1TWHK 3S1MC 4JK1A 3GTOC 1YNJA 2PPBA 5M5YK 2NVQK 1WCMC 5C3EC 3GTKC 3H0GK 3I4NK 2R93C 4BBRC 2JA6K 4A93K 2JA7K 2CW0A 5FJ8K 3HOWK 3FKIK 3HOYK 4BY7K 4YG2A 4A3BK 4A3DK 2E2JC 4A3MK 3GTJK 3GTGK 1TWFK 4C3IK 4A3LC 4YFKA 4OIOA 2R92K 3GTQC 3S2HK 5C4XC 4A3KK 4QJVB 4A3JC 5IP7K 2JA5K 2PA8L 4KMUA 4Y7NC 3HOUC 5IYBK 1XPPA 4X6AK 1I3QC 1Y1WK 3WODA 4A3CK 4A3IK 3S2DK 5IYDC 2Y0SD 2O5JA 1Y1VK 1I50K 4XSZA 4C2MK 3GTLC 1K83C 3K7AC 1I6VA 2WB1L 4LLGA 4MEYA 4QJVA 4XLPA 3HOXC 3RZDC 2JA8K 4YFXA 3RZOK 3S1QK 4C3JK 2BE5A 3M3YK 2WAQD 4KN4A 3CQZC 3S1MK 2PMZD 5M3FK 5M3MK 3HKZL 2A69A 2NVXK 1TWCC 4A3EC 3GTOK 3HOZK 3S16C 1TWGC 4LK0A 2NVYC 4MQ9A 3PO3C 5FLMK 2JA7C 3GTMK 3HOVC 5D4DA 2B63K 3GTPK 3I4MK 2E2IC 5IP9C 4G7HA 2O5IA 2R7ZK 2E2JK 5C4JC 1SFOC 3H3VD 2VUMK 4A3LK 2R92C 2NVTC 2WB1D 2YU9C 3GTQK 4MEXA 4A3KC 3S1NC 3S17C 4BY1C 5C44K 4OIQA 3S1RK 2E2HC 4BBSK 4GZYA 2PMZL 5IYBC 3HKZD 1I6HC 2NVQC 3M4OK 3GTKK 1R9TC 1I50C 3GTLK 4KN7A 4OIRA 4XLNA 3EQLA 3RZDK 4A3FC 3HOXK 4A3GC 1WCMK 5C3EK 3I4NC 1IW7A 3H0GC 5M5WK 1TWAK 2A6EA 3FKIC 4BXXK 4Q4ZA 4A3BC 4A93C 3CQZK 4A3MC 1ZYRA 3HOWC 1TWFC 4NOIA 2NVXC 3HOYC 4A3EK 4BY7C 3PO2C 5IYCK 3S14C 3S15C 5TMCA 4OIPA 5FLMC
chains in the Genus database with same CATH superfamily
5CHPA 5JFEA 4Y7NK 3A8IA 5IOTA 4YFNA 5M5XK 4KARA 4Y52K 2VUMC 1TWHC 2NVTK 1I3QK 4LOWA 4BKWA 3OEPA 3TFHA 1DD5A 2GAGC 3RZOC 1O29A 2A6HA 4A3DC 2ZUFA 2JA5A 1TWGK 2JA6A 3SZZA 1SMYA 5IP9K 3GDZA 3GSIA 3GTMC 3HOVK 2P5MA 5IYCC 2EBBA 1G51A 1F93A 4BBSC 5TMFA 1WOSA 5C44C 1VRQC 3MMLB 4AYBD 2E2HA 3G4CA 3AD7C 3S1MC 3I4NK 3GTKC 3TFJA 3ERED 4LR2A 2JA6K 3N3YA 4A93K 1B4BA 5FJ8K 3FKIK 3VA7A 2E2JC 1KQ4A 3A8KA 4PABA 3S2HK 1O2AA 3AQPA 4A3JC 2PHCB 1Y1VA 4KMUA 4GTFA 3S2DK 1IS1A 2O5JA 4XSZA 2VUMA 4MEYA 4XLPA 4XCHA 3CQZA 3NUHA 2P8TA 1YX2A 1F9NA 1I3QA 2WAQD 2PMZD 5M3MK 3HKZL 3GTOK 4A3EC 1WOOA 3GTLA 2NVYC 3FOFA 2GAHC 4KB2A 5IP9C 2O5IA 3H3VD 2RGRA 2VUMK 4A3LK 1BGWA 3AH5A 3S17C 2V6SA 3H0GA 4OIQA 1XZQB 1WOPA 5IYBC 2NVQC 3GTLK 4A3GC 5C3EK 1XZQA 2A6EA 4Q4ZA 4A3BC 1O26A 4A93C 4A3MC 4C3IC 4NOIA 4AH6A 3GTOA 2NVXA 1Y1WA 3HOUK 5C4XK 4A3CC 1HQMA 3GEEA 4A3IC 5IYDK 2A68A 1Y1VC 4C2MC 5CJ9A 4DDQA 4X6AC 3K7AK 3TTGA 4LK1A 4BY1K 3M3YC 2JA6C 1I6HK 1JVIA 1BDFA 1R9TK 2GSUA 4KAWX 4G7ZA 4A3FK 3S2HC 3S0XA 3S16K 2Y0SL 2NVYK 4A3JK 5IP7C 2R7ZC 3I4MC 4GTCA 3PO2K 1HI9A 1WQHA 4LQYA 3S1RC 2YU9K 2E2HK 1VGXA 1XXBA 5EGHA 4M1XA 4WILA 2CFAA 4KM9A 4QIWL 4Y52C 5JVOA 3T00A 5M5YK 3H0GK 4GTDA 4BLAA 2CW0A 3GEIA 4BY7K 4YG2A 4A3BK 4A3DK 2E2IA 5HL8A 1PJ6A 2CFAB 4C3IK 3GTJK 3GTGK 4A3LC 4GTBA 4QJVB 3HOUC 5IYBK 1XPPA 1TWFA 1I3QC 1Y1WK 1O27A 2XCRB 5IYDC 1DCPA 3L4KA 1I50K 4KDDA 3GTLC 1K83C 3K7AC 4LLGA 3HOXC 4KASA 3RZOK 1IE0A 3ADAC 3GTJA 3GTGA 3IPJA 1TWHA 1TWCC 1JQWA 3HOZK 4BLBA 5IOQA 1ZQ1C 2JH3A 1XXAA 5IORA 3GTMK 5D4DA 1WCMA 3HOVC 1SFOA 1F7UA 2R92C 1J6VA 3GTQK 4GTLA 4BY1C 5C44K 3T01A 1YCLA 1IBAA 1EFWA 4GTAA 3M4OK 1R9TC 1USMA 2YU9A 1WIHA 1TWCA 3EQLA 3T02A 4A3FC 2V6UA 3AD9C 4O2DA 3CQZK 4FZBA 1C0AA 3Q3QA 4GFQA 1RU0A 1WSVA 5TMCA 1VH2A 4ILDA 4J3NA 1DCOA 2B63C 3GTPC 3GTKA 4C3HK 3BP8C 3LAJA 4Q5SA 3FHZA 4WJ3M 3S17K 3AD8C 4WJ4A 1O25A 4ZH4A 2JA8C 1WSRA 2KWAA 4LJZA 1WQGA 4QIWD 3GTJC 3GTGC 4G0UA 3OPFA 3PO3K 1JOEA 2R93A 1TWCK 4A3GK 1EH1A 3HOZC 1AB4A 1TWAC 4BXXC 1F7VA 2JA5C 4XSXA 5E68A 5C4JK 1SFOK 1K83K 3S1NK 3GTQA 4KMHA 3QX3A 1IL2A 5C3EC 1PJ5A 3CAGA 2R93C 2ZUEA 4BBRC 3HOWK 1V5VA 3HOYK 1VLOA 1TWFK 3N0CA 4YFKA 4OIOA 2R92K 3OREA 3GTQC 5C4XC 4A3KK 3LAPA 1J6XA 5IP7K 2PA8L 4Y7NC 4X6AK 4P5BA 3WODA 3GTPA 2B63A 1I6VA 2WB1L 4QJVA 3RZDC 2FQTA 2W7VA 4C3JK 1O24A 2D6FC 3FKIA 3GTMA 3CQZC 5M3FK 1EK8A 4KC6A 2A69A 1GE9A 3SZYA 3S16C 4MQ9A 1INNA 3PO3C 2JA7C 1PJ7A 2B63K 1XZPA 1TWAA 2E2IC 3GTPK 3I4MK 2R7ZK 4C3HC 1ISEA 2NVTC 2YU9C 4MEXA 4BBSK 5EGEA 4GZYA 4PAAA 3FOEA 1I50C 2JA7A 4OIRA 4XLNA 3HOXK 3I4NC 1TWAK 2R7ZA 1J6WA 4BXXK 1J98A 3A8JA 3HOWC 1USOA 2NVXC 3HOYC 1ZVUA 5IYCK 5FLMC 2WAQL 2GSOA 4P5AA 1BJTA 4P9SA 1Y1WC 1YNNA 3S2DC 3S1QC 2R93K 4G0WA 4BBRK 3H3VL 4C3JC 1XZPB 3M4OC 3DXJA 4KB4A 4AYBL 4OINA 1L0WA 1WQFA 4KMDA 2V6TA 3TFIA 2XCOA 1O2BA 3L4JA 1WORA 3G4AA 2E2IK 3S14K 3S15K 4KMAA 1DCHA 1IQ0A 2PA8D 4G7OA 1TWHK 1EI6A 4JK1A 3GTOC 1YNJA 2PPBA 2NVQK 3JSTA 1WCMC 2NVYA 2JA7K 4KM8A 4G0VA 2R92A 1ZXOA 1BS2A 3HXAA 4A3MK 1R9TA 4RMFA 4FM9A 2Y3PA 4C45A 2XCQA 1UV7A 2JA5K 2GSNA 4A3CK 4A3IK 1VJEA 3BUEA 2Y0SD 1Y1VK 4C2MK 1O28A 3GEHA 3LPXA 2JA8K 3S1QK 4YFXA 2BE5A 2ZFZA 3M3YK 4KN4A 1X31C 3S1MK 4KATA 2NVXK 3BP3A 1XXCA 1TWGC 4LK0A 3AQOA 5L46A 5FLMK 5IOSA 2RH6A 4G7HA 2E2JK 1O2FB 5C4JC 1SFOC 5TJ3A 2WB1D 1I50A 4A3KC 3S1NC 3V4GA 3S1RK 2E2HC 2PMZL 3HKZD 1I6HC 1B4AA 3N0BA 3GTKK 4KN7A 3RZDK 1EQRA 3GIRA 1WCMK 1TWGA 1IW7A 3H0GC 5M5WK 3FKIC 2FQOA 1ZYRA 1TWFC 1ZBSA 4BY7C 4A3EK 4GT9A 3PO2C 4GTEA 3S14C 3S15C 1K83A 4OIPA
chains in the Genus database with same CATH topology
4Y7NK 3HOUK 5C4XK 2WAQL 2B63C 3GTPC 4YFNA 5M5XK 1Y1WC 1HQMA 4C3HK 4A3IC 4A3CC 5IYDK 2A68A 4Y52K 1Y1VC 2VUMC 1TWHC 4X6AC 2NVTK 1I3QK 1YNNA 3K7AK 4LK1A 4Q5SA 3S2DC 3S17K 3S1QC 4BY1K 3M3YC 2R93K 4ZH4A 4BBRK 2JA6C 2JA8C 3H3VL 3RZOC 1I6HK 3M4OC 1BDFA 3DXJA 4LJZA 2A6HA 1R9TK 4A3DC 4QIWD 4AYBL 3GTJC 4G7ZA 4OINA 3GTGC 3PO3K 4A3FK 3S2HC 1TWCK 4A3GK 3HOZC 3S16K 1TWGK 1TWAC 2Y0SL 2NVYK 4BXXC 4A3JK 1SMYA 5IP9K 5IP7C 2JA5C 3GTMC 3HOVK 2R7ZC 2E2IK 3I4MC 3PO2K 5IYCC 3S14K 4XSXA 5C4JK 1SFOK 3S15K 3S1RC 1K83K 2YU9K 2E2HK 4BBSC 3S1NK 5TMFA 5C44C 2PA8D 4G7OA 4QIWL 4AYBD 4Y52C 1TWHK 3S1MC 4JK1A 3GTOC 1YNJA 2PPBA 5M5YK 2NVQK 1WCMC 5C3EC 3GTKC 3H0GK 3I4NK 2R93C 4BBRC 2JA6K 4A93K 2JA7K 2CW0A 5FJ8K 3HOWK 3FKIK 3HOYK 4BY7K 4YG2A 4A3BK 4A3DK 2E2JC 4A3MK 3GTJK 3GTGK 1TWFK 4C3IK 4A3LC 4YFKA 4OIOA 2R92K 3GTQC 3S2HK 5C4XC 4A3KK 4QJVB 4A3JC 5IP7K 2JA5K 2PA8L 4KMUA 4Y7NC 3HOUC 5IYBK 1XPPA 4X6AK 1I3QC 1Y1WK 3WODA 4A3CK 4A3IK 3S2DK 5IYDC 2Y0SD 2O5JA 1Y1VK 1I50K 4XSZA 4C2MK 3GTLC 1K83C 3K7AC 1I6VA 2WB1L 4LLGA 4MEYA 4QJVA 4XLPA 3HOXC 3RZDC 2JA8K 4YFXA 3RZOK 3S1QK 4C3JK 2BE5A 3M3YK 2WAQD 4KN4A 3CQZC 3S1MK 2PMZD 5M3FK 5M3MK 3HKZL 2A69A 2NVXK 1TWCC 4A3EC 3GTOK 3HOZK 3S16C 1TWGC 4LK0A 2NVYC 4MQ9A 3PO3C 5FLMK 2JA7C 3GTMK 3HOVC 5D4DA 2B63K 3GTPK 3I4MK 2E2IC 5IP9C 4G7HA 2O5IA 2R7ZK 2E2JK 5C4JC 1SFOC 3H3VD 2VUMK 4A3LK 2R92C 2NVTC 2WB1D 2YU9C 3GTQK 4MEXA 4A3KC 3S1NC 3S17C 4BY1C 5C44K 4OIQA 3S1RK 2E2HC 4BBSK 4GZYA 2PMZL 5IYBC 3HKZD 1I6HC 2NVQC 3M4OK 3GTKK 1R9TC 1I50C 3GTLK 4KN7A 4OIRA 4XLNA 3EQLA 3RZDK 4A3FC 3HOXK 4A3GC 1WCMK 5C3EK 3I4NC 1IW7A 3H0GC 5M5WK 1TWAK 2A6EA 3FKIC 4BXXK 4Q4ZA 4A3BC 4A93C 3CQZK 4A3MC 1ZYRA 3HOWC 1TWFC 4NOIA 2NVXC 3HOYC 4A3EK 4BY7C 3PO2C 5IYCK 3S14C 3S15C 5TMCA 4OIPA 5FLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N K;  3HOU K;  5C4X K;  2WAQ L;  2B63 C;  3GTP C;  4YFN A;  5M5X K;  1Y1W C;  1HQM A;  4C3H K;  4A3I C;  4A3C C;  5IYD K;  2A68 A;  4Y52 K;  1Y1V C;  2VUM C;  1TWH C;  4X6A C;  2NVT K;  1I3Q K;  1YNN A;  3K7A K;  4LK1 A;  4Q5S A;  3S2D C;  3S17 K;  3S1Q C;  4BY1 K;  3M3Y C;  2R93 K;  4ZH4 A;  4BBR K;  2JA6 C;  2JA8 C;  3H3V L;  3RZO C;  1I6H K;  3M4O C;  1BDF A;  3DXJ A;  4LJZ A;  2A6H A;  1R9T K;  4A3D C;  4QIW D;  4AYB L;  3GTJ C;  4G7Z A;  4OIN A;  3GTG C;  3PO3 K;  4A3F K;  3S2H C;  1TWC K;  4A3G K;  3HOZ C;  3S16 K;  1TWG K;  1TWA C;  2Y0S L;  2NVY K;  4BXX C;  4A3J K;  1SMY A;  5IP9 K;  5IP7 C;  2JA5 C;  3GTM C;  3HOV K;  2R7Z C;  2E2I K;  3I4M C;  3PO2 K;  5IYC C;  3S14 K;  4XSX A;  5C4J K;  1SFO K;  3S15 K;  3S1R C;  1K83 K;  2YU9 K;  2E2H K;  4BBS C;  3S1N K;  5TMF A;  5C44 C;  2PA8 D;  4G7O A;  4QIW L;  4AYB D;  4Y52 C;  1TWH K;  3S1M C;  4JK1 A;  3GTO C;  1YNJ A;  2PPB A;  5M5Y K;  2NVQ K;  1WCM C;  5C3E C;  3GTK C;  3H0G K;  3I4N K;  2R93 C;  4BBR C;  2JA6 K;  4A93 K;  2JA7 K;  2CW0 A;  5FJ8 K;  3HOW K;  3FKI K;  3HOY K;  4BY7 K;  4YG2 A;  4A3B K;  4A3D K;  2E2J C;  4A3M K;  3GTJ K;  3GTG K;  1TWF K;  4C3I K;  4A3L C;  4YFK A;  4OIO A;  2R92 K;  3GTQ C;  3S2H K;  5C4X C;  4A3K K;  4QJV B;  4A3J C;  5IP7 K;  2JA5 K;  2PA8 L;  4KMU A;  4Y7N C;  3HOU C;  5IYB K;  1XPP A;  4X6A K;  1I3Q C;  1Y1W K;  3WOD A;  4A3C K;  4A3I K;  3S2D K;  5IYD C;  2Y0S D;  2O5J A;  1Y1V K;  1I50 K;  4XSZ A;  4C2M K;  3GTL C;  1K83 C;  3K7A C;  1I6V A;  2WB1 L;  4LLG A;  4MEY A;  4QJV A;  4XLP A;  3HOX C;  3RZD C;  2JA8 K;  4YFX A;  3RZO K;  3S1Q K;  4C3J K;  2BE5 A;  3M3Y K;  2WAQ D;  4KN4 A;  3CQZ C;  3S1M K;  2PMZ D;  5M3F K;  5M3M K;  3HKZ L;  2A69 A;  2NVX K;  1TWC C;  4A3E C;  3GTO K;  3HOZ K;  3S16 C;  1TWG C;  4LK0 A;  2NVY C;  4MQ9 A;  3PO3 C;  5FLM K;  2JA7 C;  3GTM K;  3HOV C;  5D4D A;  2B63 K;  3GTP K;  3I4M K;  2E2I C;  5IP9 C;  4G7H A;  2O5I A;  2R7Z K;  2E2J K;  5C4J C;  1SFO C;  3H3V D;  2VUM K;  4A3L K;  2R92 C;  2NVT C;  2WB1 D;  2YU9 C;  3GTQ K;  4MEX A;  4A3K C;  3S1N C;  3S17 C;  4BY1 C;  5C44 K;  4OIQ A;  3S1R K;  2E2H C;  4BBS K;  4GZY A;  2PMZ L;  5IYB C;  3HKZ D;  1I6H C;  2NVQ C;  3M4O K;  3GTK K;  1R9T C;  1I50 C;  3GTL K;  4KN7 A;  4OIR A;  4XLN A;  3EQL A;  3RZD K;  4A3F C;  3HOX K;  4A3G C;  1WCM K;  5C3E K;  3I4N C;  1IW7 A;  3H0G C;  5M5W K;  1TWA K;  2A6E A;  3FKI C;  4BXX K;  4Q4Z A;  4A3B C;  4A93 C;  3CQZ K;  4A3M C;  1ZYR A;  3HOW C;  1TWF C;  4NOI A;  2NVX C;  3HOY C;  4A3E K;  4BY7 C;  3PO2 C;  5IYC K;  3S14 C;  3S15 C;  5TMC A;  4OIP A;  5FLM C; 
#chains in the Genus database with same CATH topology
 5CHP A;  5JFE A;  4Y7N K;  3A8I A;  5IOT A;  4YFN A;  5M5X K;  4KAR A;  4Y52 K;  2VUM C;  1TWH C;  2NVT K;  1I3Q K;  4LOW A;  4BKW A;  3OEP A;  3TFH A;  1DD5 A;  2GAG C;  3RZO C;  1O29 A;  2A6H A;  4A3D C;  2ZUF A;  2JA5 A;  1TWG K;  2JA6 A;  3SZZ A;  1SMY A;  5IP9 K;  3GDZ A;  3GSI A;  3GTM C;  3HOV K;  2P5M A;  5IYC C;  2EBB A;  1G51 A;  1F93 A;  4BBS C;  5TMF A;  1WOS A;  5C44 C;  1VRQ C;  3MML B;  4AYB D;  2E2H A;  3G4C A;  3AD7 C;  3S1M C;  3I4N K;  3GTK C;  3TFJ A;  3ERE D;  4LR2 A;  2JA6 K;  3N3Y A;  4A93 K;  1B4B A;  5FJ8 K;  3FKI K;  3VA7 A;  2E2J C;  1KQ4 A;  3A8K A;  4PAB A;  3S2H K;  1O2A A;  3AQP A;  4A3J C;  2PHC B;  1Y1V A;  4KMU A;  4GTF A;  3S2D K;  1IS1 A;  2O5J A;  4XSZ A;  2VUM A;  4MEY A;  4XLP A;  4XCH A;  3CQZ A;  3NUH A;  2P8T A;  1YX2 A;  1F9N A;  1I3Q A;  2WAQ D;  2PMZ D;  5M3M K;  3HKZ L;  3GTO K;  4A3E C;  1WOO A;  3GTL A;  2NVY C;  3FOF A;  2GAH C;  4KB2 A;  5IP9 C;  2O5I A;  3H3V D;  2RGR A;  2VUM K;  4A3L K;  1BGW A;  3AH5 A;  3S17 C;  2V6S A;  3H0G A;  4OIQ A;  1XZQ B;  1WOP A;  5IYB C;  2NVQ C;  3GTL K;  4A3G C;  5C3E K;  1XZQ A;  2A6E A;  4Q4Z A;  4A3B C;  1O26 A;  4A93 C;  4A3M C;  4C3I C;  4NOI A;  4AH6 A;  3GTO A;  2NVX A;  1Y1W A;  3HOU K;  5C4X K;  4A3C C;  1HQM A;  3GEE A;  4A3I C;  5IYD K;  2A68 A;  1Y1V C;  4C2M C;  5CJ9 A;  4DDQ A;  4X6A C;  3K7A K;  3TTG A;  4LK1 A;  4BY1 K;  3M3Y C;  2JA6 C;  1I6H K;  1JVI A;  1BDF A;  1R9T K;  2GSU A;  4KAW X;  4G7Z A;  4A3F K;  3S2H C;  3S0X A;  3S16 K;  2Y0S L;  2NVY K;  4A3J K;  5IP7 C;  2R7Z C;  3I4M C;  4GTC A;  3PO2 K;  1HI9 A;  1WQH A;  4LQY A;  3S1R C;  2YU9 K;  2E2H K;  1VGX A;  1XXB A;  5EGH A;  4M1X A;  4WIL A;  2CFA A;  4KM9 A;  4QIW L;  4Y52 C;  5JVO A;  3T00 A;  5M5Y K;  3H0G K;  4GTD A;  4BLA A;  2CW0 A;  3GEI A;  4BY7 K;  4YG2 A;  4A3B K;  4A3D K;  2E2I A;  5HL8 A;  1PJ6 A;  2CFA B;  4C3I K;  3GTJ K;  3GTG K;  4A3L C;  4GTB A;  4QJV B;  3HOU C;  5IYB K;  1XPP A;  1TWF A;  1I3Q C;  1Y1W K;  1O27 A;  2XCR B;  5IYD C;  1DCP A;  3L4K A;  1I50 K;  4KDD A;  3GTL C;  1K83 C;  3K7A C;  4LLG A;  3HOX C;  4KAS A;  3RZO K;  1IE0 A;  3ADA C;  3GTJ A;  3GTG A;  3IPJ A;  1TWH A;  1TWC C;  1JQW A;  3HOZ K;  4BLB A;  5IOQ A;  1ZQ1 C;  2JH3 A;  1XXA A;  5IOR A;  3GTM K;  5D4D A;  1WCM A;  3HOV C;  1SFO A;  1F7U A;  2R92 C;  1J6V A;  3GTQ K;  4GTL A;  4BY1 C;  5C44 K;  3T01 A;  1YCL A;  1IBA A;  1EFW A;  4GTA A;  3M4O K;  1R9T C;  1USM A;  2YU9 A;  1WIH A;  1TWC A;  3EQL A;  3T02 A;  4A3F C;  2V6U A;  3AD9 C;  4O2D A;  3CQZ K;  4FZB A;  1C0A A;  3Q3Q A;  4GFQ A;  1RU0 A;  1WSV A;  5TMC A;  1VH2 A;  4ILD A;  4J3N A;  1DCO A;  2B63 C;  3GTP C;  3GTK A;  4C3H K;  3BP8 C;  3LAJ A;  4Q5S A;  3FHZ A;  4WJ3 M;  3S17 K;  3AD8 C;  4WJ4 A;  1O25 A;  4ZH4 A;  2JA8 C;  1WSR A;  2KWA A;  4LJZ A;  1WQG A;  4QIW D;  3GTJ C;  3GTG C;  4G0U A;  3OPF A;  3PO3 K;  1JOE A;  2R93 A;  1TWC K;  4A3G K;  1EH1 A;  3HOZ C;  1AB4 A;  1TWA C;  4BXX C;  1F7V A;  2JA5 C;  4XSX A;  5E68 A;  5C4J K;  1SFO K;  1K83 K;  3S1N K;  3GTQ A;  4KMH A;  3QX3 A;  1IL2 A;  5C3E C;  1PJ5 A;  3CAG A;  2R93 C;  2ZUE A;  4BBR C;  3HOW K;  1V5V A;  3HOY K;  1VLO A;  1TWF K;  3N0C A;  4YFK A;  4OIO A;  2R92 K;  3ORE A;  3GTQ C;  5C4X C;  4A3K K;  3LAP A;  1J6X A;  5IP7 K;  2PA8 L;  4Y7N C;  4X6A K;  4P5B A;  3WOD A;  3GTP A;  2B63 A;  1I6V A;  2WB1 L;  4QJV A;  3RZD C;  2FQT A;  2W7V A;  4C3J K;  1O24 A;  2D6F C;  3FKI A;  3GTM A;  3CQZ C;  5M3F K;  1EK8 A;  4KC6 A;  2A69 A;  1GE9 A;  3SZY A;  3S16 C;  4MQ9 A;  1INN A;  3PO3 C;  2JA7 C;  1PJ7 A;  2B63 K;  1XZP A;  1TWA A;  2E2I C;  3GTP K;  3I4M K;  2R7Z K;  4C3H C;  1ISE A;  2NVT C;  2YU9 C;  4MEX A;  4BBS K;  5EGE A;  4GZY A;  4PAA A;  3FOE A;  1I50 C;  2JA7 A;  4OIR A;  4XLN A;  3HOX K;  3I4N C;  1TWA K;  2R7Z A;  1J6W A;  4BXX K;  1J98 A;  3A8J A;  3HOW C;  1USO A;  2NVX C;  3HOY C;  1ZVU A;  5IYC K;  5FLM C;  2WAQ L;  2GSO A;  4P5A A;  1BJT A;  4P9S A;  1Y1W C;  1YNN A;  3S2D C;  3S1Q C;  2R93 K;  4G0W A;  4BBR K;  3H3V L;  4C3J C;  1XZP B;  3M4O C;  3DXJ A;  4KB4 A;  4AYB L;  4OIN A;  1L0W A;  1WQF A;  4KMD A;  2V6T A;  3TFI A;  2XCO A;  1O2B A;  3L4J A;  1WOR A;  3G4A A;  2E2I K;  3S14 K;  3S15 K;  4KMA A;  1DCH A;  1IQ0 A;  2PA8 D;  4G7O A;  1TWH K;  1EI6 A;  4JK1 A;  3GTO C;  1YNJ A;  2PPB A;  2NVQ K;  3JST A;  1WCM C;  2NVY A;  2JA7 K;  4KM8 A;  4G0V A;  2R92 A;  1ZXO A;  1BS2 A;  3HXA A;  4A3M K;  1R9T A;  4RMF A;  4FM9 A;  2Y3P A;  4C45 A;  2XCQ A;  1UV7 A;  2JA5 K;  2GSN A;  4A3C K;  4A3I K;  1VJE A;  3BUE A;  2Y0S D;  1Y1V K;  4C2M K;  1O28 A;  3GEH A;  3LPX A;  2JA8 K;  3S1Q K;  4YFX A;  2BE5 A;  2ZFZ A;  3M3Y K;  4KN4 A;  1X31 C;  3S1M K;  4KAT A;  2NVX K;  3BP3 A;  1XXC A;  1TWG C;  4LK0 A;  3AQO A;  5L46 A;  5FLM K;  5IOS A;  2RH6 A;  4G7H A;  2E2J K;  1O2F B;  5C4J C;  1SFO C;  5TJ3 A;  2WB1 D;  1I50 A;  4A3K C;  3S1N C;  3V4G A;  3S1R K;  2E2H C;  2PMZ L;  3HKZ D;  1I6H C;  1B4A A;  3N0B A;  3GTK K;  4KN7 A;  3RZD K;  1EQR A;  3GIR A;  1WCM K;  1TWG A;  1IW7 A;  3H0G C;  5M5W K;  3FKI C;  2FQO A;  1ZYR A;  1TWF C;  1ZBS A;  4BY7 C;  4A3E K;  4GT9 A;  3PO2 C;  4GTE A;  3S14 C;  3S15 C;  1K83 A;  4OIP A; 
#chains in the Genus database with same CATH homology
 4Y7N K;  3HOU K;  5C4X K;  2WAQ L;  2B63 C;  3GTP C;  4YFN A;  5M5X K;  1Y1W C;  1HQM A;  4C3H K;  4A3I C;  4A3C C;  5IYD K;  2A68 A;  4Y52 K;  1Y1V C;  2VUM C;  1TWH C;  4X6A C;  2NVT K;  1I3Q K;  1YNN A;  3K7A K;  4LK1 A;  4Q5S A;  3S2D C;  3S17 K;  3S1Q C;  4BY1 K;  3M3Y C;  2R93 K;  4ZH4 A;  4BBR K;  2JA6 C;  2JA8 C;  3H3V L;  3RZO C;  1I6H K;  3M4O C;  1BDF A;  3DXJ A;  4LJZ A;  2A6H A;  1R9T K;  4A3D C;  4QIW D;  4AYB L;  3GTJ C;  4G7Z A;  4OIN A;  3GTG C;  3PO3 K;  4A3F K;  3S2H C;  1TWC K;  4A3G K;  3HOZ C;  3S16 K;  1TWG K;  1TWA C;  2Y0S L;  2NVY K;  4BXX C;  4A3J K;  1SMY A;  5IP9 K;  5IP7 C;  2JA5 C;  3GTM C;  3HOV K;  2R7Z C;  2E2I K;  3I4M C;  3PO2 K;  5IYC C;  3S14 K;  4XSX A;  5C4J K;  1SFO K;  3S15 K;  3S1R C;  1K83 K;  2YU9 K;  2E2H K;  4BBS C;  3S1N K;  5TMF A;  5C44 C;  2PA8 D;  4G7O A;  4QIW L;  4AYB D;  4Y52 C;  1TWH K;  3S1M C;  4JK1 A;  3GTO C;  1YNJ A;  2PPB A;  5M5Y K;  2NVQ K;  1WCM C;  5C3E C;  3GTK C;  3H0G K;  3I4N K;  2R93 C;  4BBR C;  2JA6 K;  4A93 K;  2JA7 K;  2CW0 A;  5FJ8 K;  3HOW K;  3FKI K;  3HOY K;  4BY7 K;  4YG2 A;  4A3B K;  4A3D K;  2E2J C;  4A3M K;  3GTJ K;  3GTG K;  1TWF K;  4C3I K;  4A3L C;  4YFK A;  4OIO A;  2R92 K;  3GTQ C;  3S2H K;  5C4X C;  4A3K K;  4QJV B;  4A3J C;  5IP7 K;  2JA5 K;  2PA8 L;  4KMU A;  4Y7N C;  3HOU C;  5IYB K;  1XPP A;  4X6A K;  1I3Q C;  1Y1W K;  3WOD A;  4A3C K;  4A3I K;  3S2D K;  5IYD C;  2Y0S D;  2O5J A;  1Y1V K;  1I50 K;  4XSZ A;  4C2M K;  3GTL C;  1K83 C;  3K7A C;  1I6V A;  2WB1 L;  4LLG A;  4MEY A;  4QJV A;  4XLP A;  3HOX C;  3RZD C;  2JA8 K;  4YFX A;  3RZO K;  3S1Q K;  4C3J K;  2BE5 A;  3M3Y K;  2WAQ D;  4KN4 A;  3CQZ C;  3S1M K;  2PMZ D;  5M3F K;  5M3M K;  3HKZ L;  2A69 A;  2NVX K;  1TWC C;  4A3E C;  3GTO K;  3HOZ K;  3S16 C;  1TWG C;  4LK0 A;  2NVY C;  4MQ9 A;  3PO3 C;  5FLM K;  2JA7 C;  3GTM K;  3HOV C;  5D4D A;  2B63 K;  3GTP K;  3I4M K;  2E2I C;  5IP9 C;  4G7H A;  2O5I A;  2R7Z K;  2E2J K;  5C4J C;  1SFO C;  3H3V D;  2VUM K;  4A3L K;  2R92 C;  2NVT C;  2WB1 D;  2YU9 C;  3GTQ K;  4MEX A;  4A3K C;  3S1N C;  3S17 C;  4BY1 C;  5C44 K;  4OIQ A;  3S1R K;  2E2H C;  4BBS K;  4GZY A;  2PMZ L;  5IYB C;  3HKZ D;  1I6H C;  2NVQ C;  3M4O K;  3GTK K;  1R9T C;  1I50 C;  3GTL K;  4KN7 A;  4OIR A;  4XLN A;  3EQL A;  3RZD K;  4A3F C;  3HOX K;  4A3G C;  1WCM K;  5C3E K;  3I4N C;  1IW7 A;  3H0G C;  5M5W K;  1TWA K;  2A6E A;  3FKI C;  4BXX K;  4Q4Z A;  4A3B C;  4A93 C;  3CQZ K;  4A3M C;  1ZYR A;  3HOW C;  1TWF C;  4NOI A;  2NVX C;  3HOY C;  4A3E K;  4BY7 C;  3PO2 C;  5IYC K;  3S14 C;  3S15 C;  5TMC A;  4OIP A;  5FLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...