3GTMK

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtmK00
5TMFA 4C3IK 3RZOK 4YFKA 5TMCA 3GTMK 4X6AK 2E2IC 3GTOC 4A3MC 3M4OK 4A3LC 4AYBL 2E2IK 2NVQC 3GTKK 4BBRC 3GTOK 3EQLA 4A3LK 3FKIC 4QJVB 4A3KC 4A3CC 4BBRK 1Y1WC 3PO2C 3S1NC 5M5XK 2R92C 3DXJA 1Y1WK 4A3CK 5IP9C 1SFOC 2O5JA 3HKZD 3I4MC 4XLPA 4BBSC 3M3YC 2R92K 3I4NK 2WAQD 5IP9K 1WCMC 4A3IK 4Q4ZA 1SFOK 3GTGC 3I4MK 5IYDC 3K7AC 3S15C 2WB1D 3H3VL 1WCMK 2NVXC 3GTGK 5C4XC 3S14K 5IYDK 3HOUC 3S15K 3S1QC 1K83C 1I3QC 2PMZD 5C3EC 3S1MC 5C4XK 3RZOC 1TWCK 2PA8L 4C3JK 4OIQA 3HOUK 3S1QK 4X6AC 1K83K 1I3QK 4KN7A 5C3EK 3S1MK 4A3DK 3M4OC 2A68A 2JA7K 4AYBD 5IYCC 3GTKC 4GZYA 4LLGA 1TWFC 1I6VA 5IYCK 1TWFK 2R93K 3S16C 5FJ8K 3HOWC 3HOVC 4A3GC 1SMYA 4QJVA 3I4NC 4KN4A 3S16K 4A3JC 4C2MK 4A3IC 3HOWK 3HOVK 4A3BK 1I6HC 4A3GK 4NOIA 5M3FK 3CQZC 4A3JK 5M5WK 1I6HK 3GTJC 2Y0SL 1I50C 3GTQK 1TWGC 3H3VD 3S14C 3CQZK 1ZYRA 3GTJK 4OIPA 1I50K 1TWCC 1TWGK 1YNJA 1YNNA 2PA8D 4BXXC 4LK0A 3HOZK 3GTPC 2JA7C 4BXXK 4Q5SA 1BDFA 4Y52K 3HOYC 4JK1A 3GTPK 4A3DC 5FLMC 4MQ9A 4BY1C 2CW0A 3HOYK 2R93C 1TWAC 5FLMK 4BY1K 3PO3K 4LJZA 1TWAK 1IW7A 4A3FK 2R7ZC 3HKZL 4KMUA 4A3BC 1XPPA 2B63C 5IYBK 4XSZA 2R7ZK 4QIWL 4Y7NK 4XSXA 1R9TC 2B63K 3GTQC 1TWHC 2JA8K 2Y0SD 5C4JC 4OIRA 2JA6C 4YG2A 4A3EC 3HOXC 1R9TK 5IP7K 1TWHK 3S2HC 5C4JK 4G7ZA 2PMZL 2JA6K 4A3EK 2A69A 3WODA 3HOXK 4C3HK 3HOZC 4OIOA 3S2HK 3S2DC 4Y52C 2A6HA 3RZDC 4XLNA 4ZH4A 3S2DK 3S17C 4A93C 4BY7C 1HQMA 5D4DA 4A3MK 3RZDK 4G7OA 4YFXA 3S17K 3H0GC 2NVQK 4A93K 2O5IA 4BY7K 5C44C 3PO3C 4A3FC 3FKIK 2VUMC 4A3KK 3H0GK 5C44K 3PO2K 2BE5A 3S1NK 4G7HA 5IYBC 2VUMK 3S1RC 3GTLC 4Y7NC 4QIWD 2YU9C 2WAQL 2E2HC 2JA5C 1Y1VC 3S1RK 3GTLK 3M3YK 4YFNA 4BBSK 2A6EA 5IP7C 2YU9K 2WB1L 2E2HK 2JA5K 1Y1VK 3K7AK 2E2JK 2E2JC 2NVXK 2NVYC 2NVTC 2JA8C 5M3MK 2PPBA 4MEXA 4LK1A 5M5YK 3GTMC 2NVTK 2NVYK 4MEYA 4OINA
chains in the Genus database with same CATH superfamily
5TMFA 3G4AA 4KM8A 1WORA 1WQHA 3T00A 3GTMK 1PJ7A 4PAAA 3GTOC 4A3LC 1KQ4A 4AYBL 3EQLA 2PHCB 1R9TA 4A3CC 1TWHA 4BBRK 1Y1WC 2P5MA 3BP3A 3DXJA 1DCPA 2O5JA 5IP9C 3GSIA 3N0CA 2R92K 4G0WA 1WCMC 1SFOK 4FZBA 5IYDC 2WB1D 2NVXC 3GTGK 4GTBA 3S15K 1I3QC 3RZOC 2P8TA 4X6AC 2V6TA 4KN7A 1BJTA 1EI6A 5IYCC 4LR2A 1USMA 3IPJA 1TWFK 3LAPA 3S16C 4C2MC 2CFAA 5FJ8K 4A3GC 4QJVA 1IBAA 4KN4A 3AQPA 3HOVK 4WILA 1I6HC 1INNA 1RU0A 3L4KA 1I50C 3H3VD 3GTOA 3TFHA 3GTJK 5IORA 1TWCC 1TWGK 1YNNA 1VLOA 4GTCA 1Y1WA 4Q5SA 1BDFA 3FOFA 3GTPK 2GAGC 2D6FC 4MQ9A 2CW0A 3HOYK 1WCMA 3S0XA 2FQOA 4LJZA 2R7ZC 3HKZL 4A3BC 3OEPA 1I3QA 2GSNA 2B63K 3GTQC 4BLBA 5HL8A 1WOOA 5C4JK 2JA6K 1X31C 3HOXK 4C3HK 3HOZC 1C0AA 1VJEA 4LOWA 3S2DC 1WSVA 4KAWX 3RZDC 1HQMA 5D4DA 4G7OA 1G51A 1USOA 4C45A 1WIHA 5IOTA 1I50A 4P5AA 1WOPA 3AQOA 4QIWD 2E2HC 1Y1VC 1F7UA 2YU9K 2NVXK 5M3MK 4WJ4A 4MEXA 4KATA 5M5YK 2E2JK 3RZOK 4YFKA 3SZZA 4P5BA 3LPXA 4X6AK 2R7ZA 1ZBSA 1O2AA 2Y3PA 2E2IK 1J6WA 4XCHA 2NVQC 2FQTA 2CFAB 4KM9A 3FKIC 4QJVB 4A3KC 3S1NC 3AH5A 3I4MC 4BBSC 1EQRA 2WAQD 3K7AC 5JVOA 2ZFZA 4C3JC 3S1QC 1K83C 5C3EC 2PMZD 3S1MC 4A3DC 5C4XK 1TWCK 4OIQA 3HOUK 4AH6A 3TFJA 3M4OC 1O24A 4AYBD 4LLGA 1PJ6A 1I6VA 1VH2A 2E2HA 1Y1VA 3G4CA 3GEIA 3T02A 1O2FB 1SMYA 4A3JC 4A3IC 3HOWK 4A3BK 4NOIA 5M5WK 2RGRA 3AD8C 2Y0SL 3GTQK 3CQZK 1ZYRA 3AD7C 3HXAA 3FKIA 3HOZK 2RH6A 1XZPA 4BXXK 4GT9A 4JK1A 3GEHA 1EK8A 2R93C 3A8KA 1TWAC 5FLMK 4BY1K 3JSTA 4O2DA 4KMUA 1K83A 4XSZA 1ISEA 4XSXA 1ZQ1C 5IOQA 1F93A 2V6UA 5IOSA 4OIRA 4YG2A 4PABA 1R9TK 1TWHK 3LAJA 4G7ZA 4A3EK 2A69A 1IS1A 4OIOA 3S2HK 3ADAC 4GTAA 4A93C 1XXAA 3SZYA 3A8IA 1XXCA 3GDZA 3H0GC 2NVQK 3S17K 4GTFA 4BY7K 4A3FC 3GEEA 1EH1A 3FKIK 1EFWA 4A3KK 1JVIA 2GSOA 2VUMC 2W7VA 5C44K 3S1NK 4M1XA 4RMFA 2KWAA 3GTLC 4BBSK 2JA5C 3S1RK 5CJ9A 4YFNA 5IP7C 3K7AK 1O27A 2NVYC 2NVTC 4LK1A 3GTMC 2R93A 1TWAA 4MEYA 2JA8K 1BGWA 1DCOA 4A3MC 3M4OK 4KB2A 1DD5A 4BBRC 3GTOK 4A3LK 3QX3A 4GTEA 3PO2C 5M5XK 2R92C 4A3CK 1Y1WK 1SFOC 1IL2A 3AD9C 4KDDA 5IP9K 4A3IK 4Q4ZA 3GTGC 1J98A 3S15C 1WCMK 1WQFA 5IYDK 1XZPB 4C3IC 3H0GA 2PA8L 2GSUA 4KARA 1I3QK 4KASA 3BP8C 2VUMA 1YX2A 3GTKC 4GZYA 3FHZA 3GTLA 1TWFC 3TFIA 1IQ0A 5IYCK 2JA5A 3CAGA 4FM9A 2R93K 1BS2A 3HOVC 2NVYA 3I4NC 3S16K 4C2MK 3GTMA 1L0WA 4A3GK 5M3FK 3OPFA 1I6HK 3GTJC 2XCOA 3S14C 1VRQC 1TWGC 4OIPA 1I50K 1YNJA 4WJ3M 4LK0A 3GTPC 2JA7C 2R92A 3HOYC 1SFOA 1B4AA 3GTGA 1ZXOA 4A3FK 1XPPA 1F9NA 2B63C 2R7ZK 3NUHA 1O26A 1DCHA 2Y0SD 1JOEA 5C4JC 2XCRB 4G0UA 2JA6C 4J3NA 5EGHA 4BLAA 3HOXC 3GTKA 4C3HC 5IP7K 2PMZL 1TWFA 1O28A 1JQWA 1HI9A 2ZUEA 1VGXA 4Y52C 2A6HA 4ZH4A 3S2DK 1XZQB 4G0VA 4KC6A 1O29A 4A3MK 3RZDK 4YFXA 1J6VA 2O5IA 3PO3C 2JH3A 3GTJA 1TWGA 4GFQA 3BUEA 3PO2K 2BE5A 5IYBC 4Y7NC 3TTGA 2YU9C 1IE0A 3N0BA 3GTPA 4GTDA 2JA7A 2WB1L 2E2HK 1Y1VK 2E2JC 2PPBA 3ERED 4OINA 4C3IK 5TMCA 4KMAA 2E2IC 5TJ3A 3OREA 5CHPA 3N3YA 2B63A 3GTKK 3V4GA 1J6XA 2JA6A 3HKZD 4XLPA 3M3YC 3I4NK 1V5VA 3I4MK 2XCQA 3H3VL 5C4XC 3S14K 3HOUC 1O2BA 4C3JK 1XXBA 3S1QK 1K83K 5C3EK 3S1MK 4A3DK 4LQYA 2A68A 2JA7K 2YU9A 5L46A 2NVXA 5E68A 3FOEA 1XZQA 4GTLA 3HOWC 1UV7A 4KMHA 1PJ5A 2ZUFA 3CQZC 4A3JK 2E2IA 1WQGA 2V6SA 1F7VA 3L4JA 2PA8D 2EBBA 4BXXC 4Y52K 1WOSA 4DDQA 5FLMC 4BY1C 1ZVUA 1WSRA 3PO3K 1TWAK 1IW7A 1TWCA 5IYBK 5EGEA 4QIWL 4Y7NK 1R9TC 3A8JA 1TWHC 3GIRA 4A3EC 3S2HC 1GE9A 3WODA 3MMLB 4KB4A 3T01A 4XLNA 1O25A 3S17C 4BY7C 5JFEA 3VA7A 3GTQA 4A93K 3CQZA 5C44C 3Q3QA 3H0GK 1AB4A 4G7HA 2VUMK 3S1RC 4KMDA 2WAQL 3M3YK 3GTLK 2GAHC 2A6EA 4ILDA 2JA5K 4BKWA 2JA8C 4P9SA 1YCLA 2NVTK 2NVYK 1B4BA
chains in the Genus database with same CATH topology
5TMFA 4C3IK 3RZOK 4YFKA 5TMCA 3GTMK 4X6AK 2E2IC 3GTOC 4A3MC 3M4OK 4A3LC 4AYBL 2E2IK 2NVQC 3GTKK 4BBRC 3GTOK 3EQLA 4A3LK 3FKIC 4QJVB 4A3KC 4A3CC 4BBRK 1Y1WC 3PO2C 3S1NC 5M5XK 2R92C 3DXJA 1Y1WK 4A3CK 5IP9C 1SFOC 2O5JA 3HKZD 3I4MC 4XLPA 4BBSC 3M3YC 2R92K 3I4NK 2WAQD 5IP9K 1WCMC 4A3IK 4Q4ZA 1SFOK 3GTGC 3I4MK 5IYDC 3K7AC 3S15C 2WB1D 3H3VL 1WCMK 2NVXC 3GTGK 5C4XC 3S14K 5IYDK 3HOUC 3S15K 3S1QC 1K83C 1I3QC 2PMZD 5C3EC 3S1MC 5C4XK 3RZOC 1TWCK 2PA8L 4C3JK 4OIQA 3HOUK 3S1QK 4X6AC 1K83K 1I3QK 4KN7A 5C3EK 3S1MK 4A3DK 3M4OC 2A68A 2JA7K 4AYBD 5IYCC 3GTKC 4GZYA 4LLGA 1TWFC 1I6VA 5IYCK 1TWFK 2R93K 3S16C 5FJ8K 3HOWC 3HOVC 4A3GC 1SMYA 4QJVA 3I4NC 4KN4A 3S16K 4A3JC 4C2MK 4A3IC 3HOWK 3HOVK 4A3BK 1I6HC 4A3GK 4NOIA 5M3FK 3CQZC 4A3JK 5M5WK 1I6HK 3GTJC 2Y0SL 1I50C 3GTQK 1TWGC 3H3VD 3S14C 3CQZK 1ZYRA 3GTJK 4OIPA 1I50K 1TWCC 1TWGK 1YNJA 1YNNA 2PA8D 4BXXC 4LK0A 3HOZK 3GTPC 2JA7C 4BXXK 4Q5SA 1BDFA 4Y52K 3HOYC 4JK1A 3GTPK 4A3DC 5FLMC 4MQ9A 4BY1C 2CW0A 3HOYK 2R93C 1TWAC 5FLMK 4BY1K 3PO3K 4LJZA 1TWAK 1IW7A 4A3FK 2R7ZC 3HKZL 4KMUA 4A3BC 1XPPA 2B63C 5IYBK 4XSZA 2R7ZK 4QIWL 4Y7NK 4XSXA 1R9TC 2B63K 3GTQC 1TWHC 2JA8K 2Y0SD 5C4JC 4OIRA 2JA6C 4YG2A 4A3EC 3HOXC 1R9TK 5IP7K 1TWHK 3S2HC 5C4JK 4G7ZA 2PMZL 2JA6K 4A3EK 2A69A 3WODA 3HOXK 4C3HK 3HOZC 4OIOA 3S2HK 3S2DC 4Y52C 2A6HA 3RZDC 4XLNA 4ZH4A 3S2DK 3S17C 4A93C 4BY7C 1HQMA 5D4DA 4A3MK 3RZDK 4G7OA 4YFXA 3S17K 3H0GC 2NVQK 4A93K 2O5IA 4BY7K 5C44C 3PO3C 4A3FC 3FKIK 2VUMC 4A3KK 3H0GK 5C44K 3PO2K 2BE5A 3S1NK 4G7HA 5IYBC 2VUMK 3S1RC 3GTLC 4Y7NC 4QIWD 2YU9C 2WAQL 2E2HC 2JA5C 1Y1VC 3S1RK 3GTLK 3M3YK 4YFNA 4BBSK 2A6EA 5IP7C 2YU9K 2WB1L 2E2HK 2JA5K 1Y1VK 3K7AK 2E2JK 2E2JC 2NVXK 2NVYC 2NVTC 2JA8C 5M3MK 2PPBA 4MEXA 4LK1A 5M5YK 3GTMC 2NVTK 2NVYK 4MEYA 4OINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TMF A;  4C3I K;  3RZO K;  4YFK A;  5TMC A;  3GTM K;  4X6A K;  2E2I C;  3GTO C;  4A3M C;  3M4O K;  4A3L C;  4AYB L;  2E2I K;  2NVQ C;  3GTK K;  4BBR C;  3GTO K;  3EQL A;  4A3L K;  3FKI C;  4QJV B;  4A3K C;  4A3C C;  4BBR K;  1Y1W C;  3PO2 C;  3S1N C;  5M5X K;  2R92 C;  3DXJ A;  1Y1W K;  4A3C K;  5IP9 C;  1SFO C;  2O5J A;  3HKZ D;  3I4M C;  4XLP A;  4BBS C;  3M3Y C;  2R92 K;  3I4N K;  2WAQ D;  5IP9 K;  1WCM C;  4A3I K;  4Q4Z A;  1SFO K;  3GTG C;  3I4M K;  5IYD C;  3K7A C;  3S15 C;  2WB1 D;  3H3V L;  1WCM K;  2NVX C;  3GTG K;  5C4X C;  3S14 K;  5IYD K;  3HOU C;  3S15 K;  3S1Q C;  1K83 C;  1I3Q C;  2PMZ D;  5C3E C;  3S1M C;  5C4X K;  3RZO C;  1TWC K;  2PA8 L;  4C3J K;  4OIQ A;  3HOU K;  3S1Q K;  4X6A C;  1K83 K;  1I3Q K;  4KN7 A;  5C3E K;  3S1M K;  4A3D K;  3M4O C;  2A68 A;  2JA7 K;  4AYB D;  5IYC C;  3GTK C;  4GZY A;  4LLG A;  1TWF C;  1I6V A;  5IYC K;  1TWF K;  2R93 K;  3S16 C;  5FJ8 K;  3HOW C;  3HOV C;  4A3G C;  1SMY A;  4QJV A;  3I4N C;  4KN4 A;  3S16 K;  4A3J C;  4C2M K;  4A3I C;  3HOW K;  3HOV K;  4A3B K;  1I6H C;  4A3G K;  4NOI A;  5M3F K;  3CQZ C;  4A3J K;  5M5W K;  1I6H K;  3GTJ C;  2Y0S L;  1I50 C;  3GTQ K;  1TWG C;  3H3V D;  3S14 C;  3CQZ K;  1ZYR A;  3GTJ K;  4OIP A;  1I50 K;  1TWC C;  1TWG K;  1YNJ A;  1YNN A;  2PA8 D;  4BXX C;  4LK0 A;  3HOZ K;  3GTP C;  2JA7 C;  4BXX K;  4Q5S A;  1BDF A;  4Y52 K;  3HOY C;  4JK1 A;  3GTP K;  4A3D C;  5FLM C;  4MQ9 A;  4BY1 C;  2CW0 A;  3HOY K;  2R93 C;  1TWA C;  5FLM K;  4BY1 K;  3PO3 K;  4LJZ A;  1TWA K;  1IW7 A;  4A3F K;  2R7Z C;  3HKZ L;  4KMU A;  4A3B C;  1XPP A;  2B63 C;  5IYB K;  4XSZ A;  2R7Z K;  4QIW L;  4Y7N K;  4XSX A;  1R9T C;  2B63 K;  3GTQ C;  1TWH C;  2JA8 K;  2Y0S D;  5C4J C;  4OIR A;  2JA6 C;  4YG2 A;  4A3E C;  3HOX C;  1R9T K;  5IP7 K;  1TWH K;  3S2H C;  5C4J K;  4G7Z A;  2PMZ L;  2JA6 K;  4A3E K;  2A69 A;  3WOD A;  3HOX K;  4C3H K;  3HOZ C;  4OIO A;  3S2H K;  3S2D C;  4Y52 C;  2A6H A;  3RZD C;  4XLN A;  4ZH4 A;  3S2D K;  3S17 C;  4A93 C;  4BY7 C;  1HQM A;  5D4D A;  4A3M K;  3RZD K;  4G7O A;  4YFX A;  3S17 K;  3H0G C;  2NVQ K;  4A93 K;  2O5I A;  4BY7 K;  5C44 C;  3PO3 C;  4A3F C;  3FKI K;  2VUM C;  4A3K K;  3H0G K;  5C44 K;  3PO2 K;  2BE5 A;  3S1N K;  4G7H A;  5IYB C;  2VUM K;  3S1R C;  3GTL C;  4Y7N C;  4QIW D;  2YU9 C;  2WAQ L;  2E2H C;  2JA5 C;  1Y1V C;  3S1R K;  3GTL K;  3M3Y K;  4YFN A;  4BBS K;  2A6E A;  5IP7 C;  2YU9 K;  2WB1 L;  2E2H K;  2JA5 K;  1Y1V K;  3K7A K;  2E2J K;  2E2J C;  2NVX K;  2NVY C;  2NVT C;  2JA8 C;  5M3M K;  2PPB A;  4MEX A;  4LK1 A;  5M5Y K;  3GTM C;  2NVT K;  2NVY K;  4MEY A;  4OIN A; 
#chains in the Genus database with same CATH topology
 5TMF A;  3G4A A;  4KM8 A;  1WOR A;  1WQH A;  3T00 A;  3GTM K;  1PJ7 A;  4PAA A;  3GTO C;  4A3L C;  1KQ4 A;  4AYB L;  3EQL A;  2PHC B;  1R9T A;  4A3C C;  1TWH A;  4BBR K;  1Y1W C;  2P5M A;  3BP3 A;  3DXJ A;  1DCP A;  2O5J A;  5IP9 C;  3GSI A;  3N0C A;  2R92 K;  4G0W A;  1WCM C;  1SFO K;  4FZB A;  5IYD C;  2WB1 D;  2NVX C;  3GTG K;  4GTB A;  3S15 K;  1I3Q C;  3RZO C;  2P8T A;  4X6A C;  2V6T A;  4KN7 A;  1BJT A;  1EI6 A;  5IYC C;  4LR2 A;  1USM A;  3IPJ A;  1TWF K;  3LAP A;  3S16 C;  4C2M C;  2CFA A;  5FJ8 K;  4A3G C;  4QJV A;  1IBA A;  4KN4 A;  3AQP A;  3HOV K;  4WIL A;  1I6H C;  1INN A;  1RU0 A;  3L4K A;  1I50 C;  3H3V D;  3GTO A;  3TFH A;  3GTJ K;  5IOR A;  1TWC C;  1TWG K;  1YNN A;  1VLO A;  4GTC A;  1Y1W A;  4Q5S A;  1BDF A;  3FOF A;  3GTP K;  2GAG C;  2D6F C;  4MQ9 A;  2CW0 A;  3HOY K;  1WCM A;  3S0X A;  2FQO A;  4LJZ A;  2R7Z C;  3HKZ L;  4A3B C;  3OEP A;  1I3Q A;  2GSN A;  2B63 K;  3GTQ C;  4BLB A;  5HL8 A;  1WOO A;  5C4J K;  2JA6 K;  1X31 C;  3HOX K;  4C3H K;  3HOZ C;  1C0A A;  1VJE A;  4LOW A;  3S2D C;  1WSV A;  4KAW X;  3RZD C;  1HQM A;  5D4D A;  4G7O A;  1G51 A;  1USO A;  4C45 A;  1WIH A;  5IOT A;  1I50 A;  4P5A A;  1WOP A;  3AQO A;  4QIW D;  2E2H C;  1Y1V C;  1F7U A;  2YU9 K;  2NVX K;  5M3M K;  4WJ4 A;  4MEX A;  4KAT A;  5M5Y K;  2E2J K;  3RZO K;  4YFK A;  3SZZ A;  4P5B A;  3LPX A;  4X6A K;  2R7Z A;  1ZBS A;  1O2A A;  2Y3P A;  2E2I K;  1J6W A;  4XCH A;  2NVQ C;  2FQT A;  2CFA B;  4KM9 A;  3FKI C;  4QJV B;  4A3K C;  3S1N C;  3AH5 A;  3I4M C;  4BBS C;  1EQR A;  2WAQ D;  3K7A C;  5JVO A;  2ZFZ A;  4C3J C;  3S1Q C;  1K83 C;  5C3E C;  2PMZ D;  3S1M C;  4A3D C;  5C4X K;  1TWC K;  4OIQ A;  3HOU K;  4AH6 A;  3TFJ A;  3M4O C;  1O24 A;  4AYB D;  4LLG A;  1PJ6 A;  1I6V A;  1VH2 A;  2E2H A;  1Y1V A;  3G4C A;  3GEI A;  3T02 A;  1O2F B;  1SMY A;  4A3J C;  4A3I C;  3HOW K;  4A3B K;  4NOI A;  5M5W K;  2RGR A;  3AD8 C;  2Y0S L;  3GTQ K;  3CQZ K;  1ZYR A;  3AD7 C;  3HXA A;  3FKI A;  3HOZ K;  2RH6 A;  1XZP A;  4BXX K;  4GT9 A;  4JK1 A;  3GEH A;  1EK8 A;  2R93 C;  3A8K A;  1TWA C;  5FLM K;  4BY1 K;  3JST A;  4O2D A;  4KMU A;  1K83 A;  4XSZ A;  1ISE A;  4XSX A;  1ZQ1 C;  5IOQ A;  1F93 A;  2V6U A;  5IOS A;  4OIR A;  4YG2 A;  4PAB A;  1R9T K;  1TWH K;  3LAJ A;  4G7Z A;  4A3E K;  2A69 A;  1IS1 A;  4OIO A;  3S2H K;  3ADA C;  4GTA A;  4A93 C;  1XXA A;  3SZY A;  3A8I A;  1XXC A;  3GDZ A;  3H0G C;  2NVQ K;  3S17 K;  4GTF A;  4BY7 K;  4A3F C;  3GEE A;  1EH1 A;  3FKI K;  1EFW A;  4A3K K;  1JVI A;  2GSO A;  2VUM C;  2W7V A;  5C44 K;  3S1N K;  4M1X A;  4RMF A;  2KWA A;  3GTL C;  4BBS K;  2JA5 C;  3S1R K;  5CJ9 A;  4YFN A;  5IP7 C;  3K7A K;  1O27 A;  2NVY C;  2NVT C;  4LK1 A;  3GTM C;  2R93 A;  1TWA A;  4MEY A;  2JA8 K;  1BGW A;  1DCO A;  4A3M C;  3M4O K;  4KB2 A;  1DD5 A;  4BBR C;  3GTO K;  4A3L K;  3QX3 A;  4GTE A;  3PO2 C;  5M5X K;  2R92 C;  4A3C K;  1Y1W K;  1SFO C;  1IL2 A;  3AD9 C;  4KDD A;  5IP9 K;  4A3I K;  4Q4Z A;  3GTG C;  1J98 A;  3S15 C;  1WCM K;  1WQF A;  5IYD K;  1XZP B;  4C3I C;  3H0G A;  2PA8 L;  2GSU A;  4KAR A;  1I3Q K;  4KAS A;  3BP8 C;  2VUM A;  1YX2 A;  3GTK C;  4GZY A;  3FHZ A;  3GTL A;  1TWF C;  3TFI A;  1IQ0 A;  5IYC K;  2JA5 A;  3CAG A;  4FM9 A;  2R93 K;  1BS2 A;  3HOV C;  2NVY A;  3I4N C;  3S16 K;  4C2M K;  3GTM A;  1L0W A;  4A3G K;  5M3F K;  3OPF A;  1I6H K;  3GTJ C;  2XCO A;  3S14 C;  1VRQ C;  1TWG C;  4OIP A;  1I50 K;  1YNJ A;  4WJ3 M;  4LK0 A;  3GTP C;  2JA7 C;  2R92 A;  3HOY C;  1SFO A;  1B4A A;  3GTG A;  1ZXO A;  4A3F K;  1XPP A;  1F9N A;  2B63 C;  2R7Z K;  3NUH A;  1O26 A;  1DCH A;  2Y0S D;  1JOE A;  5C4J C;  2XCR B;  4G0U A;  2JA6 C;  4J3N A;  5EGH A;  4BLA A;  3HOX C;  3GTK A;  4C3H C;  5IP7 K;  2PMZ L;  1TWF A;  1O28 A;  1JQW A;  1HI9 A;  2ZUE A;  1VGX A;  4Y52 C;  2A6H A;  4ZH4 A;  3S2D K;  1XZQ B;  4G0V A;  4KC6 A;  1O29 A;  4A3M K;  3RZD K;  4YFX A;  1J6V A;  2O5I A;  3PO3 C;  2JH3 A;  3GTJ A;  1TWG A;  4GFQ A;  3BUE A;  3PO2 K;  2BE5 A;  5IYB C;  4Y7N C;  3TTG A;  2YU9 C;  1IE0 A;  3N0B A;  3GTP A;  4GTD A;  2JA7 A;  2WB1 L;  2E2H K;  1Y1V K;  2E2J C;  2PPB A;  3ERE D;  4OIN A;  4C3I K;  5TMC A;  4KMA A;  2E2I C;  5TJ3 A;  3ORE A;  5CHP A;  3N3Y A;  2B63 A;  3GTK K;  3V4G A;  1J6X A;  2JA6 A;  3HKZ D;  4XLP A;  3M3Y C;  3I4N K;  1V5V A;  3I4M K;  2XCQ A;  3H3V L;  5C4X C;  3S14 K;  3HOU C;  1O2B A;  4C3J K;  1XXB A;  3S1Q K;  1K83 K;  5C3E K;  3S1M K;  4A3D K;  4LQY A;  2A68 A;  2JA7 K;  2YU9 A;  5L46 A;  2NVX A;  5E68 A;  3FOE A;  1XZQ A;  4GTL A;  3HOW C;  1UV7 A;  4KMH A;  1PJ5 A;  2ZUF A;  3CQZ C;  4A3J K;  2E2I A;  1WQG A;  2V6S A;  1F7V A;  3L4J A;  2PA8 D;  2EBB A;  4BXX C;  4Y52 K;  1WOS A;  4DDQ A;  5FLM C;  4BY1 C;  1ZVU A;  1WSR A;  3PO3 K;  1TWA K;  1IW7 A;  1TWC A;  5IYB K;  5EGE A;  4QIW L;  4Y7N K;  1R9T C;  3A8J A;  1TWH C;  3GIR A;  4A3E C;  3S2H C;  1GE9 A;  3WOD A;  3MML B;  4KB4 A;  3T01 A;  4XLN A;  1O25 A;  3S17 C;  4BY7 C;  5JFE A;  3VA7 A;  3GTQ A;  4A93 K;  3CQZ A;  5C44 C;  3Q3Q A;  3H0G K;  1AB4 A;  4G7H A;  2VUM K;  3S1R C;  4KMD A;  2WAQ L;  3M3Y K;  3GTL K;  2GAH C;  2A6E A;  4ILD A;  2JA5 K;  4BKW A;  2JA8 C;  4P9S A;  1YCL A;  2NVT K;  2NVY K;  1B4B A; 
#chains in the Genus database with same CATH homology
 5TMF A;  4C3I K;  3RZO K;  4YFK A;  5TMC A;  3GTM K;  4X6A K;  2E2I C;  3GTO C;  4A3M C;  3M4O K;  4A3L C;  4AYB L;  2E2I K;  2NVQ C;  3GTK K;  4BBR C;  3GTO K;  3EQL A;  4A3L K;  3FKI C;  4QJV B;  4A3K C;  4A3C C;  4BBR K;  1Y1W C;  3PO2 C;  3S1N C;  5M5X K;  2R92 C;  3DXJ A;  1Y1W K;  4A3C K;  5IP9 C;  1SFO C;  2O5J A;  3HKZ D;  3I4M C;  4XLP A;  4BBS C;  3M3Y C;  2R92 K;  3I4N K;  2WAQ D;  5IP9 K;  1WCM C;  4A3I K;  4Q4Z A;  1SFO K;  3GTG C;  3I4M K;  5IYD C;  3K7A C;  3S15 C;  2WB1 D;  3H3V L;  1WCM K;  2NVX C;  3GTG K;  5C4X C;  3S14 K;  5IYD K;  3HOU C;  3S15 K;  3S1Q C;  1K83 C;  1I3Q C;  2PMZ D;  5C3E C;  3S1M C;  5C4X K;  3RZO C;  1TWC K;  2PA8 L;  4C3J K;  4OIQ A;  3HOU K;  3S1Q K;  4X6A C;  1K83 K;  1I3Q K;  4KN7 A;  5C3E K;  3S1M K;  4A3D K;  3M4O C;  2A68 A;  2JA7 K;  4AYB D;  5IYC C;  3GTK C;  4GZY A;  4LLG A;  1TWF C;  1I6V A;  5IYC K;  1TWF K;  2R93 K;  3S16 C;  5FJ8 K;  3HOW C;  3HOV C;  4A3G C;  1SMY A;  4QJV A;  3I4N C;  4KN4 A;  3S16 K;  4A3J C;  4C2M K;  4A3I C;  3HOW K;  3HOV K;  4A3B K;  1I6H C;  4A3G K;  4NOI A;  5M3F K;  3CQZ C;  4A3J K;  5M5W K;  1I6H K;  3GTJ C;  2Y0S L;  1I50 C;  3GTQ K;  1TWG C;  3H3V D;  3S14 C;  3CQZ K;  1ZYR A;  3GTJ K;  4OIP A;  1I50 K;  1TWC C;  1TWG K;  1YNJ A;  1YNN A;  2PA8 D;  4BXX C;  4LK0 A;  3HOZ K;  3GTP C;  2JA7 C;  4BXX K;  4Q5S A;  1BDF A;  4Y52 K;  3HOY C;  4JK1 A;  3GTP K;  4A3D C;  5FLM C;  4MQ9 A;  4BY1 C;  2CW0 A;  3HOY K;  2R93 C;  1TWA C;  5FLM K;  4BY1 K;  3PO3 K;  4LJZ A;  1TWA K;  1IW7 A;  4A3F K;  2R7Z C;  3HKZ L;  4KMU A;  4A3B C;  1XPP A;  2B63 C;  5IYB K;  4XSZ A;  2R7Z K;  4QIW L;  4Y7N K;  4XSX A;  1R9T C;  2B63 K;  3GTQ C;  1TWH C;  2JA8 K;  2Y0S D;  5C4J C;  4OIR A;  2JA6 C;  4YG2 A;  4A3E C;  3HOX C;  1R9T K;  5IP7 K;  1TWH K;  3S2H C;  5C4J K;  4G7Z A;  2PMZ L;  2JA6 K;  4A3E K;  2A69 A;  3WOD A;  3HOX K;  4C3H K;  3HOZ C;  4OIO A;  3S2H K;  3S2D C;  4Y52 C;  2A6H A;  3RZD C;  4XLN A;  4ZH4 A;  3S2D K;  3S17 C;  4A93 C;  4BY7 C;  1HQM A;  5D4D A;  4A3M K;  3RZD K;  4G7O A;  4YFX A;  3S17 K;  3H0G C;  2NVQ K;  4A93 K;  2O5I A;  4BY7 K;  5C44 C;  3PO3 C;  4A3F C;  3FKI K;  2VUM C;  4A3K K;  3H0G K;  5C44 K;  3PO2 K;  2BE5 A;  3S1N K;  4G7H A;  5IYB C;  2VUM K;  3S1R C;  3GTL C;  4Y7N C;  4QIW D;  2YU9 C;  2WAQ L;  2E2H C;  2JA5 C;  1Y1V C;  3S1R K;  3GTL K;  3M3Y K;  4YFN A;  4BBS K;  2A6E A;  5IP7 C;  2YU9 K;  2WB1 L;  2E2H K;  2JA5 K;  1Y1V K;  3K7A K;  2E2J K;  2E2J C;  2NVX K;  2NVY C;  2NVT C;  2JA8 C;  5M3M K;  2PPB A;  4MEX A;  4LK1 A;  5M5Y K;  3GTM C;  2NVT K;  2NVY K;  4MEY A;  4OIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...