3HOWK

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3howK00
3DXJA 3FKIK 2JA7K 2A68A 4OIQA 2NVTK 3S2HK 4X6AK 2Y0SD 2E2JC 4YFNA 3HOVC 1I50C 1K83K 1SFOK 3S17C 2JA5K 3M3YK 4XLNA 1Y1WC 4A3MC 3GTMK 4A3EC 3I4MK 4OIPA 2VUMK 5M3FK 5IYCC 4Y52K 1TWAC 1I3QK 2PA8D 3WODA 3S1RC 3K7AK 2O5JA 3S14K 5C4XC 3S15K 3GTLK 2JA8C 3GTQC 4MQ9A 4YFKA 1TWHK 2NVXC 4A3IC 1SMYA 1TWCC 4LJZA 3S16K 3S1QK 4A3DK 4BY1K 3RZOC 4BXXK 4BY7K 3H0GC 2O5IA 2R92C 1YNNA 1XPPA 3HOUC 3RZDC 2PPBA 4QJVB 1TWFC 1R9TK 2E2JK 5C4JC 2Y0SL 1I50K 3GTJC 3HOVK 3S17K 5C3EC 1Y1WK 4A3MK 2E2HC 4A3EK 5C44C 5IP9C 3HOWC 5IYCK 1TWAK 4OIRA 4A3BC 3S1RK 4QIWD 5TMCA 2PA8L 2WAQD 1WCMK 5C4XK 3M4OC 4Q5SA 4Q4ZA 3GTKC 2JA6C 5M5WK 3GTQK 3HOXC 2A6EA 4KN7A 2NVXK 4A3IK 1TWCK 4MEXA 2B63C 1I6HC 3RZOK 1BDFA 1ZYRA 3H0GK 2R92K 4LLGA 4QJVA 3HOUK 3RZDK 1TWFK 5IYBC 4A93C 4A3LC 3GTPC 4OIOA 2R7ZC 3GTJK 4A3GK 5C3EK 2NVYC 3S1NC 4A3FC 2WB1D 2E2HK 5IP9K 4C2MK 3HOWK 4A3BK 1Y1VC 3M4OK 4KN4A 4QIWL 4A3CC 2WAQL 3GTOC 4A3KC 2JA6K 2A6HA 3HOXK 4BBSC 3HKZD 4LK1A 2B63K 1HQMA 2NVTC 4A3JC 4MEYA 5FLMC 2NVQC 2JA8K 4XSZA 3PO3C 4C3HK 5IYBK 2JA5C 4A93K 3GTPK 2E2IC 2R7ZK 3S1MC 4ZH4A 2VUMC 4BY7C 2YU9C 1I3QC 2NVYK 3S1NK 4C3IK 5D4DA 4BBRC 3CQZC 4A3FK 4XLPA 2WB1L 2BE5A 5IP7C 1Y1VK 3PO2C 4A3CK 2PMZD 5C4JK 3GTOK 3I4NC 4Y7NC 4A3KK 3HOYC 1IW7A 4BXXC 5FJ8K 1TWGC 4AYBD 3HKZL 5C44K 5IYDC 4GZYA 3H3VD 3S2DC 5M5YK 4A3JK 1R9TC 5FLMK 3GTKK 3HOZC 2NVQK 3PO3K 2A69A 2R93C 2CW0A 3GTGC 4LK0A 1WCMC 4KMUA 3FKIC 2E2IK 2JA7C 3S1MK 1I6HK 2YU9K 1I6VA 4OINA 3S2HC 4X6AC 4G7HA 4BBRK 3CQZK 5TMFA 1K83C 3EQLA 1SFOC 4A3LK 3M3YC 5IP7K 4G7ZA 3GTMC 3I4MC 5M5XK 3PO2K 4Y52C 5M3MK 4G7OA 3I4NK 4Y7NK 2PMZL 3HOYK 4YFXA 4YG2A 3K7AC 3S14C 3S15C 1TWGK 5IYDK 3GTLC 4AYBL 1YNJA 3H3VL 4C3JK 4XSXA 3S2DK 1TWHC 4NOIA 3S16C 3HOZK 3S1QC 4A3DC 4BY1C 4A3GC 3GTGK 4BBSK 2R93K 4JK1A
chains in the Genus database with same CATH superfamily
3DXJA 2JA7K 3T00A 4KC6A 2NVTK 1Y1VA 1O2AA 3M3YK 3BUEA 4OIPA 2GSNA 5M3FK 3S1RC 4G0VA 3V4GA 4MQ9A 1IS1A 3S16K 4BY1K 2VUMA 2YU9A 2O5IA 1VJEA 1YNNA 1XPPA 3CQZA 3AQPA 2PPBA 5C4JC 2Y0SL 3GTJC 5C3EC 4OIRA 3S1RK 3M4OC 3TFHA 1O29A 3T01A 4Q4ZA 3L4JA 4P5BA 2A6EA 2JA7A 3A8KA 4FZBA 1I6HC 3AD8C 1INNA 1ZXOA 1O26A 2XCOA 4KAWX 1ZQ1C 4LLGA 2D6FC 4A93C 3GTJK 4A3GK 5C3EK 2WB1D 3N0CA 3TTGA 1WQFA 4KB2A 3M4OK 1O24A 5EGEA 3N3YA 4LK1A 1HQMA 5CJ9A 1JVIA 3LPXA 2JA8K 4XSZA 2JA5C 4A93K 2E2IC 1BS2A 4GTCA 5D4DA 4BBRC 2BE5A 3IPJA 2PMZD 1YX2A 3FOFA 3HOYC 3GEEA 5TJ3A 3LAJA 2W7VA 3S2DC 1J6VA 1R9TC 3A8JA 3HOZC 2A69A 3GTJA 2R93C 3GTGC 1VH2A 4LK0A 1EI6A 2E2IK 4LOWA 2EBBA 1I6VA 3S2HC 1USMA 5EGHA 4G7HA 4X6AC 4BBRK 1O25A 3HOYK 3S15C 4LR2A 1V5VA 4BKWA 3H3VL 3S2DK 4XSXA 1BGWA 3HOZK 1USOA 2R93K 3GTGK 1IQ0A 1EFWA 3S2HK 4X6AK 2XCRB 4P9SA 1B4AA 4YFNA 2E2JC 4G0UA 3S17C 1Y1WC 3VA7A 2VUMK 5IYCC 2PA8D 3WODA 3S15K 1ZVUA 2JA5A 1YCLA 2E2IA 1G51A 4FM9A 2R92C 3HOUC 3RZDC 4QJVB 2E2JK 1DD5A 3S17K 1O2FB 1Y1WK 2FQOA 1XZPB 1XZQA 1IE0A 5C44C 5IYCK 4A3BC 1BJTA 4QIWD 5TMCA 2WAQD 4Q5SA 3G4AA 1EK8A 4XCHA 1R9TA 2JA6C 5IOQA 3HOXC 3GTGA 2R93A 4KN7A 5JFEA 1C0AA 1BDFA 1ZYRA 4WILA 2R92K 3HOUK 3RZDK 4GT9A 4A3LC 4OIOA 3S1NC 3GEIA 4C3IC 4GTFA 4A3BK 4KMHA 1J98A 1WQHA 4KN4A 4A3CC 4A3KC 2JA6K 1WSVA 3HOXK 2V6SA 5JVOA 1F9NA 4A3JC 4MEYA 4KB4A 1Y1WA 2ZUFA 4JK1A 4ZH4A 1I3QC 3S1NK 4C3IK 3CAGA 3QX3A 2WB1L 1ISEA 2GAHC 3PO2C 4A3CK 5C4JK 4A3KK 3GSIA 4BXXC 4GTEA 5FJ8K 4GZYA 4KM8A 1WOOA 2R92A 3G4CA 4A3JK 2CW0A 4GTAA 5IORA 1WCMC 1I6HK 4KM9A 2GSUA 4KDDA 1K83C 2JA6A 4G7ZA 1WORA 3I4MC 3PO2K 3T02A 2PMZL 1VGXA 1O2BA 3GTLC 4KASA 4ILDA 2RGRA 1WCMK 4C45A 2Y3PA 2A68A 4OIQA 3HOVC 1I50C 1X31C 1K83K 2JA5K 4XLNA 3FHZA 3I4MK 2CFAA 1TWAC 5C4XC 1EH1A 3GTLK 3S0XA 4YFKA 2NVXC 4A3IC 1TWCC 4LJZA 1XZPA 3H0GC 1I3QA 2RH6A 3LAPA 2ZFZA 2GSOA 1R9TK 1AB4A 3FOEA 3HOVK 1I50K 1PJ6A 2E2HC 3HOWC 4C2MC 1TWAK 3HXAA 1XXCA 2PA8L 5C4XK 3GTKC 5M5WK 3BP8C 2NVXK 4A3IK 1WCMA 1TWCK 4MEXA 1ZBSA 3H0GK 1K83A 1O27A 1UV7A 5IYBC 1O28A 3L4KA 2R7ZC 1XXAA 2JH3A 3OEPA 2NVYC 4KATA 2E2HK 3HOWK 4C2MK 3GTLA 1J6XA 4QIWL 3ERED 1IL2A 2WAQL 3GTOC 2A6HA 1KQ4A 3HKZD 4BBSC 2V6TA 3OREA 1L0WA 2P5MA 3TFIA 3NUHA 2FQTA 2NVTC 4RMFA 3PO3C 3GIRA 4J3NA 1I50A 5IOTA 5IYBK 2R7ZK 3S1MC 1DCHA 1TWAA 2NVYK 1EQRA 1F7UA 5IP7C 1XXBA 3TFJA 2ZUEA 2NVXA 3GTOK 3I4NC 1TWCA 4Y7NC 1IW7A 2KWAA 3H0GA 1TWGC 4AYBD 5C44K 5M5YK 3OPFA 3PO3K 1HI9A 4KMUA 3FKIC 2E2HA 3S1MK 1VLOA 3SZYA 1VRQC 3AD9C 4WJ4A 3BP3A 3EQLA 1SFOC 3GTKA 4A3LK 1IBAA 5IP7K 3GTMC 5M5XK 4G7OA 4Y52C 5M3MK 3I4NK 4Y7NK 4YG2A 3K7AC 3S14C 1TWGK 1RU0A 4LQYA 3AH5A 1TWHC 4NOIA 3S1QC 4A3DC 2R7ZA 4A3GC 4BY7C 2NVYA 3FKIK 5E68A 2Y0SD 1JOEA 5HL8A 3GTOA 1SFOK 4A3MC 3GEHA 4A3EC 3GTMK 1WOPA 1XZQB 4Y52K 1I3QK 3K7AK 2O5JA 3S14K 1B4BA 4G0WA 2JA8C 3GTQC 4P5AA 4AH6A 1TWHK 4KMDA 1SMYA 3S1QK 4A3DK 1WQGA 4BXXK 3RZOC 4BY7K 1DCPA 4GFQA 3ADAC 1TWFC 1PJ5A 1GE9A 4A3MK 4A3EK 1TWGA 5IP9C 4O2DA 4DDQA 4BLBA 2GAGC 3GTQK 5L46A 3FKIA 1WIHA 2B63C 3RZOK 1J6WA 3AD7C 4QJVA 4C3HC 1TWFK 1SFOA 3GTPC 3GTMA 2XCQA 4A3FC 3JSTA 5IP9K 1F7VA 4PAAA 1Y1VC 3N0BA 1TWHA 2P8TA 2B63K 1F93A 4BLAA 4KMAA 5FLMC 2NVQC 4C3HK 3GTPK 2VUMC 2YU9C 4A3FK 3CQZC 4XLPA 3GTQA 1Y1VK 3SZZA 1JQWA 5IYDC 3HKZL 1WSRA 3H3VD 4C3JC 1TWFA 3GDZA 5FLMK 3GTKK 2NVQK 5IOSA 4KARA 3A8IA 3AQOA 4GTLA 2JA7C 1WOSA 4WJ3M 2YU9K 4OINA 1PJ7A 1DCOA 4GTBA 3CQZK 5TMFA 2V6UA 3M3YC 3MMLB 4PABA 2PHCB 2CFAB 4YFXA 2B63A 4GTDA 5CHPA 5IYDK 4AYBL 3Q3QA 1YNJA 4C3JK 3GTPA 3S16C 4BY1C 4BBSK 4M1XA
chains in the Genus database with same CATH topology
3DXJA 3FKIK 2JA7K 2A68A 4OIQA 2NVTK 3S2HK 4X6AK 2Y0SD 2E2JC 4YFNA 3HOVC 1I50C 1K83K 1SFOK 3S17C 2JA5K 3M3YK 4XLNA 1Y1WC 4A3MC 3GTMK 4A3EC 3I4MK 4OIPA 2VUMK 5M3FK 5IYCC 4Y52K 1TWAC 1I3QK 2PA8D 3WODA 3S1RC 3K7AK 2O5JA 3S14K 5C4XC 3S15K 3GTLK 2JA8C 3GTQC 4MQ9A 4YFKA 1TWHK 2NVXC 4A3IC 1SMYA 1TWCC 4LJZA 3S16K 3S1QK 4A3DK 4BY1K 3RZOC 4BXXK 4BY7K 3H0GC 2O5IA 2R92C 1YNNA 1XPPA 3HOUC 3RZDC 2PPBA 4QJVB 1TWFC 1R9TK 2E2JK 5C4JC 2Y0SL 1I50K 3GTJC 3HOVK 3S17K 5C3EC 1Y1WK 4A3MK 2E2HC 4A3EK 5C44C 5IP9C 3HOWC 5IYCK 1TWAK 4OIRA 4A3BC 3S1RK 4QIWD 5TMCA 2PA8L 2WAQD 1WCMK 5C4XK 3M4OC 4Q5SA 4Q4ZA 3GTKC 2JA6C 5M5WK 3GTQK 3HOXC 2A6EA 4KN7A 2NVXK 4A3IK 1TWCK 4MEXA 2B63C 1I6HC 3RZOK 1BDFA 1ZYRA 3H0GK 2R92K 4LLGA 4QJVA 3HOUK 3RZDK 1TWFK 5IYBC 4A93C 4A3LC 3GTPC 4OIOA 2R7ZC 3GTJK 4A3GK 5C3EK 2NVYC 3S1NC 4A3FC 2WB1D 2E2HK 5IP9K 4C2MK 3HOWK 4A3BK 1Y1VC 3M4OK 4KN4A 4QIWL 4A3CC 2WAQL 3GTOC 4A3KC 2JA6K 2A6HA 3HOXK 4BBSC 3HKZD 4LK1A 2B63K 1HQMA 2NVTC 4A3JC 4MEYA 5FLMC 2NVQC 2JA8K 4XSZA 3PO3C 4C3HK 5IYBK 2JA5C 4A93K 3GTPK 2E2IC 2R7ZK 3S1MC 4ZH4A 2VUMC 4BY7C 2YU9C 1I3QC 2NVYK 3S1NK 4C3IK 5D4DA 4BBRC 3CQZC 4A3FK 4XLPA 2WB1L 2BE5A 5IP7C 1Y1VK 3PO2C 4A3CK 2PMZD 5C4JK 3GTOK 3I4NC 4Y7NC 4A3KK 3HOYC 1IW7A 4BXXC 5FJ8K 1TWGC 4AYBD 3HKZL 5C44K 5IYDC 4GZYA 3H3VD 3S2DC 5M5YK 4A3JK 1R9TC 5FLMK 3GTKK 3HOZC 2NVQK 3PO3K 2A69A 2R93C 2CW0A 3GTGC 4LK0A 1WCMC 4KMUA 3FKIC 2E2IK 2JA7C 3S1MK 1I6HK 2YU9K 1I6VA 4OINA 3S2HC 4X6AC 4G7HA 4BBRK 3CQZK 5TMFA 1K83C 3EQLA 1SFOC 4A3LK 3M3YC 5IP7K 4G7ZA 3GTMC 3I4MC 5M5XK 3PO2K 4Y52C 5M3MK 4G7OA 3I4NK 4Y7NK 2PMZL 3HOYK 4YFXA 4YG2A 3K7AC 3S14C 3S15C 1TWGK 5IYDK 3GTLC 4AYBL 1YNJA 3H3VL 4C3JK 4XSXA 3S2DK 1TWHC 4NOIA 3S16C 3HOZK 3S1QC 4A3DC 4BY1C 4A3GC 3GTGK 4BBSK 2R93K 4JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ A;  3FKI K;  2JA7 K;  2A68 A;  4OIQ A;  2NVT K;  3S2H K;  4X6A K;  2Y0S D;  2E2J C;  4YFN A;  3HOV C;  1I50 C;  1K83 K;  1SFO K;  3S17 C;  2JA5 K;  3M3Y K;  4XLN A;  1Y1W C;  4A3M C;  3GTM K;  4A3E C;  3I4M K;  4OIP A;  2VUM K;  5M3F K;  5IYC C;  4Y52 K;  1TWA C;  1I3Q K;  2PA8 D;  3WOD A;  3S1R C;  3K7A K;  2O5J A;  3S14 K;  5C4X C;  3S15 K;  3GTL K;  2JA8 C;  3GTQ C;  4MQ9 A;  4YFK A;  1TWH K;  2NVX C;  4A3I C;  1SMY A;  1TWC C;  4LJZ A;  3S16 K;  3S1Q K;  4A3D K;  4BY1 K;  3RZO C;  4BXX K;  4BY7 K;  3H0G C;  2O5I A;  2R92 C;  1YNN A;  1XPP A;  3HOU C;  3RZD C;  2PPB A;  4QJV B;  1TWF C;  1R9T K;  2E2J K;  5C4J C;  2Y0S L;  1I50 K;  3GTJ C;  3HOV K;  3S17 K;  5C3E C;  1Y1W K;  4A3M K;  2E2H C;  4A3E K;  5C44 C;  5IP9 C;  3HOW C;  5IYC K;  1TWA K;  4OIR A;  4A3B C;  3S1R K;  4QIW D;  5TMC A;  2PA8 L;  2WAQ D;  1WCM K;  5C4X K;  3M4O C;  4Q5S A;  4Q4Z A;  3GTK C;  2JA6 C;  5M5W K;  3GTQ K;  3HOX C;  2A6E A;  4KN7 A;  2NVX K;  4A3I K;  1TWC K;  4MEX A;  2B63 C;  1I6H C;  3RZO K;  1BDF A;  1ZYR A;  3H0G K;  2R92 K;  4LLG A;  4QJV A;  3HOU K;  3RZD K;  1TWF K;  5IYB C;  4A93 C;  4A3L C;  3GTP C;  4OIO A;  2R7Z C;  3GTJ K;  4A3G K;  5C3E K;  2NVY C;  3S1N C;  4A3F C;  2WB1 D;  2E2H K;  5IP9 K;  4C2M K;  3HOW K;  4A3B K;  1Y1V C;  3M4O K;  4KN4 A;  4QIW L;  4A3C C;  2WAQ L;  3GTO C;  4A3K C;  2JA6 K;  2A6H A;  3HOX K;  4BBS C;  3HKZ D;  4LK1 A;  2B63 K;  1HQM A;  2NVT C;  4A3J C;  4MEY A;  5FLM C;  2NVQ C;  2JA8 K;  4XSZ A;  3PO3 C;  4C3H K;  5IYB K;  2JA5 C;  4A93 K;  3GTP K;  2E2I C;  2R7Z K;  3S1M C;  4ZH4 A;  2VUM C;  4BY7 C;  2YU9 C;  1I3Q C;  2NVY K;  3S1N K;  4C3I K;  5D4D A;  4BBR C;  3CQZ C;  4A3F K;  4XLP A;  2WB1 L;  2BE5 A;  5IP7 C;  1Y1V K;  3PO2 C;  4A3C K;  2PMZ D;  5C4J K;  3GTO K;  3I4N C;  4Y7N C;  4A3K K;  3HOY C;  1IW7 A;  4BXX C;  5FJ8 K;  1TWG C;  4AYB D;  3HKZ L;  5C44 K;  5IYD C;  4GZY A;  3H3V D;  3S2D C;  5M5Y K;  4A3J K;  1R9T C;  5FLM K;  3GTK K;  3HOZ C;  2NVQ K;  3PO3 K;  2A69 A;  2R93 C;  2CW0 A;  3GTG C;  4LK0 A;  1WCM C;  4KMU A;  3FKI C;  2E2I K;  2JA7 C;  3S1M K;  1I6H K;  2YU9 K;  1I6V A;  4OIN A;  3S2H C;  4X6A C;  4G7H A;  4BBR K;  3CQZ K;  5TMF A;  1K83 C;  3EQL A;  1SFO C;  4A3L K;  3M3Y C;  5IP7 K;  4G7Z A;  3GTM C;  3I4M C;  5M5X K;  3PO2 K;  4Y52 C;  5M3M K;  4G7O A;  3I4N K;  4Y7N K;  2PMZ L;  3HOY K;  4YFX A;  4YG2 A;  3K7A C;  3S14 C;  3S15 C;  1TWG K;  5IYD K;  3GTL C;  4AYB L;  1YNJ A;  3H3V L;  4C3J K;  4XSX A;  3S2D K;  1TWH C;  4NOI A;  3S16 C;  3HOZ K;  3S1Q C;  4A3D C;  4BY1 C;  4A3G C;  3GTG K;  4BBS K;  2R93 K;  4JK1 A; 
#chains in the Genus database with same CATH topology
 3DXJ A;  2JA7 K;  3T00 A;  4KC6 A;  2NVT K;  1Y1V A;  1O2A A;  3M3Y K;  3BUE A;  4OIP A;  2GSN A;  5M3F K;  3S1R C;  4G0V A;  3V4G A;  4MQ9 A;  1IS1 A;  3S16 K;  4BY1 K;  2VUM A;  2YU9 A;  2O5I A;  1VJE A;  1YNN A;  1XPP A;  3CQZ A;  3AQP A;  2PPB A;  5C4J C;  2Y0S L;  3GTJ C;  5C3E C;  4OIR A;  3S1R K;  3M4O C;  3TFH A;  1O29 A;  3T01 A;  4Q4Z A;  3L4J A;  4P5B A;  2A6E A;  2JA7 A;  3A8K A;  4FZB A;  1I6H C;  3AD8 C;  1INN A;  1ZXO A;  1O26 A;  2XCO A;  4KAW X;  1ZQ1 C;  4LLG A;  2D6F C;  4A93 C;  3GTJ K;  4A3G K;  5C3E K;  2WB1 D;  3N0C A;  3TTG A;  1WQF A;  4KB2 A;  3M4O K;  1O24 A;  5EGE A;  3N3Y A;  4LK1 A;  1HQM A;  5CJ9 A;  1JVI A;  3LPX A;  2JA8 K;  4XSZ A;  2JA5 C;  4A93 K;  2E2I C;  1BS2 A;  4GTC A;  5D4D A;  4BBR C;  2BE5 A;  3IPJ A;  2PMZ D;  1YX2 A;  3FOF A;  3HOY C;  3GEE A;  5TJ3 A;  3LAJ A;  2W7V A;  3S2D C;  1J6V A;  1R9T C;  3A8J A;  3HOZ C;  2A69 A;  3GTJ A;  2R93 C;  3GTG C;  1VH2 A;  4LK0 A;  1EI6 A;  2E2I K;  4LOW A;  2EBB A;  1I6V A;  3S2H C;  1USM A;  5EGH A;  4G7H A;  4X6A C;  4BBR K;  1O25 A;  3HOY K;  3S15 C;  4LR2 A;  1V5V A;  4BKW A;  3H3V L;  3S2D K;  4XSX A;  1BGW A;  3HOZ K;  1USO A;  2R93 K;  3GTG K;  1IQ0 A;  1EFW A;  3S2H K;  4X6A K;  2XCR B;  4P9S A;  1B4A A;  4YFN A;  2E2J C;  4G0U A;  3S17 C;  1Y1W C;  3VA7 A;  2VUM K;  5IYC C;  2PA8 D;  3WOD A;  3S15 K;  1ZVU A;  2JA5 A;  1YCL A;  2E2I A;  1G51 A;  4FM9 A;  2R92 C;  3HOU C;  3RZD C;  4QJV B;  2E2J K;  1DD5 A;  3S17 K;  1O2F B;  1Y1W K;  2FQO A;  1XZP B;  1XZQ A;  1IE0 A;  5C44 C;  5IYC K;  4A3B C;  1BJT A;  4QIW D;  5TMC A;  2WAQ D;  4Q5S A;  3G4A A;  1EK8 A;  4XCH A;  1R9T A;  2JA6 C;  5IOQ A;  3HOX C;  3GTG A;  2R93 A;  4KN7 A;  5JFE A;  1C0A A;  1BDF A;  1ZYR A;  4WIL A;  2R92 K;  3HOU K;  3RZD K;  4GT9 A;  4A3L C;  4OIO A;  3S1N C;  3GEI A;  4C3I C;  4GTF A;  4A3B K;  4KMH A;  1J98 A;  1WQH A;  4KN4 A;  4A3C C;  4A3K C;  2JA6 K;  1WSV A;  3HOX K;  2V6S A;  5JVO A;  1F9N A;  4A3J C;  4MEY A;  4KB4 A;  1Y1W A;  2ZUF A;  4JK1 A;  4ZH4 A;  1I3Q C;  3S1N K;  4C3I K;  3CAG A;  3QX3 A;  2WB1 L;  1ISE A;  2GAH C;  3PO2 C;  4A3C K;  5C4J K;  4A3K K;  3GSI A;  4BXX C;  4GTE A;  5FJ8 K;  4GZY A;  4KM8 A;  1WOO A;  2R92 A;  3G4C A;  4A3J K;  2CW0 A;  4GTA A;  5IOR A;  1WCM C;  1I6H K;  4KM9 A;  2GSU A;  4KDD A;  1K83 C;  2JA6 A;  4G7Z A;  1WOR A;  3I4M C;  3PO2 K;  3T02 A;  2PMZ L;  1VGX A;  1O2B A;  3GTL C;  4KAS A;  4ILD A;  2RGR A;  1WCM K;  4C45 A;  2Y3P A;  2A68 A;  4OIQ A;  3HOV C;  1I50 C;  1X31 C;  1K83 K;  2JA5 K;  4XLN A;  3FHZ A;  3I4M K;  2CFA A;  1TWA C;  5C4X C;  1EH1 A;  3GTL K;  3S0X A;  4YFK A;  2NVX C;  4A3I C;  1TWC C;  4LJZ A;  1XZP A;  3H0G C;  1I3Q A;  2RH6 A;  3LAP A;  2ZFZ A;  2GSO A;  1R9T K;  1AB4 A;  3FOE A;  3HOV K;  1I50 K;  1PJ6 A;  2E2H C;  3HOW C;  4C2M C;  1TWA K;  3HXA A;  1XXC A;  2PA8 L;  5C4X K;  3GTK C;  5M5W K;  3BP8 C;  2NVX K;  4A3I K;  1WCM A;  1TWC K;  4MEX A;  1ZBS A;  3H0G K;  1K83 A;  1O27 A;  1UV7 A;  5IYB C;  1O28 A;  3L4K A;  2R7Z C;  1XXA A;  2JH3 A;  3OEP A;  2NVY C;  4KAT A;  2E2H K;  3HOW K;  4C2M K;  3GTL A;  1J6X A;  4QIW L;  3ERE D;  1IL2 A;  2WAQ L;  3GTO C;  2A6H A;  1KQ4 A;  3HKZ D;  4BBS C;  2V6T A;  3ORE A;  1L0W A;  2P5M A;  3TFI A;  3NUH A;  2FQT A;  2NVT C;  4RMF A;  3PO3 C;  3GIR A;  4J3N A;  1I50 A;  5IOT A;  5IYB K;  2R7Z K;  3S1M C;  1DCH A;  1TWA A;  2NVY K;  1EQR A;  1F7U A;  5IP7 C;  1XXB A;  3TFJ A;  2ZUE A;  2NVX A;  3GTO K;  3I4N C;  1TWC A;  4Y7N C;  1IW7 A;  2KWA A;  3H0G A;  1TWG C;  4AYB D;  5C44 K;  5M5Y K;  3OPF A;  3PO3 K;  1HI9 A;  4KMU A;  3FKI C;  2E2H A;  3S1M K;  1VLO A;  3SZY A;  1VRQ C;  3AD9 C;  4WJ4 A;  3BP3 A;  3EQL A;  1SFO C;  3GTK A;  4A3L K;  1IBA A;  5IP7 K;  3GTM C;  5M5X K;  4G7O A;  4Y52 C;  5M3M K;  3I4N K;  4Y7N K;  4YG2 A;  3K7A C;  3S14 C;  1TWG K;  1RU0 A;  4LQY A;  3AH5 A;  1TWH C;  4NOI A;  3S1Q C;  4A3D C;  2R7Z A;  4A3G C;  4BY7 C;  2NVY A;  3FKI K;  5E68 A;  2Y0S D;  1JOE A;  5HL8 A;  3GTO A;  1SFO K;  4A3M C;  3GEH A;  4A3E C;  3GTM K;  1WOP A;  1XZQ B;  4Y52 K;  1I3Q K;  3K7A K;  2O5J A;  3S14 K;  1B4B A;  4G0W A;  2JA8 C;  3GTQ C;  4P5A A;  4AH6 A;  1TWH K;  4KMD A;  1SMY A;  3S1Q K;  4A3D K;  1WQG A;  4BXX K;  3RZO C;  4BY7 K;  1DCP A;  4GFQ A;  3ADA C;  1TWF C;  1PJ5 A;  1GE9 A;  4A3M K;  4A3E K;  1TWG A;  5IP9 C;  4O2D A;  4DDQ A;  4BLB A;  2GAG C;  3GTQ K;  5L46 A;  3FKI A;  1WIH A;  2B63 C;  3RZO K;  1J6W A;  3AD7 C;  4QJV A;  4C3H C;  1TWF K;  1SFO A;  3GTP C;  3GTM A;  2XCQ A;  4A3F C;  3JST A;  5IP9 K;  1F7V A;  4PAA A;  1Y1V C;  3N0B A;  1TWH A;  2P8T A;  2B63 K;  1F93 A;  4BLA A;  4KMA A;  5FLM C;  2NVQ C;  4C3H K;  3GTP K;  2VUM C;  2YU9 C;  4A3F K;  3CQZ C;  4XLP A;  3GTQ A;  1Y1V K;  3SZZ A;  1JQW A;  5IYD C;  3HKZ L;  1WSR A;  3H3V D;  4C3J C;  1TWF A;  3GDZ A;  5FLM K;  3GTK K;  2NVQ K;  5IOS A;  4KAR A;  3A8I A;  3AQO A;  4GTL A;  2JA7 C;  1WOS A;  4WJ3 M;  2YU9 K;  4OIN A;  1PJ7 A;  1DCO A;  4GTB A;  3CQZ K;  5TMF A;  2V6U A;  3M3Y C;  3MML B;  4PAB A;  2PHC B;  2CFA B;  4YFX A;  2B63 A;  4GTD A;  5CHP A;  5IYD K;  4AYB L;  3Q3Q A;  1YNJ A;  4C3J K;  3GTP A;  3S16 C;  4BY1 C;  4BBS K;  4M1X A; 
#chains in the Genus database with same CATH homology
 3DXJ A;  3FKI K;  2JA7 K;  2A68 A;  4OIQ A;  2NVT K;  3S2H K;  4X6A K;  2Y0S D;  2E2J C;  4YFN A;  3HOV C;  1I50 C;  1K83 K;  1SFO K;  3S17 C;  2JA5 K;  3M3Y K;  4XLN A;  1Y1W C;  4A3M C;  3GTM K;  4A3E C;  3I4M K;  4OIP A;  2VUM K;  5M3F K;  5IYC C;  4Y52 K;  1TWA C;  1I3Q K;  2PA8 D;  3WOD A;  3S1R C;  3K7A K;  2O5J A;  3S14 K;  5C4X C;  3S15 K;  3GTL K;  2JA8 C;  3GTQ C;  4MQ9 A;  4YFK A;  1TWH K;  2NVX C;  4A3I C;  1SMY A;  1TWC C;  4LJZ A;  3S16 K;  3S1Q K;  4A3D K;  4BY1 K;  3RZO C;  4BXX K;  4BY7 K;  3H0G C;  2O5I A;  2R92 C;  1YNN A;  1XPP A;  3HOU C;  3RZD C;  2PPB A;  4QJV B;  1TWF C;  1R9T K;  2E2J K;  5C4J C;  2Y0S L;  1I50 K;  3GTJ C;  3HOV K;  3S17 K;  5C3E C;  1Y1W K;  4A3M K;  2E2H C;  4A3E K;  5C44 C;  5IP9 C;  3HOW C;  5IYC K;  1TWA K;  4OIR A;  4A3B C;  3S1R K;  4QIW D;  5TMC A;  2PA8 L;  2WAQ D;  1WCM K;  5C4X K;  3M4O C;  4Q5S A;  4Q4Z A;  3GTK C;  2JA6 C;  5M5W K;  3GTQ K;  3HOX C;  2A6E A;  4KN7 A;  2NVX K;  4A3I K;  1TWC K;  4MEX A;  2B63 C;  1I6H C;  3RZO K;  1BDF A;  1ZYR A;  3H0G K;  2R92 K;  4LLG A;  4QJV A;  3HOU K;  3RZD K;  1TWF K;  5IYB C;  4A93 C;  4A3L C;  3GTP C;  4OIO A;  2R7Z C;  3GTJ K;  4A3G K;  5C3E K;  2NVY C;  3S1N C;  4A3F C;  2WB1 D;  2E2H K;  5IP9 K;  4C2M K;  3HOW K;  4A3B K;  1Y1V C;  3M4O K;  4KN4 A;  4QIW L;  4A3C C;  2WAQ L;  3GTO C;  4A3K C;  2JA6 K;  2A6H A;  3HOX K;  4BBS C;  3HKZ D;  4LK1 A;  2B63 K;  1HQM A;  2NVT C;  4A3J C;  4MEY A;  5FLM C;  2NVQ C;  2JA8 K;  4XSZ A;  3PO3 C;  4C3H K;  5IYB K;  2JA5 C;  4A93 K;  3GTP K;  2E2I C;  2R7Z K;  3S1M C;  4ZH4 A;  2VUM C;  4BY7 C;  2YU9 C;  1I3Q C;  2NVY K;  3S1N K;  4C3I K;  5D4D A;  4BBR C;  3CQZ C;  4A3F K;  4XLP A;  2WB1 L;  2BE5 A;  5IP7 C;  1Y1V K;  3PO2 C;  4A3C K;  2PMZ D;  5C4J K;  3GTO K;  3I4N C;  4Y7N C;  4A3K K;  3HOY C;  1IW7 A;  4BXX C;  5FJ8 K;  1TWG C;  4AYB D;  3HKZ L;  5C44 K;  5IYD C;  4GZY A;  3H3V D;  3S2D C;  5M5Y K;  4A3J K;  1R9T C;  5FLM K;  3GTK K;  3HOZ C;  2NVQ K;  3PO3 K;  2A69 A;  2R93 C;  2CW0 A;  3GTG C;  4LK0 A;  1WCM C;  4KMU A;  3FKI C;  2E2I K;  2JA7 C;  3S1M K;  1I6H K;  2YU9 K;  1I6V A;  4OIN A;  3S2H C;  4X6A C;  4G7H A;  4BBR K;  3CQZ K;  5TMF A;  1K83 C;  3EQL A;  1SFO C;  4A3L K;  3M3Y C;  5IP7 K;  4G7Z A;  3GTM C;  3I4M C;  5M5X K;  3PO2 K;  4Y52 C;  5M3M K;  4G7O A;  3I4N K;  4Y7N K;  2PMZ L;  3HOY K;  4YFX A;  4YG2 A;  3K7A C;  3S14 C;  3S15 C;  1TWG K;  5IYD K;  3GTL C;  4AYB L;  1YNJ A;  3H3V L;  4C3J K;  4XSX A;  3S2D K;  1TWH C;  4NOI A;  3S16 C;  3HOZ K;  3S1Q C;  4A3D C;  4BY1 C;  4A3G C;  3GTG K;  4BBS K;  2R93 K;  4JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...