3GTMK

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtmK00
2PA8L 1Y1VC 3HOWC 3H3VL 1TWHC 5FJ8K 3S17C 4A3EK 4BY1K 2JA5K 3M3YC 3S15C 4A3LK 3S2DC 3S1RC 2NVQK 2R93C 4XLPA 3S16C 2JA6C 3S14K 4LK1A 4Y52C 1R9TK 1TWCC 2R7ZC 1I6HK 5IYDC 1IW7A 4OIRA 3RZOC 5D4DA 2NVXK 3GTGK 3I4MC 1HQMA 2R92C 4BY7K 4QJVB 5TMFA 1Y1WK 4X6AC 2NVTC 1WCMC 4Q5SA 4A3BK 4A3GC 4BXXC 3HOXK 3PO3C 3HOYC 1TWAC 5FLMC 3HOZK 4Y7NC 4A3FK 3S1MK 1SFOK 4JK1A 5M5WK 3GTKC 4GZYA 4KN7A 3FKIK 1BDFA 5TMCA 2JA8C 4A93C 5C4XC 4MEYA 4YG2A 3RZDC 5IYBC 3GTJC 3M3YK 3GTMC 3S15K 2VUMK 2NVYK 3EQLA 4A3JK 5IP7K 3HKZL 1I3QC 2E2IC 4OIQA 5M5YK 3M4OK 1TWFK 4A3IK 1K83K 2A69A 3K7AC 2O5IA 3GTLK 4QJVA 1ZYRA 3I4NK 4A3CK 2BE5A 4BBSC 5M3MK 2A6EA 2YU9C 3RZOK 2WAQD 4BBRC 4C2MK 5M5XK 5C4JK 4A3MC 3S1NC 4OIOA 3GTPK 4X6AK 5IP9C 3GTOK 2B63K 3HOVK 4BXXK 2WB1D 3PO3K 3HOYK 1I50K 3HKZD 4MEXA 3WODA 1YNJA 2CW0A 5M3FK 2E2JK 5IYCK 3S2HC 4A3DK 2E2HK 4OIPA 1TWGK 4A3EC 2WAQL 4XSZA 4XLNA 4BY1C 3PO2C 4A3LC 1Y1VK 4YFXA 2NVQC 3HOWK 1TWHK 5IYBK 4OINA 3S17K 4XSXA 4Q4ZA 3S1RK 2JA7C 3S14C 3S2DK 2R93K 2WB1L 3S16K 3H0GC 4ZH4A 3DXJA 2JA6K 1I6HC 5C44C 4QIWD 3HOUC 1XPPA 4Y52K 4LLGA 1TWCK 2NVXC 3GTGC 2R7ZK 5IYDK 4A3MK 4AYBL 1Y1WC 4A3BC 3I4MK 3HOXC 2R92K 2NVTK 1WCMK 1I6VA 4LJZA 2A6HA 2PMZD 3HOZC 4A3FC 4A3KC 1SFOC 5C3EC 3S1MC 1TWAK 1SMYA 2Y0SD 5FLMK 3GTQC 4QIWL 3FKIC 4Y7NK 3CQZC 3GTKK 4YFNA 4AYBD 2JA8K 4A93K 3PO2K 5C4XK 2PPBA 2JA5C 2VUMC 2NVYC 4C3HK 3RZDK 4A3JC 5IP7C 3GTJK 2JA7K 3GTMK 3S1QC 4LK0A 3M4OC 1TWFC 4A3IC 1K83C 3H0GK 3S1QK 2PMZL 3GTLC 1I3QK 4C3JK 5C44K 1R9TC 2E2IK 3HOUK 3I4NC 3K7AK 4A3CC 2Y0SL 2PA8D 5C4JC 4G7OA 4A3GK 2A68A 3H3VD 3GTPC 4BBSK 4KN4A 2YU9K 4KMUA 4BBRK 2B63C 3GTOC 4BY7C 3S1NK 3HOVC 4G7HA 5IP9K 1I50C 1YNNA 4NOIA 4YFKA 4A3DC 4A3KK 2E2JC 5C3EK 5IYCC 4MQ9A 2E2HC 3GTQK 4C3IK 3S2HK 1TWGC 2O5JA 3CQZK 4G7ZA
chains in the Genus database with same CATH superfamily
4WILA 5L46A 3TTGA 2R92A 4A3LK 1IQ0A 4GTDA 4LK1A 1R9TK 2R7ZC 1IW7A 1XXCA 1DCOA 1WOPA 2D6FC 4KMDA 4BY7K 1Y1WK 2NVTC 2ZFZA 2GAGC 2XCOA 4PAAA 4A3BK 1DCPA 1XZQA 1TWAC 5FLMC 5IOQA 4A3FK 1O27A 3AD7C 3GIRA 5M5WK 2NVXA 5IOTA 3GTGA 4MEYA 4YG2A 3M3YK 2VUMK 5IP7K 1ZXOA 1I3QC 4FZBA 2BE5A 1O25A 3AQPA 3RZOK 2WAQD 4A3MC 4G0UA 5C4JK 4OIOA 4X6AK 5IP9C 2JA5A 4GTEA 3T00A 3HOVK 1WSRA 4GTBA 3PO3K 3HOYK 2FQTA 4MEXA 4A3DK 2E2JK 4G0WA 4C45A 2E2HK 2RH6A 4OIPA 3SZZA 1TWGK 3GTPA 4XSZA 3GTOA 2JH3A 3IPJA 1WOSA 2P8TA 1XZPA 2JA7C 4Q4ZA 3H0GC 5E68A 4WJ4A 1SFOA 3FHZA 3MMLB 2R7ZK 3QX3A 4RMFA 1ISEA 4P9SA 5CJ9A 3HOXC 3TFIA 2NVTK 4LJZA 2A6HA 1VGXA 2PMZD 5C3EC 2GSNA 1TWAK 3CAGA 2FQOA 5FLMK 1WOOA 3GTLA 4YFNA 4KDDA 1F93A 2PPBA 2NVYC 1J6WA 4A3JC 4O2DA 1TWFC 1K83C 1EH1A 1J6VA 3GEHA 1I3QK 1R9TC 3T01A 4G7OA 4KB2A 4KMUA 2B63C 4BY7C 4GTAA 4G7HA 5JVOA 5IP9K 1WSVA 4NOIA 2E2IA 4A3KK 2JA6A 5IYCC 1DCHA 4G0VA 1KQ4A 3GTQK 1WORA 3CQZK 3H3VL 3M3YC 3S1RC 1WCMA 1EI6A 4J3NA 1XXAA 3GSIA 1G51A 4KC6A 1TWCC 3RZOC 4KARA 3GTKA 1HQMA 2R92C 4X6AC 4QJVB 1WIHA 1C0AA 3HOXK 3PO3C 3HOYC 2CFAB 1ZBSA 5EGHA 1GE9A 4GZYA 2JA8C 3Q3QA 5C4XC 2YU9A 1Y1WA 4KAWX 3RZDC 2NVYK 3LAPA 4A3JK 4OIQA 1TWFK 1K83K 1YCLA 3K7AC 4A3GC 3BUEA 1F7VA 4BBRC 5M5XK 4PABA 1BGWA 2B63K 5TJ3A 2WB1D 3GEEA 4BLAA 3N3YA 1X31C 3HKZD 2EBBA 1YNJA 3S2HC 5IYCK 1ZQ1C 3S0XA 4AH6A 1JOEA 2NVQC 5IYBK 4XSXA 3S1RK 4FM9A 4BLBA 1XPPA 3OREA 1TWGA 4LLGA 1TWCK 1USMA 3FKIA 4KB4A 4GFQA 2R92K 3BP8C 3HOZC 3S1MC 4A3KC 1SFOC 1XZQB 4QIWL 3GTQC 3V4GA 3CQZC 2KWAA 2JA8K 4AYBD 4GTCA 5C4XK 4KASA 1EFWA 3RZDK 1VLOA 1I50A 3M4OC 4KM8A 3GTLC 5C44K 4C3JK 3HOUK 3I4NC 1F9NA 3K7AK 2Y0SL 4KMAA 5CHPA 4A3GK 5HL8A 2A68A 5EGEA 4BBRK 1Y1VA 1TWHA 3AD9C 2XCRB 2R93A 1I3QA 3L4KA 1PJ5A 3S2HK 4Q5SA 2Y3PA 2PA8L 3S17C 2JA5K 2NVQK 3S16C 2JA6C 2V6SA 1XZPB 5IYDC 5D4DA 3TFHA 1WCMC 3GTMA 2JA7A 3H0GA 3HOZK 4Y7NC 3S1MK 1SFOK 4JK1A 3GTKC 1BDFA 4KN7A 5TMCA 1O2AA 1HI9A 3A8JA 3SZYA 2GAHC 1WQFA 5IYBC 3GTJC 3S15K 4GTFA 3EQLA 3HKZL 3OEPA 1V5VA 5M5YK 3M4OK 1O2BA 2O5IA 3GTLK 4ILDA 4QJVA 3I4NK 4BBSC 5M3MK 2YU9C 1O2FB 4C2MK 2CFAA 2W7VA 4LQYA 5JFEA 4BXXK 3JSTA 1USOA 1TWFA 3N0CA 1K83A 1R9TA 3VA7A 1ZVUA 4A3EC 2WAQL 4BY1C 2B63A 4YFXA 4BKWA 4OINA 3S17K 4KATA 3G4AA 3S14C 3S16K 4M1XA 2JA6K 1I6HC 1BS2A 5C44C 1EK8A 4C3JC 3HOUC 3LAJA 2NVXC 3GTGC 4GT9A 5IYDK 4AYBL 1PJ7A 1VRQC 1YX2A 2VUMA 3NUHA 1WCMK 1I6VA 1JVIA 1SMYA 3A8KA 3FKIC 4Y7NK 1J6XA 2GSOA 3OPFA 3FOEA 3GTKK 3PO2K 1BJTA 2JA5C 1VJEA 4C3HK 3ADAC 3GTJK 3S1QC 4LK0A 4A3IC 3LPXA 3TFJA 2PMZL 1B4BA 4A3CC 1DD5A 2E2HA 1O29A 1IBAA 1O28A 4BBSK 3H3VD 3GTPC 2YU9K 1JQWA 4DDQA 3L4JA 1F7UA 3GTOC 2P5MA 1I50C 1YNNA 3T02A 1RU0A 1XXBA 5IOSA 4MQ9A 1EQRA 4C3IK 2R7ZA 4G7ZA 2V6TA 1Y1VC 3HOWC 1TWHC 5FJ8K 4A3EK 4BY1K 3S15C 3S2DC 2R93C 4XLPA 2PHCB 4WJ3M 3S14K 1TWAA 2XCQA 4Y52C 1I6HK 4OIRA 1IL2A 4C2MC 2NVXK 3GTGK 3I4MC 4KM9A 5TMFA 3N0BA 4GTLA 1UV7A 4BXXC 3GEIA 1O26A 2ZUEA 4LOWA 3FKIK 4A93C 1IE0A 3GTMC 4LR2A 3S1QK 2E2IC 4A3IK 2A69A 1J98A 3GTQA 1WQGA 1ZYRA 4A3CK 3CQZA 2A6EA 5IORA 3S1NC 3AH5A 3GTPK 3GTOK 1I50K 1IS1A 4P5AA 4KMHA 3WODA 2CW0A 1L0WA 5M3FK 3G4CA 2RGRA 4XLNA 2GSUA 3PO2C 4A3LC 1Y1VK 3HOWK 1TWHK 4C3HC 3S2DK 3A8IA 2R93K 2WB1L 3GDZA 4ZH4A 3DXJA 4QIWD 1WQHA 4Y52K 1AB4A 4A3MK 1Y1WC 1B4AA 4A3BC 3BP3A 3I4MK 2V6UA 2NVYA 2ZUFA 4A3FC 3HXAA 2Y0SD 4C3IC 3FOFA 4P5BA 4A93K 2VUMC 5IP7C 1O24A 2JA7K 3GTMK 1INNA 3AQOA 3H0GK 1VH2A 1PJ6A 2E2IK 2PA8D 5C4JC 4KN4A 3S1NK 3GTJA 3HOVC 4YFKA 4XCHA 4A3DC 2E2JC 5C3EK 2E2HC 1TWCA 1TWGC 2O5JA 3AD8C 3ERED
chains in the Genus database with same CATH topology
2PA8L 1Y1VC 3HOWC 3H3VL 1TWHC 5FJ8K 3S17C 4A3EK 4BY1K 2JA5K 3M3YC 3S15C 4A3LK 3S2DC 3S1RC 2NVQK 2R93C 4XLPA 3S16C 2JA6C 3S14K 4LK1A 4Y52C 1R9TK 1TWCC 2R7ZC 1I6HK 5IYDC 1IW7A 4OIRA 3RZOC 5D4DA 2NVXK 3GTGK 3I4MC 1HQMA 2R92C 4BY7K 4QJVB 5TMFA 1Y1WK 4X6AC 2NVTC 1WCMC 4Q5SA 4A3BK 4A3GC 4BXXC 3HOXK 3PO3C 3HOYC 1TWAC 5FLMC 3HOZK 4Y7NC 4A3FK 3S1MK 1SFOK 4JK1A 5M5WK 3GTKC 4GZYA 4KN7A 3FKIK 1BDFA 5TMCA 2JA8C 4A93C 5C4XC 4MEYA 4YG2A 3RZDC 5IYBC 3GTJC 3M3YK 3GTMC 3S15K 2VUMK 2NVYK 3EQLA 4A3JK 5IP7K 3HKZL 1I3QC 2E2IC 4OIQA 5M5YK 3M4OK 1TWFK 4A3IK 1K83K 2A69A 3K7AC 2O5IA 3GTLK 4QJVA 1ZYRA 3I4NK 4A3CK 2BE5A 4BBSC 5M3MK 2A6EA 2YU9C 3RZOK 2WAQD 4BBRC 4C2MK 5M5XK 5C4JK 4A3MC 3S1NC 4OIOA 3GTPK 4X6AK 5IP9C 3GTOK 2B63K 3HOVK 4BXXK 2WB1D 3PO3K 3HOYK 1I50K 3HKZD 4MEXA 3WODA 1YNJA 2CW0A 5M3FK 2E2JK 5IYCK 3S2HC 4A3DK 2E2HK 4OIPA 1TWGK 4A3EC 2WAQL 4XSZA 4XLNA 4BY1C 3PO2C 4A3LC 1Y1VK 4YFXA 2NVQC 3HOWK 1TWHK 5IYBK 4OINA 3S17K 4XSXA 4Q4ZA 3S1RK 2JA7C 3S14C 3S2DK 2R93K 2WB1L 3S16K 3H0GC 4ZH4A 3DXJA 2JA6K 1I6HC 5C44C 4QIWD 3HOUC 1XPPA 4Y52K 4LLGA 1TWCK 2NVXC 3GTGC 2R7ZK 5IYDK 4A3MK 4AYBL 1Y1WC 4A3BC 3I4MK 3HOXC 2R92K 2NVTK 1WCMK 1I6VA 4LJZA 2A6HA 2PMZD 3HOZC 4A3FC 4A3KC 1SFOC 5C3EC 3S1MC 1TWAK 1SMYA 2Y0SD 5FLMK 3GTQC 4QIWL 3FKIC 4Y7NK 3CQZC 3GTKK 4YFNA 4AYBD 2JA8K 4A93K 3PO2K 5C4XK 2PPBA 2JA5C 2VUMC 2NVYC 4C3HK 3RZDK 4A3JC 5IP7C 3GTJK 2JA7K 3GTMK 3S1QC 4LK0A 3M4OC 1TWFC 4A3IC 1K83C 3H0GK 3S1QK 2PMZL 3GTLC 1I3QK 4C3JK 5C44K 1R9TC 2E2IK 3HOUK 3I4NC 3K7AK 4A3CC 2Y0SL 2PA8D 5C4JC 4G7OA 4A3GK 2A68A 3H3VD 3GTPC 4BBSK 4KN4A 2YU9K 4KMUA 4BBRK 2B63C 3GTOC 4BY7C 3S1NK 3HOVC 4G7HA 5IP9K 1I50C 1YNNA 4NOIA 4YFKA 4A3DC 4A3KK 2E2JC 5C3EK 5IYCC 4MQ9A 2E2HC 3GTQK 4C3IK 3S2HK 1TWGC 2O5JA 3CQZK 4G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 L;  1Y1V C;  3HOW C;  3H3V L;  1TWH C;  5FJ8 K;  3S17 C;  4A3E K;  4BY1 K;  2JA5 K;  3M3Y C;  3S15 C;  4A3L K;  3S2D C;  3S1R C;  2NVQ K;  2R93 C;  4XLP A;  3S16 C;  2JA6 C;  3S14 K;  4LK1 A;  4Y52 C;  1R9T K;  1TWC C;  2R7Z C;  1I6H K;  5IYD C;  1IW7 A;  4OIR A;  3RZO C;  5D4D A;  2NVX K;  3GTG K;  3I4M C;  1HQM A;  2R92 C;  4BY7 K;  4QJV B;  5TMF A;  1Y1W K;  4X6A C;  2NVT C;  1WCM C;  4Q5S A;  4A3B K;  4A3G C;  4BXX C;  3HOX K;  3PO3 C;  3HOY C;  1TWA C;  5FLM C;  3HOZ K;  4Y7N C;  4A3F K;  3S1M K;  1SFO K;  4JK1 A;  5M5W K;  3GTK C;  4GZY A;  4KN7 A;  3FKI K;  1BDF A;  5TMC A;  2JA8 C;  4A93 C;  5C4X C;  4MEY A;  4YG2 A;  3RZD C;  5IYB C;  3GTJ C;  3M3Y K;  3GTM C;  3S15 K;  2VUM K;  2NVY K;  3EQL A;  4A3J K;  5IP7 K;  3HKZ L;  1I3Q C;  2E2I C;  4OIQ A;  5M5Y K;  3M4O K;  1TWF K;  4A3I K;  1K83 K;  2A69 A;  3K7A C;  2O5I A;  3GTL K;  4QJV A;  1ZYR A;  3I4N K;  4A3C K;  2BE5 A;  4BBS C;  5M3M K;  2A6E A;  2YU9 C;  3RZO K;  2WAQ D;  4BBR C;  4C2M K;  5M5X K;  5C4J K;  4A3M C;  3S1N C;  4OIO A;  3GTP K;  4X6A K;  5IP9 C;  3GTO K;  2B63 K;  3HOV K;  4BXX K;  2WB1 D;  3PO3 K;  3HOY K;  1I50 K;  3HKZ D;  4MEX A;  3WOD A;  1YNJ A;  2CW0 A;  5M3F K;  2E2J K;  5IYC K;  3S2H C;  4A3D K;  2E2H K;  4OIP A;  1TWG K;  4A3E C;  2WAQ L;  4XSZ A;  4XLN A;  4BY1 C;  3PO2 C;  4A3L C;  1Y1V K;  4YFX A;  2NVQ C;  3HOW K;  1TWH K;  5IYB K;  4OIN A;  3S17 K;  4XSX A;  4Q4Z A;  3S1R K;  2JA7 C;  3S14 C;  3S2D K;  2R93 K;  2WB1 L;  3S16 K;  3H0G C;  4ZH4 A;  3DXJ A;  2JA6 K;  1I6H C;  5C44 C;  4QIW D;  3HOU C;  1XPP A;  4Y52 K;  4LLG A;  1TWC K;  2NVX C;  3GTG C;  2R7Z K;  5IYD K;  4A3M K;  4AYB L;  1Y1W C;  4A3B C;  3I4M K;  3HOX C;  2R92 K;  2NVT K;  1WCM K;  1I6V A;  4LJZ A;  2A6H A;  2PMZ D;  3HOZ C;  4A3F C;  4A3K C;  1SFO C;  5C3E C;  3S1M C;  1TWA K;  1SMY A;  2Y0S D;  5FLM K;  3GTQ C;  4QIW L;  3FKI C;  4Y7N K;  3CQZ C;  3GTK K;  4YFN A;  4AYB D;  2JA8 K;  4A93 K;  3PO2 K;  5C4X K;  2PPB A;  2JA5 C;  2VUM C;  2NVY C;  4C3H K;  3RZD K;  4A3J C;  5IP7 C;  3GTJ K;  2JA7 K;  3GTM K;  3S1Q C;  4LK0 A;  3M4O C;  1TWF C;  4A3I C;  1K83 C;  3H0G K;  3S1Q K;  2PMZ L;  3GTL C;  1I3Q K;  4C3J K;  5C44 K;  1R9T C;  2E2I K;  3HOU K;  3I4N C;  3K7A K;  4A3C C;  2Y0S L;  2PA8 D;  5C4J C;  4G7O A;  4A3G K;  2A68 A;  3H3V D;  3GTP C;  4BBS K;  4KN4 A;  2YU9 K;  4KMU A;  4BBR K;  2B63 C;  3GTO C;  4BY7 C;  3S1N K;  3HOV C;  4G7H A;  5IP9 K;  1I50 C;  1YNN A;  4NOI A;  4YFK A;  4A3D C;  4A3K K;  2E2J C;  5C3E K;  5IYC C;  4MQ9 A;  2E2H C;  3GTQ K;  4C3I K;  3S2H K;  1TWG C;  2O5J A;  3CQZ K;  4G7Z A; 
#chains in the Genus database with same CATH topology
 4WIL A;  5L46 A;  3TTG A;  2R92 A;  4A3L K;  1IQ0 A;  4GTD A;  4LK1 A;  1R9T K;  2R7Z C;  1IW7 A;  1XXC A;  1DCO A;  1WOP A;  2D6F C;  4KMD A;  4BY7 K;  1Y1W K;  2NVT C;  2ZFZ A;  2GAG C;  2XCO A;  4PAA A;  4A3B K;  1DCP A;  1XZQ A;  1TWA C;  5FLM C;  5IOQ A;  4A3F K;  1O27 A;  3AD7 C;  3GIR A;  5M5W K;  2NVX A;  5IOT A;  3GTG A;  4MEY A;  4YG2 A;  3M3Y K;  2VUM K;  5IP7 K;  1ZXO A;  1I3Q C;  4FZB A;  2BE5 A;  1O25 A;  3AQP A;  3RZO K;  2WAQ D;  4A3M C;  4G0U A;  5C4J K;  4OIO A;  4X6A K;  5IP9 C;  2JA5 A;  4GTE A;  3T00 A;  3HOV K;  1WSR A;  4GTB A;  3PO3 K;  3HOY K;  2FQT A;  4MEX A;  4A3D K;  2E2J K;  4G0W A;  4C45 A;  2E2H K;  2RH6 A;  4OIP A;  3SZZ A;  1TWG K;  3GTP A;  4XSZ A;  3GTO A;  2JH3 A;  3IPJ A;  1WOS A;  2P8T A;  1XZP A;  2JA7 C;  4Q4Z A;  3H0G C;  5E68 A;  4WJ4 A;  1SFO A;  3FHZ A;  3MML B;  2R7Z K;  3QX3 A;  4RMF A;  1ISE A;  4P9S A;  5CJ9 A;  3HOX C;  3TFI A;  2NVT K;  4LJZ A;  2A6H A;  1VGX A;  2PMZ D;  5C3E C;  2GSN A;  1TWA K;  3CAG A;  2FQO A;  5FLM K;  1WOO A;  3GTL A;  4YFN A;  4KDD A;  1F93 A;  2PPB A;  2NVY C;  1J6W A;  4A3J C;  4O2D A;  1TWF C;  1K83 C;  1EH1 A;  1J6V A;  3GEH A;  1I3Q K;  1R9T C;  3T01 A;  4G7O A;  4KB2 A;  4KMU A;  2B63 C;  4BY7 C;  4GTA A;  4G7H A;  5JVO A;  5IP9 K;  1WSV A;  4NOI A;  2E2I A;  4A3K K;  2JA6 A;  5IYC C;  1DCH A;  4G0V A;  1KQ4 A;  3GTQ K;  1WOR A;  3CQZ K;  3H3V L;  3M3Y C;  3S1R C;  1WCM A;  1EI6 A;  4J3N A;  1XXA A;  3GSI A;  1G51 A;  4KC6 A;  1TWC C;  3RZO C;  4KAR A;  3GTK A;  1HQM A;  2R92 C;  4X6A C;  4QJV B;  1WIH A;  1C0A A;  3HOX K;  3PO3 C;  3HOY C;  2CFA B;  1ZBS A;  5EGH A;  1GE9 A;  4GZY A;  2JA8 C;  3Q3Q A;  5C4X C;  2YU9 A;  1Y1W A;  4KAW X;  3RZD C;  2NVY K;  3LAP A;  4A3J K;  4OIQ A;  1TWF K;  1K83 K;  1YCL A;  3K7A C;  4A3G C;  3BUE A;  1F7V A;  4BBR C;  5M5X K;  4PAB A;  1BGW A;  2B63 K;  5TJ3 A;  2WB1 D;  3GEE A;  4BLA A;  3N3Y A;  1X31 C;  3HKZ D;  2EBB A;  1YNJ A;  3S2H C;  5IYC K;  1ZQ1 C;  3S0X A;  4AH6 A;  1JOE A;  2NVQ C;  5IYB K;  4XSX A;  3S1R K;  4FM9 A;  4BLB A;  1XPP A;  3ORE A;  1TWG A;  4LLG A;  1TWC K;  1USM A;  3FKI A;  4KB4 A;  4GFQ A;  2R92 K;  3BP8 C;  3HOZ C;  3S1M C;  4A3K C;  1SFO C;  1XZQ B;  4QIW L;  3GTQ C;  3V4G A;  3CQZ C;  2KWA A;  2JA8 K;  4AYB D;  4GTC A;  5C4X K;  4KAS A;  1EFW A;  3RZD K;  1VLO A;  1I50 A;  3M4O C;  4KM8 A;  3GTL C;  5C44 K;  4C3J K;  3HOU K;  3I4N C;  1F9N A;  3K7A K;  2Y0S L;  4KMA A;  5CHP A;  4A3G K;  5HL8 A;  2A68 A;  5EGE A;  4BBR K;  1Y1V A;  1TWH A;  3AD9 C;  2XCR B;  2R93 A;  1I3Q A;  3L4K A;  1PJ5 A;  3S2H K;  4Q5S A;  2Y3P A;  2PA8 L;  3S17 C;  2JA5 K;  2NVQ K;  3S16 C;  2JA6 C;  2V6S A;  1XZP B;  5IYD C;  5D4D A;  3TFH A;  1WCM C;  3GTM A;  2JA7 A;  3H0G A;  3HOZ K;  4Y7N C;  3S1M K;  1SFO K;  4JK1 A;  3GTK C;  1BDF A;  4KN7 A;  5TMC A;  1O2A A;  1HI9 A;  3A8J A;  3SZY A;  2GAH C;  1WQF A;  5IYB C;  3GTJ C;  3S15 K;  4GTF A;  3EQL A;  3HKZ L;  3OEP A;  1V5V A;  5M5Y K;  3M4O K;  1O2B A;  2O5I A;  3GTL K;  4ILD A;  4QJV A;  3I4N K;  4BBS C;  5M3M K;  2YU9 C;  1O2F B;  4C2M K;  2CFA A;  2W7V A;  4LQY A;  5JFE A;  4BXX K;  3JST A;  1USO A;  1TWF A;  3N0C A;  1K83 A;  1R9T A;  3VA7 A;  1ZVU A;  4A3E C;  2WAQ L;  4BY1 C;  2B63 A;  4YFX A;  4BKW A;  4OIN A;  3S17 K;  4KAT A;  3G4A A;  3S14 C;  3S16 K;  4M1X A;  2JA6 K;  1I6H C;  1BS2 A;  5C44 C;  1EK8 A;  4C3J C;  3HOU C;  3LAJ A;  2NVX C;  3GTG C;  4GT9 A;  5IYD K;  4AYB L;  1PJ7 A;  1VRQ C;  1YX2 A;  2VUM A;  3NUH A;  1WCM K;  1I6V A;  1JVI A;  1SMY A;  3A8K A;  3FKI C;  4Y7N K;  1J6X A;  2GSO A;  3OPF A;  3FOE A;  3GTK K;  3PO2 K;  1BJT A;  2JA5 C;  1VJE A;  4C3H K;  3ADA C;  3GTJ K;  3S1Q C;  4LK0 A;  4A3I C;  3LPX A;  3TFJ A;  2PMZ L;  1B4B A;  4A3C C;  1DD5 A;  2E2H A;  1O29 A;  1IBA A;  1O28 A;  4BBS K;  3H3V D;  3GTP C;  2YU9 K;  1JQW A;  4DDQ A;  3L4J A;  1F7U A;  3GTO C;  2P5M A;  1I50 C;  1YNN A;  3T02 A;  1RU0 A;  1XXB A;  5IOS A;  4MQ9 A;  1EQR A;  4C3I K;  2R7Z A;  4G7Z A;  2V6T A;  1Y1V C;  3HOW C;  1TWH C;  5FJ8 K;  4A3E K;  4BY1 K;  3S15 C;  3S2D C;  2R93 C;  4XLP A;  2PHC B;  4WJ3 M;  3S14 K;  1TWA A;  2XCQ A;  4Y52 C;  1I6H K;  4OIR A;  1IL2 A;  4C2M C;  2NVX K;  3GTG K;  3I4M C;  4KM9 A;  5TMF A;  3N0B A;  4GTL A;  1UV7 A;  4BXX C;  3GEI A;  1O26 A;  2ZUE A;  4LOW A;  3FKI K;  4A93 C;  1IE0 A;  3GTM C;  4LR2 A;  3S1Q K;  2E2I C;  4A3I K;  2A69 A;  1J98 A;  3GTQ A;  1WQG A;  1ZYR A;  4A3C K;  3CQZ A;  2A6E A;  5IOR A;  3S1N C;  3AH5 A;  3GTP K;  3GTO K;  1I50 K;  1IS1 A;  4P5A A;  4KMH A;  3WOD A;  2CW0 A;  1L0W A;  5M3F K;  3G4C A;  2RGR A;  4XLN A;  2GSU A;  3PO2 C;  4A3L C;  1Y1V K;  3HOW K;  1TWH K;  4C3H C;  3S2D K;  3A8I A;  2R93 K;  2WB1 L;  3GDZ A;  4ZH4 A;  3DXJ A;  4QIW D;  1WQH A;  4Y52 K;  1AB4 A;  4A3M K;  1Y1W C;  1B4A A;  4A3B C;  3BP3 A;  3I4M K;  2V6U A;  2NVY A;  2ZUF A;  4A3F C;  3HXA A;  2Y0S D;  4C3I C;  3FOF A;  4P5B A;  4A93 K;  2VUM C;  5IP7 C;  1O24 A;  2JA7 K;  3GTM K;  1INN A;  3AQO A;  3H0G K;  1VH2 A;  1PJ6 A;  2E2I K;  2PA8 D;  5C4J C;  4KN4 A;  3S1N K;  3GTJ A;  3HOV C;  4YFK A;  4XCH A;  4A3D C;  2E2J C;  5C3E K;  2E2H C;  1TWC A;  1TWG C;  2O5J A;  3AD8 C;  3ERE D; 
#chains in the Genus database with same CATH homology
 2PA8 L;  1Y1V C;  3HOW C;  3H3V L;  1TWH C;  5FJ8 K;  3S17 C;  4A3E K;  4BY1 K;  2JA5 K;  3M3Y C;  3S15 C;  4A3L K;  3S2D C;  3S1R C;  2NVQ K;  2R93 C;  4XLP A;  3S16 C;  2JA6 C;  3S14 K;  4LK1 A;  4Y52 C;  1R9T K;  1TWC C;  2R7Z C;  1I6H K;  5IYD C;  1IW7 A;  4OIR A;  3RZO C;  5D4D A;  2NVX K;  3GTG K;  3I4M C;  1HQM A;  2R92 C;  4BY7 K;  4QJV B;  5TMF A;  1Y1W K;  4X6A C;  2NVT C;  1WCM C;  4Q5S A;  4A3B K;  4A3G C;  4BXX C;  3HOX K;  3PO3 C;  3HOY C;  1TWA C;  5FLM C;  3HOZ K;  4Y7N C;  4A3F K;  3S1M K;  1SFO K;  4JK1 A;  5M5W K;  3GTK C;  4GZY A;  4KN7 A;  3FKI K;  1BDF A;  5TMC A;  2JA8 C;  4A93 C;  5C4X C;  4MEY A;  4YG2 A;  3RZD C;  5IYB C;  3GTJ C;  3M3Y K;  3GTM C;  3S15 K;  2VUM K;  2NVY K;  3EQL A;  4A3J K;  5IP7 K;  3HKZ L;  1I3Q C;  2E2I C;  4OIQ A;  5M5Y K;  3M4O K;  1TWF K;  4A3I K;  1K83 K;  2A69 A;  3K7A C;  2O5I A;  3GTL K;  4QJV A;  1ZYR A;  3I4N K;  4A3C K;  2BE5 A;  4BBS C;  5M3M K;  2A6E A;  2YU9 C;  3RZO K;  2WAQ D;  4BBR C;  4C2M K;  5M5X K;  5C4J K;  4A3M C;  3S1N C;  4OIO A;  3GTP K;  4X6A K;  5IP9 C;  3GTO K;  2B63 K;  3HOV K;  4BXX K;  2WB1 D;  3PO3 K;  3HOY K;  1I50 K;  3HKZ D;  4MEX A;  3WOD A;  1YNJ A;  2CW0 A;  5M3F K;  2E2J K;  5IYC K;  3S2H C;  4A3D K;  2E2H K;  4OIP A;  1TWG K;  4A3E C;  2WAQ L;  4XSZ A;  4XLN A;  4BY1 C;  3PO2 C;  4A3L C;  1Y1V K;  4YFX A;  2NVQ C;  3HOW K;  1TWH K;  5IYB K;  4OIN A;  3S17 K;  4XSX A;  4Q4Z A;  3S1R K;  2JA7 C;  3S14 C;  3S2D K;  2R93 K;  2WB1 L;  3S16 K;  3H0G C;  4ZH4 A;  3DXJ A;  2JA6 K;  1I6H C;  5C44 C;  4QIW D;  3HOU C;  1XPP A;  4Y52 K;  4LLG A;  1TWC K;  2NVX C;  3GTG C;  2R7Z K;  5IYD K;  4A3M K;  4AYB L;  1Y1W C;  4A3B C;  3I4M K;  3HOX C;  2R92 K;  2NVT K;  1WCM K;  1I6V A;  4LJZ A;  2A6H A;  2PMZ D;  3HOZ C;  4A3F C;  4A3K C;  1SFO C;  5C3E C;  3S1M C;  1TWA K;  1SMY A;  2Y0S D;  5FLM K;  3GTQ C;  4QIW L;  3FKI C;  4Y7N K;  3CQZ C;  3GTK K;  4YFN A;  4AYB D;  2JA8 K;  4A93 K;  3PO2 K;  5C4X K;  2PPB A;  2JA5 C;  2VUM C;  2NVY C;  4C3H K;  3RZD K;  4A3J C;  5IP7 C;  3GTJ K;  2JA7 K;  3GTM K;  3S1Q C;  4LK0 A;  3M4O C;  1TWF C;  4A3I C;  1K83 C;  3H0G K;  3S1Q K;  2PMZ L;  3GTL C;  1I3Q K;  4C3J K;  5C44 K;  1R9T C;  2E2I K;  3HOU K;  3I4N C;  3K7A K;  4A3C C;  2Y0S L;  2PA8 D;  5C4J C;  4G7O A;  4A3G K;  2A68 A;  3H3V D;  3GTP C;  4BBS K;  4KN4 A;  2YU9 K;  4KMU A;  4BBR K;  2B63 C;  3GTO C;  4BY7 C;  3S1N K;  3HOV C;  4G7H A;  5IP9 K;  1I50 C;  1YNN A;  4NOI A;  4YFK A;  4A3D C;  4A3K K;  2E2J C;  5C3E K;  5IYC C;  4MQ9 A;  2E2H C;  3GTQ K;  4C3I K;  3S2H K;  1TWG C;  2O5J A;  3CQZ K;  4G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...