3HOWK

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3howK00
4NOIA 2A68A 5M5WK 4Q4ZA 4X6AK 3FKIC 5D4DA 4QJVA 3S1QC 4BXXK 3M4OC 4YFKA 2WAQL 4KN4A 3HOWC 2WAQD 2R7ZK 4A3BK 3S15K 4LK1A 3S17K 1XPPA 3M3YK 4BY7K 2NVYK 2NVQK 3S1NC 1SFOK 2YU9K 3S1RK 4A3JC 3GTQK 2WB1L 3HOXK 2WB1D 5C4JK 4A3BC 4BY7C 3EQLA 3GTMC 3M3YC 3GTGK 2O5IA 4QJVB 3HOZK 3I4MK 1TWFK 4A3IC 2O5JA 1ZYRA 4A3KK 2NVXC 3M4OK 2R93C 4X6AC 1SMYA 3FKIK 3S1QK 4G7ZA 2JA5C 3PO2C 5IP7K 4OIRA 1R9TC 4AYBD 2E2HC 4KMUA 2JA8C 3HOUK 4YG2A 1K83K 4MEXA 2B63C 3HOVK 2JA5K 4A3CC 5IYDK 5C44C 3HOYK 3GTOK 5C4XK 1TWCK 2JA6K 4A3LK 3S1MK 4A3KC 2NVXK 3GTGC 4A3IK 4A3DK 4BBSK 1I6VA 2R93K 3S14K 1TWGC 4Y52K 5C4JC 4YFNA 5C3EC 2CW0A 1IW7A 3K7AK 4A3FK 4C2MK 3HOXC 5C3EK 4LK0A 2JA7K 4OINA 3H0GK 3S14C 4JK1A 2R7ZC 3HOWK 3GTPK 1Y1VC 3S15C 3I4NK 3PO3C 4MEYA 3S2DC 4A3LC 1WCMK 2PA8L 4XSZA 5C4XC 2PA8D 2Y0SD 4QIWL 4QIWD 5IYBK 3PO2K 5FLMK 1YNJA 4Y7NC 2R92C 2B63K 1I6HC 5IYDC 4A3CK 4BBRC 4OIOA 2E2HK 3RZDC 2JA8K 1I50C 5IP9C 1TWHC 4LJZA 5IP7C 2E2JK 2E2IK 5IYBC 3GTLC 4Q5SA 4XSXA 2NVTC 5M3FK 3GTKC 3S2DK 5M3MK 1WCMC 1Y1VK 1TWFC 3HOZC 2VUMC 3I4MC 3H0GC 3K7AC 4AYBL 3S16K 4LLGA 3S1NK 1I3QK 4A3JK 5IYCK 3H3VL 3H3VD 1YNNA 4YFXA 4Y52C 4GZYA 2A69A 5FJ8K 3GTKK 4MQ9A 4ZH4A 1TWCC 3GTJK 3GTOC 3S1MC 5C44K 2JA6C 1TWHK 1TWAK 3HKZL 3HKZD 4XLPA 4A3EC 2E2IC 3RZDK 2E2JC 3GTLK 3HOUC 3S2HC 4A3MC 4A93K 2A6EA 5M5YK 5FLMC 4G7HA 2PMZD 4A3EK 1I6HK 2PMZL 1HQMA 4C3IK 4Y7NK 2R92K 4OIQA 3CQZK 4OIPA 3GTJC 4A3GK 3GTPC 4KN7A 2Y0SL 2BE5A 5TMFA 4C3JK 5M5XK 1Y1WC 3PO3K 3GTMK 3RZOC 3I4NC 1I3QC 5TMCA 4A3FC 5IYCC 3S16C 2JA7C 2NVYC 3S1RC 3GTQC 3S17C 1SFOC 2YU9C 1Y1WK 2VUMK 2A6HA 2NVQC 3RZOK 4A3DC 1TWGK 4BXXC 4C3HK 4BBSC 4A3GC 2NVTK 3CQZC 4G7OA 3WODA 3DXJA 4XLNA 3HOVC 3HOYC 4A93C 3S2HK 1I50K 5IP9K 4BY1K 1BDFA 4BBRK 4A3MK 1K83C 2PPBA 4BY1C 1R9TK 1TWAC
chains in the Genus database with same CATH superfamily
4NOIA 1F93A 2A68A 2ZUEA 3M4OC 1ISEA 4J3NA 2RGRA 2ZFZA 3S15K 1Y1VA 3S1NC 3FOEA 4A3JC 4G0VA 2V6SA 3EQLA 3N0BA 3I4MK 1TWFK 4X6AC 1ZYRA 2NVXC 2R7ZA 1F7UA 5IOTA 2YU9A 4G7ZA 2JA5C 2NVYA 5IP7K 4KATA 1JOEA 1O29A 1R9TC 2JA8C 4KMUA 1TWGA 3GTPA 1XZPA 2JA5K 5C44C 3AH5A 1TWCK 1EQRA 1WQHA 4A3IK 4BBSK 3BP8C 3FOFA 3HOXC 4P9SA 5C3EK 3GTOA 3S14C 4JK1A 3OPFA 1WOOA 3GTPK 3I4NK 4XSZA 5C4XC 3AD8C 2Y0SD 4C45A 4QIWL 3A8JA 1O28A 4KB4A 4A3CK 4BLAA 5JFEA 3CAGA 3AQPA 1Y1VK 1BGWA 3L4JA 1ZXOA 3HOZC 4KARA 1TWHA 3BUEA 4C2MC 3L4KA 4LLGA 1WOSA 2FQTA 5IYCK 1O25A 3H3VL 3GTGA 5IORA 3GTJK 3ERED 4GTLA 3GTOC 1HI9A 3HKZD 3LAJA 1X31C 4A3EK 1JQWA 2RH6A 2PMZL 2V6TA 3T02A 2R92K 1I6HK 2P8TA 1L0WA 4A3GK 2Y0SL 5M5XK 1Y1WC 3JSTA 3S16C 5E68A 2XCQA 4KM9A 1G51A 4WILA 2JH3A 2R92A 4A3GC 2NVTK 3WODA 3HOVC 3S0XA 1BDFA 4BBRK 5IOQA 2PPBA 1VJEA 3S1QC 4BXXK 4YFKA 3GIRA 4A3BK 4BY7K 3OREA 3M3YK 4KB2A 2YU9K 3S1RK 3G4AA 2WB1D 4FM9A 1O27A 4A3BC 4BY7C 3GTMC 2ZUFA 3HOZK 1ZBSA 1SFOA 3FKIK 4GTAA 1USOA 4AYBD 4WJ3M 3HOVK 1ZQ1C 4A3CC 1VRQC 4A3LK 3S1MK 3A8IA 1J6WA 3IPJA 1WCMA 1TWGC 4LR2A 5C4JC 4YFNA 2GSOA 3K7AK 4LQYA 1O26A 4LK0A 3H0GK 2R7ZC 2NVXA 4MEYA 3S2DC 2PHCB 2PA8L 4QIWD 1YNJA 2P5MA 4Y7NC 2B63K 2E2HK 1I50C 3GEHA 5HL8A 5IP9C 2E2IK 4XSXA 1DCHA 3SZYA 3V4GA 5M3FK 1XZPB 4AH6A 3S2DK 1TWFC 3I4MC 3T00A 4P5BA 2GSNA 3K7AC 1PJ6A 4A3JK 4GT9A 4P5AA 4O2DA 4YFXA 2GSUA 2A69A 4ZH4A 5TJ3A 3TFHA 2JA6C 3OEPA 5EGEA 4A3EC 2E2IC 1GE9A 4A3MC 3LPXA 2PMZD 2E2HA 3BP3A 4Y7NK 4OIPA 3GTJC 3GTPC 2VUMA 2BE5A 5TMFA 3G4CA 3RZOC 1I3QC 1IE0A 5IYCC 2FQOA 2VUMK 1DCPA 3GSIA 1TWGK 4BXXC 3T01A 5CJ9A 3CQZC 4GTBA 4BY1C 1BS2A 4Q4ZA 4X6AK 3FKIC 4QJVA 3TFJA 2WAQL 4KN4A 3HOWC 2WAQD 2NVQK 3TFIA 1SFOK 3GTQK 2WB1L 3MMLB 3HOXK 3M3YC 3GTGK 4KM8A 2Y3PA 4A3IC 1SMYA 3AD9C 3S1QK 2E2HC 1C0AA 2KWAA 4YG2A 1IL2A 2B63C 3HXAA 3Q3QA 1I50A 3AQOA 3GTOK 1BJTA 4PAAA 2NVXK 3GTGC 4A3DK 1IBAA 2JA7A 4Y52K 4BKWA 2CW0A 3NUHA 1IW7A 4KASA 1Y1WA 4C2MK 4OINA 1YCLA 3HOWK 2R93A 1Y1VC 1O2AA 3S15C 4A3LC 1WCMK 3GTLA 2PA8D 1VLOA 2R92C 1EFWA 1I6HC 5IYDC 3RZDC 4ILDA 4Q5SA 3GTKA 3GTKC 1VH2A 5M3MK 1WCMC 3GTJA 2VUMC 2CFAA 1YX2A 1I3QK 3H3VD 2E2IA 4G0UA 4Y52C 4GZYA 4LOWA 1TWCC 1KQ4A 5C44K 1IQ0A 1TWHK 1TWAK 3HKZL 3PO2K 4XCHA 1USMA 5FLMC 5M5YK 1EI6A 3VA7A 2EBBA 4FZBA 5IOSA 4KC6A 4KN7A 3I4NC 3AD7C 4A3FC 1VGXA 1B4BA 3GTQC 1SFOC 1Y1WK 4GTDA 2NVQC 1XZQA 1O24A 1F7VA 4RMFA 4BBSC 4G7OA 1O2BA 3DXJA 3FKIA 1I50K 5IP9K 4BY1K 2JA5A 1F9NA 1RU0A 1EH1A 3GDZA 1XZQB 1TWCA 1R9TK 1TWAC 3PO2C 5M5WK 5D4DA 2V6UA 1JVIA 2R7ZK 4LK1A 3S17K 1XPPA 1WSRA 1J98A 2NVYK 4GTFA 4WJ4A 3QX3A 1TWFA 5C4JK 1UV7A 3GEIA 1AB4A 2O5IA 3A8KA 4QJVB 2O5JA 4A3KK 3M4OK 2R93C 3GTQA 4C3IC 3GEEA 4BLBA 4OIRA 1WQGA 3HOUK 4MEXA 1K83K 5IYDK 1B4AA 3H0GA 3HOYK 1DD5A 5C4XK 4GTEA 4KAWX 2JA6K 1EK8A 4A3KC 2D6FC 2R93K 1I6VA 3S14K 4G0WA 4M1XA 2B63A 5C3EC 4A3FK 2JA6A 4DDQA 2JA7K 3TTGA 3PO3C 3N0CA 4KDDA 4GTCA 5L46A 1DCOA 5IYBK 1WOPA 5FLMK 4BBRC 3ADAC 4OIOA 2JA8K 1TWAA 1V5VA 1TWHC 4LJZA 5IP7C 2E2JK 5IYBC 3GTLC 2NVTC 1I3QA 1O2FB 4KMDA 1WIHA 4KMHA 5JVOA 3H0GC 4AYBL 3S16K 2XCOA 3S1NK 2CFAB 2GAGC 3FHZA 3SZZA 1YNNA 1IS1A 5FJ8K 3GTKK 4MQ9A 2W7VA 3S1MC 1XXBA 3LAPA 4XLPA 3GTLK 3HOUC 2E2JC 1PJ7A 3RZDK 3S2HC 1J6VA 4A93K 1WSVA 2A6EA 4G7HA 1HQMA 4C3IK 1R9TA 4OIQA 4C3HC 3CQZK 5EGHA 1PJ5A 1ZVUA 4C3JK 3PO3K 1WQFA 3GTMK 5TMCA 2JA7C 2NVYC 1WORA 3S1RC 3S17C 2YU9C 4C3JC 2A6HA 5CHPA 3RZOK 4A3DC 3GTMA 1XXCA 4C3HK 2XCRB 1INNA 1J6XA 3CQZA 2GAHC 4KMAA 4XLNA 3HOYC 4A93C 4GFQA 3S2HK 4A3MK 1K83C 1K83A 3N3YA 1XXAA 4PABA
chains in the Genus database with same CATH topology
4NOIA 2A68A 5M5WK 4Q4ZA 4X6AK 3FKIC 5D4DA 4QJVA 3S1QC 4BXXK 3M4OC 4YFKA 2WAQL 4KN4A 3HOWC 2WAQD 2R7ZK 4A3BK 3S15K 4LK1A 3S17K 1XPPA 3M3YK 4BY7K 2NVYK 2NVQK 3S1NC 1SFOK 2YU9K 3S1RK 4A3JC 3GTQK 2WB1L 3HOXK 2WB1D 5C4JK 4A3BC 4BY7C 3EQLA 3GTMC 3M3YC 3GTGK 2O5IA 4QJVB 3HOZK 3I4MK 1TWFK 4A3IC 2O5JA 1ZYRA 4A3KK 2NVXC 3M4OK 2R93C 4X6AC 1SMYA 3FKIK 3S1QK 4G7ZA 2JA5C 3PO2C 5IP7K 4OIRA 1R9TC 4AYBD 2E2HC 4KMUA 2JA8C 3HOUK 4YG2A 1K83K 4MEXA 2B63C 3HOVK 2JA5K 4A3CC 5IYDK 5C44C 3HOYK 3GTOK 5C4XK 1TWCK 2JA6K 4A3LK 3S1MK 4A3KC 2NVXK 3GTGC 4A3IK 4A3DK 4BBSK 1I6VA 2R93K 3S14K 1TWGC 4Y52K 5C4JC 4YFNA 5C3EC 2CW0A 1IW7A 3K7AK 4A3FK 4C2MK 3HOXC 5C3EK 4LK0A 2JA7K 4OINA 3H0GK 3S14C 4JK1A 2R7ZC 3HOWK 3GTPK 1Y1VC 3S15C 3I4NK 3PO3C 4MEYA 3S2DC 4A3LC 1WCMK 2PA8L 4XSZA 5C4XC 2PA8D 2Y0SD 4QIWL 4QIWD 5IYBK 3PO2K 5FLMK 1YNJA 4Y7NC 2R92C 2B63K 1I6HC 5IYDC 4A3CK 4BBRC 4OIOA 2E2HK 3RZDC 2JA8K 1I50C 5IP9C 1TWHC 4LJZA 5IP7C 2E2JK 2E2IK 5IYBC 3GTLC 4Q5SA 4XSXA 2NVTC 5M3FK 3GTKC 3S2DK 5M3MK 1WCMC 1Y1VK 1TWFC 3HOZC 2VUMC 3I4MC 3H0GC 3K7AC 4AYBL 3S16K 4LLGA 3S1NK 1I3QK 4A3JK 5IYCK 3H3VL 3H3VD 1YNNA 4YFXA 4Y52C 4GZYA 2A69A 5FJ8K 3GTKK 4MQ9A 4ZH4A 1TWCC 3GTJK 3GTOC 3S1MC 5C44K 2JA6C 1TWHK 1TWAK 3HKZL 3HKZD 4XLPA 4A3EC 2E2IC 3RZDK 2E2JC 3GTLK 3HOUC 3S2HC 4A3MC 4A93K 2A6EA 5M5YK 5FLMC 4G7HA 2PMZD 4A3EK 1I6HK 2PMZL 1HQMA 4C3IK 4Y7NK 2R92K 4OIQA 3CQZK 4OIPA 3GTJC 4A3GK 3GTPC 4KN7A 2Y0SL 2BE5A 5TMFA 4C3JK 5M5XK 1Y1WC 3PO3K 3GTMK 3RZOC 3I4NC 1I3QC 5TMCA 4A3FC 5IYCC 3S16C 2JA7C 2NVYC 3S1RC 3GTQC 3S17C 1SFOC 2YU9C 1Y1WK 2VUMK 2A6HA 2NVQC 3RZOK 4A3DC 1TWGK 4BXXC 4C3HK 4BBSC 4A3GC 2NVTK 3CQZC 4G7OA 3WODA 3DXJA 4XLNA 3HOVC 3HOYC 4A93C 3S2HK 1I50K 5IP9K 4BY1K 1BDFA 4BBRK 4A3MK 1K83C 2PPBA 4BY1C 1R9TK 1TWAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOI A;  2A68 A;  5M5W K;  4Q4Z A;  4X6A K;  3FKI C;  5D4D A;  4QJV A;  3S1Q C;  4BXX K;  3M4O C;  4YFK A;  2WAQ L;  4KN4 A;  3HOW C;  2WAQ D;  2R7Z K;  4A3B K;  3S15 K;  4LK1 A;  3S17 K;  1XPP A;  3M3Y K;  4BY7 K;  2NVY K;  2NVQ K;  3S1N C;  1SFO K;  2YU9 K;  3S1R K;  4A3J C;  3GTQ K;  2WB1 L;  3HOX K;  2WB1 D;  5C4J K;  4A3B C;  4BY7 C;  3EQL A;  3GTM C;  3M3Y C;  3GTG K;  2O5I A;  4QJV B;  3HOZ K;  3I4M K;  1TWF K;  4A3I C;  2O5J A;  1ZYR A;  4A3K K;  2NVX C;  3M4O K;  2R93 C;  4X6A C;  1SMY A;  3FKI K;  3S1Q K;  4G7Z A;  2JA5 C;  3PO2 C;  5IP7 K;  4OIR A;  1R9T C;  4AYB D;  2E2H C;  4KMU A;  2JA8 C;  3HOU K;  4YG2 A;  1K83 K;  4MEX A;  2B63 C;  3HOV K;  2JA5 K;  4A3C C;  5IYD K;  5C44 C;  3HOY K;  3GTO K;  5C4X K;  1TWC K;  2JA6 K;  4A3L K;  3S1M K;  4A3K C;  2NVX K;  3GTG C;  4A3I K;  4A3D K;  4BBS K;  1I6V A;  2R93 K;  3S14 K;  1TWG C;  4Y52 K;  5C4J C;  4YFN A;  5C3E C;  2CW0 A;  1IW7 A;  3K7A K;  4A3F K;  4C2M K;  3HOX C;  5C3E K;  4LK0 A;  2JA7 K;  4OIN A;  3H0G K;  3S14 C;  4JK1 A;  2R7Z C;  3HOW K;  3GTP K;  1Y1V C;  3S15 C;  3I4N K;  3PO3 C;  4MEY A;  3S2D C;  4A3L C;  1WCM K;  2PA8 L;  4XSZ A;  5C4X C;  2PA8 D;  2Y0S D;  4QIW L;  4QIW D;  5IYB K;  3PO2 K;  5FLM K;  1YNJ A;  4Y7N C;  2R92 C;  2B63 K;  1I6H C;  5IYD C;  4A3C K;  4BBR C;  4OIO A;  2E2H K;  3RZD C;  2JA8 K;  1I50 C;  5IP9 C;  1TWH C;  4LJZ A;  5IP7 C;  2E2J K;  2E2I K;  5IYB C;  3GTL C;  4Q5S A;  4XSX A;  2NVT C;  5M3F K;  3GTK C;  3S2D K;  5M3M K;  1WCM C;  1Y1V K;  1TWF C;  3HOZ C;  2VUM C;  3I4M C;  3H0G C;  3K7A C;  4AYB L;  3S16 K;  4LLG A;  3S1N K;  1I3Q K;  4A3J K;  5IYC K;  3H3V L;  3H3V D;  1YNN A;  4YFX A;  4Y52 C;  4GZY A;  2A69 A;  5FJ8 K;  3GTK K;  4MQ9 A;  4ZH4 A;  1TWC C;  3GTJ K;  3GTO C;  3S1M C;  5C44 K;  2JA6 C;  1TWH K;  1TWA K;  3HKZ L;  3HKZ D;  4XLP A;  4A3E C;  2E2I C;  3RZD K;  2E2J C;  3GTL K;  3HOU C;  3S2H C;  4A3M C;  4A93 K;  2A6E A;  5M5Y K;  5FLM C;  4G7H A;  2PMZ D;  4A3E K;  1I6H K;  2PMZ L;  1HQM A;  4C3I K;  4Y7N K;  2R92 K;  4OIQ A;  3CQZ K;  4OIP A;  3GTJ C;  4A3G K;  3GTP C;  4KN7 A;  2Y0S L;  2BE5 A;  5TMF A;  4C3J K;  5M5X K;  1Y1W C;  3PO3 K;  3GTM K;  3RZO C;  3I4N C;  1I3Q C;  5TMC A;  4A3F C;  5IYC C;  3S16 C;  2JA7 C;  2NVY C;  3S1R C;  3GTQ C;  3S17 C;  1SFO C;  2YU9 C;  1Y1W K;  2VUM K;  2A6H A;  2NVQ C;  3RZO K;  4A3D C;  1TWG K;  4BXX C;  4C3H K;  4BBS C;  4A3G C;  2NVT K;  3CQZ C;  4G7O A;  3WOD A;  3DXJ A;  4XLN A;  3HOV C;  3HOY C;  4A93 C;  3S2H K;  1I50 K;  5IP9 K;  4BY1 K;  1BDF A;  4BBR K;  4A3M K;  1K83 C;  2PPB A;  4BY1 C;  1R9T K;  1TWA C; 
#chains in the Genus database with same CATH topology
 4NOI A;  1F93 A;  2A68 A;  2ZUE A;  3M4O C;  1ISE A;  4J3N A;  2RGR A;  2ZFZ A;  3S15 K;  1Y1V A;  3S1N C;  3FOE A;  4A3J C;  4G0V A;  2V6S A;  3EQL A;  3N0B A;  3I4M K;  1TWF K;  4X6A C;  1ZYR A;  2NVX C;  2R7Z A;  1F7U A;  5IOT A;  2YU9 A;  4G7Z A;  2JA5 C;  2NVY A;  5IP7 K;  4KAT A;  1JOE A;  1O29 A;  1R9T C;  2JA8 C;  4KMU A;  1TWG A;  3GTP A;  1XZP A;  2JA5 K;  5C44 C;  3AH5 A;  1TWC K;  1EQR A;  1WQH A;  4A3I K;  4BBS K;  3BP8 C;  3FOF A;  3HOX C;  4P9S A;  5C3E K;  3GTO A;  3S14 C;  4JK1 A;  3OPF A;  1WOO A;  3GTP K;  3I4N K;  4XSZ A;  5C4X C;  3AD8 C;  2Y0S D;  4C45 A;  4QIW L;  3A8J A;  1O28 A;  4KB4 A;  4A3C K;  4BLA A;  5JFE A;  3CAG A;  3AQP A;  1Y1V K;  1BGW A;  3L4J A;  1ZXO A;  3HOZ C;  4KAR A;  1TWH A;  3BUE A;  4C2M C;  3L4K A;  4LLG A;  1WOS A;  2FQT A;  5IYC K;  1O25 A;  3H3V L;  3GTG A;  5IOR A;  3GTJ K;  3ERE D;  4GTL A;  3GTO C;  1HI9 A;  3HKZ D;  3LAJ A;  1X31 C;  4A3E K;  1JQW A;  2RH6 A;  2PMZ L;  2V6T A;  3T02 A;  2R92 K;  1I6H K;  2P8T A;  1L0W A;  4A3G K;  2Y0S L;  5M5X K;  1Y1W C;  3JST A;  3S16 C;  5E68 A;  2XCQ A;  4KM9 A;  1G51 A;  4WIL A;  2JH3 A;  2R92 A;  4A3G C;  2NVT K;  3WOD A;  3HOV C;  3S0X A;  1BDF A;  4BBR K;  5IOQ A;  2PPB A;  1VJE A;  3S1Q C;  4BXX K;  4YFK A;  3GIR A;  4A3B K;  4BY7 K;  3ORE A;  3M3Y K;  4KB2 A;  2YU9 K;  3S1R K;  3G4A A;  2WB1 D;  4FM9 A;  1O27 A;  4A3B C;  4BY7 C;  3GTM C;  2ZUF A;  3HOZ K;  1ZBS A;  1SFO A;  3FKI K;  4GTA A;  1USO A;  4AYB D;  4WJ3 M;  3HOV K;  1ZQ1 C;  4A3C C;  1VRQ C;  4A3L K;  3S1M K;  3A8I A;  1J6W A;  3IPJ A;  1WCM A;  1TWG C;  4LR2 A;  5C4J C;  4YFN A;  2GSO A;  3K7A K;  4LQY A;  1O26 A;  4LK0 A;  3H0G K;  2R7Z C;  2NVX A;  4MEY A;  3S2D C;  2PHC B;  2PA8 L;  4QIW D;  1YNJ A;  2P5M A;  4Y7N C;  2B63 K;  2E2H K;  1I50 C;  3GEH A;  5HL8 A;  5IP9 C;  2E2I K;  4XSX A;  1DCH A;  3SZY A;  3V4G A;  5M3F K;  1XZP B;  4AH6 A;  3S2D K;  1TWF C;  3I4M C;  3T00 A;  4P5B A;  2GSN A;  3K7A C;  1PJ6 A;  4A3J K;  4GT9 A;  4P5A A;  4O2D A;  4YFX A;  2GSU A;  2A69 A;  4ZH4 A;  5TJ3 A;  3TFH A;  2JA6 C;  3OEP A;  5EGE A;  4A3E C;  2E2I C;  1GE9 A;  4A3M C;  3LPX A;  2PMZ D;  2E2H A;  3BP3 A;  4Y7N K;  4OIP A;  3GTJ C;  3GTP C;  2VUM A;  2BE5 A;  5TMF A;  3G4C A;  3RZO C;  1I3Q C;  1IE0 A;  5IYC C;  2FQO A;  2VUM K;  1DCP A;  3GSI A;  1TWG K;  4BXX C;  3T01 A;  5CJ9 A;  3CQZ C;  4GTB A;  4BY1 C;  1BS2 A;  4Q4Z A;  4X6A K;  3FKI C;  4QJV A;  3TFJ A;  2WAQ L;  4KN4 A;  3HOW C;  2WAQ D;  2NVQ K;  3TFI A;  1SFO K;  3GTQ K;  2WB1 L;  3MML B;  3HOX K;  3M3Y C;  3GTG K;  4KM8 A;  2Y3P A;  4A3I C;  1SMY A;  3AD9 C;  3S1Q K;  2E2H C;  1C0A A;  2KWA A;  4YG2 A;  1IL2 A;  2B63 C;  3HXA A;  3Q3Q A;  1I50 A;  3AQO A;  3GTO K;  1BJT A;  4PAA A;  2NVX K;  3GTG C;  4A3D K;  1IBA A;  2JA7 A;  4Y52 K;  4BKW A;  2CW0 A;  3NUH A;  1IW7 A;  4KAS A;  1Y1W A;  4C2M K;  4OIN A;  1YCL A;  3HOW K;  2R93 A;  1Y1V C;  1O2A A;  3S15 C;  4A3L C;  1WCM K;  3GTL A;  2PA8 D;  1VLO A;  2R92 C;  1EFW A;  1I6H C;  5IYD C;  3RZD C;  4ILD A;  4Q5S A;  3GTK A;  3GTK C;  1VH2 A;  5M3M K;  1WCM C;  3GTJ A;  2VUM C;  2CFA A;  1YX2 A;  1I3Q K;  3H3V D;  2E2I A;  4G0U A;  4Y52 C;  4GZY A;  4LOW A;  1TWC C;  1KQ4 A;  5C44 K;  1IQ0 A;  1TWH K;  1TWA K;  3HKZ L;  3PO2 K;  4XCH A;  1USM A;  5FLM C;  5M5Y K;  1EI6 A;  3VA7 A;  2EBB A;  4FZB A;  5IOS A;  4KC6 A;  4KN7 A;  3I4N C;  3AD7 C;  4A3F C;  1VGX A;  1B4B A;  3GTQ C;  1SFO C;  1Y1W K;  4GTD A;  2NVQ C;  1XZQ A;  1O24 A;  1F7V A;  4RMF A;  4BBS C;  4G7O A;  1O2B A;  3DXJ A;  3FKI A;  1I50 K;  5IP9 K;  4BY1 K;  2JA5 A;  1F9N A;  1RU0 A;  1EH1 A;  3GDZ A;  1XZQ B;  1TWC A;  1R9T K;  1TWA C;  3PO2 C;  5M5W K;  5D4D A;  2V6U A;  1JVI A;  2R7Z K;  4LK1 A;  3S17 K;  1XPP A;  1WSR A;  1J98 A;  2NVY K;  4GTF A;  4WJ4 A;  3QX3 A;  1TWF A;  5C4J K;  1UV7 A;  3GEI A;  1AB4 A;  2O5I A;  3A8K A;  4QJV B;  2O5J A;  4A3K K;  3M4O K;  2R93 C;  3GTQ A;  4C3I C;  3GEE A;  4BLB A;  4OIR A;  1WQG A;  3HOU K;  4MEX A;  1K83 K;  5IYD K;  1B4A A;  3H0G A;  3HOY K;  1DD5 A;  5C4X K;  4GTE A;  4KAW X;  2JA6 K;  1EK8 A;  4A3K C;  2D6F C;  2R93 K;  1I6V A;  3S14 K;  4G0W A;  4M1X A;  2B63 A;  5C3E C;  4A3F K;  2JA6 A;  4DDQ A;  2JA7 K;  3TTG A;  3PO3 C;  3N0C A;  4KDD A;  4GTC A;  5L46 A;  1DCO A;  5IYB K;  1WOP A;  5FLM K;  4BBR C;  3ADA C;  4OIO A;  2JA8 K;  1TWA A;  1V5V A;  1TWH C;  4LJZ A;  5IP7 C;  2E2J K;  5IYB C;  3GTL C;  2NVT C;  1I3Q A;  1O2F B;  4KMD A;  1WIH A;  4KMH A;  5JVO A;  3H0G C;  4AYB L;  3S16 K;  2XCO A;  3S1N K;  2CFA B;  2GAG C;  3FHZ A;  3SZZ A;  1YNN A;  1IS1 A;  5FJ8 K;  3GTK K;  4MQ9 A;  2W7V A;  3S1M C;  1XXB A;  3LAP A;  4XLP A;  3GTL K;  3HOU C;  2E2J C;  1PJ7 A;  3RZD K;  3S2H C;  1J6V A;  4A93 K;  1WSV A;  2A6E A;  4G7H A;  1HQM A;  4C3I K;  1R9T A;  4OIQ A;  4C3H C;  3CQZ K;  5EGH A;  1PJ5 A;  1ZVU A;  4C3J K;  3PO3 K;  1WQF A;  3GTM K;  5TMC A;  2JA7 C;  2NVY C;  1WOR A;  3S1R C;  3S17 C;  2YU9 C;  4C3J C;  2A6H A;  5CHP A;  3RZO K;  4A3D C;  3GTM A;  1XXC A;  4C3H K;  2XCR B;  1INN A;  1J6X A;  3CQZ A;  2GAH C;  4KMA A;  4XLN A;  3HOY C;  4A93 C;  4GFQ A;  3S2H K;  4A3M K;  1K83 C;  1K83 A;  3N3Y A;  1XXA A;  4PAB A; 
#chains in the Genus database with same CATH homology
 4NOI A;  2A68 A;  5M5W K;  4Q4Z A;  4X6A K;  3FKI C;  5D4D A;  4QJV A;  3S1Q C;  4BXX K;  3M4O C;  4YFK A;  2WAQ L;  4KN4 A;  3HOW C;  2WAQ D;  2R7Z K;  4A3B K;  3S15 K;  4LK1 A;  3S17 K;  1XPP A;  3M3Y K;  4BY7 K;  2NVY K;  2NVQ K;  3S1N C;  1SFO K;  2YU9 K;  3S1R K;  4A3J C;  3GTQ K;  2WB1 L;  3HOX K;  2WB1 D;  5C4J K;  4A3B C;  4BY7 C;  3EQL A;  3GTM C;  3M3Y C;  3GTG K;  2O5I A;  4QJV B;  3HOZ K;  3I4M K;  1TWF K;  4A3I C;  2O5J A;  1ZYR A;  4A3K K;  2NVX C;  3M4O K;  2R93 C;  4X6A C;  1SMY A;  3FKI K;  3S1Q K;  4G7Z A;  2JA5 C;  3PO2 C;  5IP7 K;  4OIR A;  1R9T C;  4AYB D;  2E2H C;  4KMU A;  2JA8 C;  3HOU K;  4YG2 A;  1K83 K;  4MEX A;  2B63 C;  3HOV K;  2JA5 K;  4A3C C;  5IYD K;  5C44 C;  3HOY K;  3GTO K;  5C4X K;  1TWC K;  2JA6 K;  4A3L K;  3S1M K;  4A3K C;  2NVX K;  3GTG C;  4A3I K;  4A3D K;  4BBS K;  1I6V A;  2R93 K;  3S14 K;  1TWG C;  4Y52 K;  5C4J C;  4YFN A;  5C3E C;  2CW0 A;  1IW7 A;  3K7A K;  4A3F K;  4C2M K;  3HOX C;  5C3E K;  4LK0 A;  2JA7 K;  4OIN A;  3H0G K;  3S14 C;  4JK1 A;  2R7Z C;  3HOW K;  3GTP K;  1Y1V C;  3S15 C;  3I4N K;  3PO3 C;  4MEY A;  3S2D C;  4A3L C;  1WCM K;  2PA8 L;  4XSZ A;  5C4X C;  2PA8 D;  2Y0S D;  4QIW L;  4QIW D;  5IYB K;  3PO2 K;  5FLM K;  1YNJ A;  4Y7N C;  2R92 C;  2B63 K;  1I6H C;  5IYD C;  4A3C K;  4BBR C;  4OIO A;  2E2H K;  3RZD C;  2JA8 K;  1I50 C;  5IP9 C;  1TWH C;  4LJZ A;  5IP7 C;  2E2J K;  2E2I K;  5IYB C;  3GTL C;  4Q5S A;  4XSX A;  2NVT C;  5M3F K;  3GTK C;  3S2D K;  5M3M K;  1WCM C;  1Y1V K;  1TWF C;  3HOZ C;  2VUM C;  3I4M C;  3H0G C;  3K7A C;  4AYB L;  3S16 K;  4LLG A;  3S1N K;  1I3Q K;  4A3J K;  5IYC K;  3H3V L;  3H3V D;  1YNN A;  4YFX A;  4Y52 C;  4GZY A;  2A69 A;  5FJ8 K;  3GTK K;  4MQ9 A;  4ZH4 A;  1TWC C;  3GTJ K;  3GTO C;  3S1M C;  5C44 K;  2JA6 C;  1TWH K;  1TWA K;  3HKZ L;  3HKZ D;  4XLP A;  4A3E C;  2E2I C;  3RZD K;  2E2J C;  3GTL K;  3HOU C;  3S2H C;  4A3M C;  4A93 K;  2A6E A;  5M5Y K;  5FLM C;  4G7H A;  2PMZ D;  4A3E K;  1I6H K;  2PMZ L;  1HQM A;  4C3I K;  4Y7N K;  2R92 K;  4OIQ A;  3CQZ K;  4OIP A;  3GTJ C;  4A3G K;  3GTP C;  4KN7 A;  2Y0S L;  2BE5 A;  5TMF A;  4C3J K;  5M5X K;  1Y1W C;  3PO3 K;  3GTM K;  3RZO C;  3I4N C;  1I3Q C;  5TMC A;  4A3F C;  5IYC C;  3S16 C;  2JA7 C;  2NVY C;  3S1R C;  3GTQ C;  3S17 C;  1SFO C;  2YU9 C;  1Y1W K;  2VUM K;  2A6H A;  2NVQ C;  3RZO K;  4A3D C;  1TWG K;  4BXX C;  4C3H K;  4BBS C;  4A3G C;  2NVT K;  3CQZ C;  4G7O A;  3WOD A;  3DXJ A;  4XLN A;  3HOV C;  3HOY C;  4A93 C;  3S2H K;  1I50 K;  5IP9 K;  4BY1 K;  1BDF A;  4BBR K;  4A3M K;  1K83 C;  2PPB A;  4BY1 C;  1R9T K;  1TWA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...