3HOWK

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3howK00
4LLGA 3FKIC 3H3VD 2NVTC 3M3YC 4XSXA 2O5IA 4BXXK 4A3EC 4BBSK 4BY7K 2R93C 3S15C 2Y0SD 3HOXK 3S2HK 5IP9C 4G7ZA 4AYBL 1I3QK 1TWCK 2PMZD 3GTPC 2YU9K 5M5WK 4A3FC 1TWAC 3RZDK 1R9TK 4A3IC 2VUMK 5IP7C 4Y7NK 1YNJA 5IYDK 3K7AC 4A3BC 5C3EC 4BY1C 2JA7K 2JA5C 3GTKK 3GTOK 2R92K 4A3LK 5M3FK 2E2IK 4A3DC 1HQMA 3H0GC 1I6VA 1TWHC 1XPPA 1YNNA 5C44C 3HOUK 3PO2C 2B63C 4A3JC 3GTQC 3S17K 3I4NC 2NVTK 4A3EK 2R93K 3S15K 4LK0A 5FJ8K 4MEYA 1TWFC 4A3CC 4A3GC 2E2JC 2NVYK 2A68A 2NVQC 3I4MC 4A3FK 2PA8D 3HOZC 5C4JK 4A3IK 3S1QC 3CQZC 3K7AK 4KN4A 4ZH4A 4OIOA 1TWGC 5IYCK 5C3EK 3GTJC 4A3MK 2PPBA 4BY1K 4OINA 3HOYC 2A6EA 4C3HK 2NVXK 3S14C 4NOIA 2WB1L 1TWHK 1Y1VK 2WAQL 4MQ9A 4OIPA 5C44K 2R7ZC 3PO2K 1I50C 4QIWL 4A3JK 2B63K 3HKZL 1Y1WK 3GTLC 5FLMC 4LJZA 4AYBD 1K83C 5TMCA 4QIWD 1IW7A 3GTMK 4A3CK 4A3GK 2E2JK 2A69A 5TMFA 4BBRC 5C4XK 3GTGC 1SFOC 4C3JK 1WCMK 3FKIK 5IYBC 2JA8C 4A93C 4X6AC 3M3YK 3M4OC 3S1RC 1I6HK 3HOYK 4A3KC 3HOVC 3EQLA 4YFXA 5IP9K 1BDFA 3GTPK 2R7ZK 1TWAK 3GTLK 4Q5SA 4YG2A 5FLMK 5IP7K 2JA6C 4G7OA 1ZYRA 1K83K 3RZOC 1I6HC 2JA5K 3HOWC 4GZYA 4A3DK 4BBRK 3H0GK 3DXJA 1SFOK 3GTGK 3S2DC 4Y52C 3GTQK 3I4NK 4A93K 3HOXC 3M4OK 3S2HC 2WB1D 3S1RK 4MEXA 4OIQA 2WAQD 1I3QC 1TWCC 1TWFK 4XLNA 3HKZD 3RZDC 3S1NC 2NVQK 1R9TC 5M3MK 3I4MK 4Y7NC 3S1MC 2E2HC 3HOZK 3S1QK 2JA7C 3CQZK 4KN7A 4C3IK 3GTOC 3H3VL 2E2IC 3GTJK 3RZOK 4A3LC 1TWGK 3HOUC 4OIRA 3HOWK 3S14K 2Y0SL 3S17C 3S2DK 3S16C 2PMZL 4Y52K 1I50K 5M5YK 4YFNA 4XLPA 4C2MK 2NVYC 3PO3C 3S1NK 4QJVA 4A3BK 5C4JC 2BE5A 3S1MK 2E2HK 3WODA 4BBSC 4BXXC 4BY7C 5IYCC 5IYBK 4A3MC 2JA8K 4X6AK 5D4DA 2NVXC 4QJVB 1Y1VC 4A3KK 4LK1A 3HOVK 2YU9C 1Y1WC 2O5JA 2VUMC 4KMUA 2CW0A 4G7HA 3S16K 2A6HA 4JK1A 5IYDC 3GTMC 2PA8L 3PO3K 2JA6K 5M5XK 4Q4ZA 3GTKC 4YFKA 2R92C 5C4XC 4XSZA 1SMYA 1WCMC
chains in the Genus database with same CATH superfamily
2NVTC 2O5IA 2R93C 3S15C 2GAGC 3AD8C 4BKWA 2RGRA 5IP9C 4AYBL 1I3QK 1TWCK 3GTJA 1TWGA 1R9TK 3G4AA 5IP7C 5JFEA 4Y7NK 4WJ3M 5HL8A 3K7AC 4A3BC 1YCLA 2JA5C 1WQFA 3FOFA 4A3DC 2E2IK 4C3HC 1XPPA 3PO2C 4KM8A 3GIRA 4A3JC 3TFJA 4A3EK 5FJ8K 2ZUFA 2NVQC 2GSUA 1F7UA 1JOEA 4ZH4A 1O2AA 5IYCK 2XCOA 3FOEA 3TFHA 1RU0A 2WAQL 1BGWA 3SZYA 4LJZA 4GT9A 4C2MC 5TMCA 4A3CK 2PHCB 4GTCA 3JSTA 4BBRC 3GTGC 4FM9A 1WSVA 3HOVC 1G51A 2FQTA 2GSNA 3GTLK 5FLMK 2JA6C 4KARA 3AH5A 1SFOK 3HXAA 3TFIA 4Y52C 5IORA 3HOXC 5CHPA 4MEXA 4OIQA 4FZBA 3RZDC 4WILA 3S1NC 5M3MK 2NVXA 2JA7C 3H3VL 4A3LC 1O26A 3RZOK 1Y1WA 3HOUC 4OIRA 3HOWK 2Y0SL 3S0XA 3L4KA 2PMZL 1ZVUA 1J6VA 2V6SA 4BLBA 5C4JC 1VGXA 1O2FB 4BY7C 5IYBK 4X6AK 4WJ4A 1Y1VC 1K83A 3T00A 4G7HA 2JA5A 3PO3K 1XZQB 5C4XC 1INNA 4LLGA 1WSRA 3M3YC 1F7VA 4KMHA 5IOTA 4GTDA 3GTPC 1GE9A 4A3FC 1TWAC 2EBBA 1HI9A 5IYDK 3GTKK 3GTOK 2R92K 1HQMA 1ZXOA 2NVTK 1IE0A 1O2BA 2GSOA 2CFAB 2R93K 3S15K 4LK0A 1TWFC 4GTFA 4A3GC 1VJEA 2E2JC 2NVYK 3I4MC 1ISEA 2PA8D 1IQ0A 4C3JC 3CQZC 1XZPB 3GDZA 3K7AK 4OIOA 4A3BK 4OINA 3HOYC 3S14C 4C3HK 2WB1L 3LAJA 3PO2K 4LR2A 1KQ4A 4KAWX 2JA6A 1I50C 4A3JK 1DCPA 3HKZL 4AYBD 1K83C 3GTMK 3QX3A 2A69A 1WCMK 3LPXA 3FKIK 2JA8C 2YU9A 3S1RC 2VUMA 4YFXA 2JA7A 1DCOA 1XXCA 1ZYRA 2RH6A 1VH2A 4GFQA 4O2DA 4P9SA 3CAGA 4BBRK 3H0GK 3GTGK 3S2DC 4ILDA 3GTQK 3I4NK 2WAQD 1I3QC 1TWCC 4XLNA 2JH3A 1R9TC 3S1MC 4Y7NC 3HOZK 3S1QK 1TWHA 1Y1VA 3Q3QA 2E2IC 3GTJK 2B63A 1TWGK 4Y52K 1L0WA 3S1NK 4LOWA 5E68A 4GTBA 3WODA 4BBSC 4BXXC 3MMLB 1O28A 5IYCC 3GTPA 1IS1A 5D4DA 2R7ZA 3N0CA 1TWAA 4QJVB 5CJ9A 5TJ3A 4A3KK 2YU9C 1O29A 2VUMC 4JK1A 4M1XA 2D6FC 3G4CA 2P5MA 4YFKA 1BS2A 1DD5A 4XSZA 3ERED 3H3VD 1TWFA 4XSXA 1EK8A 4BY7K 3N0BA 2Y0SD 3AD9C 3S2HK 2PMZD 3CQZA 5M5WK 4XCHA 4A3IC 2CFAA 5C3EC 4BY1C 3NUHA 1AB4A 1I50A 5EGEA 1TWHC 5C44C 2B63C 3S17K 1ZBSA 3GEHA 1XZPA 2E2HA 2A68A 4KDDA 4A3FK 1USOA 3N3YA 2PPBA 1I6HC 4A3MK 3VA7A 3FHZA 2A6EA 3LAPA 2NVXK 4G0VA 1PJ5A 4NOIA 4P5AA 1O27A 1WQGA 4OIPA 2R7ZC 4QIWL 3A8IA 1Y1WK 4KM9A 3OREA 3AD7C 1B4AA 1EH1A 1IW7A 4QIWD 4A3GK 2E2JK 1YX2A 3TTGA 4C3JK 3BP3A 1I3QA 1TWCA 5IYBC 4A93C 4X6AC 3M4OC 5L46A 1R9TA 3HOYK 4PAAA 3EQLA 5IP9K 3T01A 1BDFA 3L4JA 1USMA 1O25A 2E2IA 5IP7K 4C3IC 1K83K 2JA5K 4GZYA 4A3DK 1F93A 3SZZA 2KWAA 1IL2A 1VLOA 1ZQ1C 2WB1D 3S1RK 3HKZD 1F9NA 2NVQK 2E2HC 4BLAA 4KN7A 3GTOC 4P5BA 3V4GA 2XCQA 2ZUEA 3S2DK 3S16C 4KMAA 5M5YK 4KMDA 4XLPA 4C2MK 2NVYC 4QJVA 2BE5A 3S1MK 4KB2A 1C0AA 1PJ7A 1EQRA 3GTLA 3HOVK 1XXAA 2O5JA 2A6HA 3GTMC 1WOPA 1SFOA 2JA6K 5M5XK 2Y3PA 1SMYA 1WCMC 4G0WA 3FKIC 4BBSK 1DCHA 4A3EC 4BXXK 4PABA 4C45A 3HOXK 4GTEA 4G7ZA 2YU9K 3RZDK 3OPFA 2VUMK 1YNJA 3T02A 1WIHA 5JVOA 2JA7K 4A3LK 5M3FK 3H0GC 1I6VA 3HOUK 1YNNA 1XZQA 3GTQC 3I4NC 1PJ6A 1IBAA 4MEYA 4A3CC 1XXBA 5EGHA 1WQHA 3HOZC 5C4JK 4A3IK 3S1QC 2V6UA 4KN4A 4LQYA 3GTJC 1TWGC 3IPJA 5C3EK 4BY1K 2V6TA 1TWHK 1Y1VK 5C44K 4MQ9A 2B63K 3GTLC 3BUEA 1B4BA 5FLMC 4GTAA 3BP8C 1V5VA 1X31C 3OEPA 4KATA 5TMFA 5C4XK 1SFOC 4AH6A 4GTLA 1EI6A 1EFWA 1WOOA 3M3YK 3GSIA 1I6HK 4A3KC 4G0UA 4DDQA 3AQOA 3GEEA 3GTPK 2R7ZK 3GTKA 1J6WA 1TWAK 3GTOA 4Q5SA 3ADAC 2W7VA 4YG2A 2R92A 4G7OA 3GEIA 3RZOC 4KB4A 1O24A 3HOWC 2R93A 3DXJA 2XCRB 2NVYA 4A93K 3M4OK 3S2HC 1TWFK 2P8TA 3AQPA 3A8JA 3I4MK 5IOSA 3CQZK 4C3IK 5IOQA 1WORA 3S14K 3S17C 3GTMA 1I50K 4RMFA 4YFNA 3PO3C 1J98A 4J3NA 1WCMA 3FKIA 2FQOA 2E2HK 2GAHC 4A3MC 2JA8K 2NVXC 1JQWA 1WOSA 1J6XA 4LK1A 1BJTA 1VRQC 3A8KA 1Y1WC 4KASA 3S16K 4KMUA 2CW0A 1JVIA 1UV7A 5IYDC 2PA8L 3H0GA 3GTGA 4Q4ZA 3GTKC 4KC6A 2R92C 3GTQA 2ZFZA
chains in the Genus database with same CATH topology
4LLGA 3FKIC 3H3VD 2NVTC 3M3YC 4XSXA 2O5IA 4BXXK 4A3EC 4BBSK 4BY7K 2R93C 3S15C 2Y0SD 3HOXK 3S2HK 5IP9C 4G7ZA 4AYBL 1I3QK 1TWCK 2PMZD 3GTPC 2YU9K 5M5WK 4A3FC 1TWAC 3RZDK 1R9TK 4A3IC 2VUMK 5IP7C 4Y7NK 1YNJA 5IYDK 3K7AC 4A3BC 5C3EC 4BY1C 2JA7K 2JA5C 3GTKK 3GTOK 2R92K 4A3LK 5M3FK 2E2IK 4A3DC 1HQMA 3H0GC 1I6VA 1TWHC 1XPPA 1YNNA 5C44C 3HOUK 3PO2C 2B63C 4A3JC 3GTQC 3S17K 3I4NC 2NVTK 4A3EK 2R93K 3S15K 4LK0A 5FJ8K 4MEYA 1TWFC 4A3CC 4A3GC 2E2JC 2NVYK 2A68A 2NVQC 3I4MC 4A3FK 2PA8D 3HOZC 5C4JK 4A3IK 3S1QC 3CQZC 3K7AK 4KN4A 4ZH4A 4OIOA 1TWGC 5IYCK 5C3EK 3GTJC 4A3MK 2PPBA 4BY1K 4OINA 3HOYC 2A6EA 4C3HK 2NVXK 3S14C 4NOIA 2WB1L 1TWHK 1Y1VK 2WAQL 4MQ9A 4OIPA 5C44K 2R7ZC 3PO2K 1I50C 4QIWL 4A3JK 2B63K 3HKZL 1Y1WK 3GTLC 5FLMC 4LJZA 4AYBD 1K83C 5TMCA 4QIWD 1IW7A 3GTMK 4A3CK 4A3GK 2E2JK 2A69A 5TMFA 4BBRC 5C4XK 3GTGC 1SFOC 4C3JK 1WCMK 3FKIK 5IYBC 2JA8C 4A93C 4X6AC 3M3YK 3M4OC 3S1RC 1I6HK 3HOYK 4A3KC 3HOVC 3EQLA 4YFXA 5IP9K 1BDFA 3GTPK 2R7ZK 1TWAK 3GTLK 4Q5SA 4YG2A 5FLMK 5IP7K 2JA6C 4G7OA 1ZYRA 1K83K 3RZOC 1I6HC 2JA5K 3HOWC 4GZYA 4A3DK 4BBRK 3H0GK 3DXJA 1SFOK 3GTGK 3S2DC 4Y52C 3GTQK 3I4NK 4A93K 3HOXC 3M4OK 3S2HC 2WB1D 3S1RK 4MEXA 4OIQA 2WAQD 1I3QC 1TWCC 1TWFK 4XLNA 3HKZD 3RZDC 3S1NC 2NVQK 1R9TC 5M3MK 3I4MK 4Y7NC 3S1MC 2E2HC 3HOZK 3S1QK 2JA7C 3CQZK 4KN7A 4C3IK 3GTOC 3H3VL 2E2IC 3GTJK 3RZOK 4A3LC 1TWGK 3HOUC 4OIRA 3HOWK 3S14K 2Y0SL 3S17C 3S2DK 3S16C 2PMZL 4Y52K 1I50K 5M5YK 4YFNA 4XLPA 4C2MK 2NVYC 3PO3C 3S1NK 4QJVA 4A3BK 5C4JC 2BE5A 3S1MK 2E2HK 3WODA 4BBSC 4BXXC 4BY7C 5IYCC 5IYBK 4A3MC 2JA8K 4X6AK 5D4DA 2NVXC 4QJVB 1Y1VC 4A3KK 4LK1A 3HOVK 2YU9C 1Y1WC 2O5JA 2VUMC 4KMUA 2CW0A 4G7HA 3S16K 2A6HA 4JK1A 5IYDC 3GTMC 2PA8L 3PO3K 2JA6K 5M5XK 4Q4ZA 3GTKC 4YFKA 2R92C 5C4XC 4XSZA 1SMYA 1WCMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLG A;  3FKI C;  3H3V D;  2NVT C;  3M3Y C;  4XSX A;  2O5I A;  4BXX K;  4A3E C;  4BBS K;  4BY7 K;  2R93 C;  3S15 C;  2Y0S D;  3HOX K;  3S2H K;  5IP9 C;  4G7Z A;  4AYB L;  1I3Q K;  1TWC K;  2PMZ D;  3GTP C;  2YU9 K;  5M5W K;  4A3F C;  1TWA C;  3RZD K;  1R9T K;  4A3I C;  2VUM K;  5IP7 C;  4Y7N K;  1YNJ A;  5IYD K;  3K7A C;  4A3B C;  5C3E C;  4BY1 C;  2JA7 K;  2JA5 C;  3GTK K;  3GTO K;  2R92 K;  4A3L K;  5M3F K;  2E2I K;  4A3D C;  1HQM A;  3H0G C;  1I6V A;  1TWH C;  1XPP A;  1YNN A;  5C44 C;  3HOU K;  3PO2 C;  2B63 C;  4A3J C;  3GTQ C;  3S17 K;  3I4N C;  2NVT K;  4A3E K;  2R93 K;  3S15 K;  4LK0 A;  5FJ8 K;  4MEY A;  1TWF C;  4A3C C;  4A3G C;  2E2J C;  2NVY K;  2A68 A;  2NVQ C;  3I4M C;  4A3F K;  2PA8 D;  3HOZ C;  5C4J K;  4A3I K;  3S1Q C;  3CQZ C;  3K7A K;  4KN4 A;  4ZH4 A;  4OIO A;  1TWG C;  5IYC K;  5C3E K;  3GTJ C;  4A3M K;  2PPB A;  4BY1 K;  4OIN A;  3HOY C;  2A6E A;  4C3H K;  2NVX K;  3S14 C;  4NOI A;  2WB1 L;  1TWH K;  1Y1V K;  2WAQ L;  4MQ9 A;  4OIP A;  5C44 K;  2R7Z C;  3PO2 K;  1I50 C;  4QIW L;  4A3J K;  2B63 K;  3HKZ L;  1Y1W K;  3GTL C;  5FLM C;  4LJZ A;  4AYB D;  1K83 C;  5TMC A;  4QIW D;  1IW7 A;  3GTM K;  4A3C K;  4A3G K;  2E2J K;  2A69 A;  5TMF A;  4BBR C;  5C4X K;  3GTG C;  1SFO C;  4C3J K;  1WCM K;  3FKI K;  5IYB C;  2JA8 C;  4A93 C;  4X6A C;  3M3Y K;  3M4O C;  3S1R C;  1I6H K;  3HOY K;  4A3K C;  3HOV C;  3EQL A;  4YFX A;  5IP9 K;  1BDF A;  3GTP K;  2R7Z K;  1TWA K;  3GTL K;  4Q5S A;  4YG2 A;  5FLM K;  5IP7 K;  2JA6 C;  4G7O A;  1ZYR A;  1K83 K;  3RZO C;  1I6H C;  2JA5 K;  3HOW C;  4GZY A;  4A3D K;  4BBR K;  3H0G K;  3DXJ A;  1SFO K;  3GTG K;  3S2D C;  4Y52 C;  3GTQ K;  3I4N K;  4A93 K;  3HOX C;  3M4O K;  3S2H C;  2WB1 D;  3S1R K;  4MEX A;  4OIQ A;  2WAQ D;  1I3Q C;  1TWC C;  1TWF K;  4XLN A;  3HKZ D;  3RZD C;  3S1N C;  2NVQ K;  1R9T C;  5M3M K;  3I4M K;  4Y7N C;  3S1M C;  2E2H C;  3HOZ K;  3S1Q K;  2JA7 C;  3CQZ K;  4KN7 A;  4C3I K;  3GTO C;  3H3V L;  2E2I C;  3GTJ K;  3RZO K;  4A3L C;  1TWG K;  3HOU C;  4OIR A;  3HOW K;  3S14 K;  2Y0S L;  3S17 C;  3S2D K;  3S16 C;  2PMZ L;  4Y52 K;  1I50 K;  5M5Y K;  4YFN A;  4XLP A;  4C2M K;  2NVY C;  3PO3 C;  3S1N K;  4QJV A;  4A3B K;  5C4J C;  2BE5 A;  3S1M K;  2E2H K;  3WOD A;  4BBS C;  4BXX C;  4BY7 C;  5IYC C;  5IYB K;  4A3M C;  2JA8 K;  4X6A K;  5D4D A;  2NVX C;  4QJV B;  1Y1V C;  4A3K K;  4LK1 A;  3HOV K;  2YU9 C;  1Y1W C;  2O5J A;  2VUM C;  4KMU A;  2CW0 A;  4G7H A;  3S16 K;  2A6H A;  4JK1 A;  5IYD C;  3GTM C;  2PA8 L;  3PO3 K;  2JA6 K;  5M5X K;  4Q4Z A;  3GTK C;  4YFK A;  2R92 C;  5C4X C;  4XSZ A;  1SMY A;  1WCM C; 
#chains in the Genus database with same CATH topology
 2NVT C;  2O5I A;  2R93 C;  3S15 C;  2GAG C;  3AD8 C;  4BKW A;  2RGR A;  5IP9 C;  4AYB L;  1I3Q K;  1TWC K;  3GTJ A;  1TWG A;  1R9T K;  3G4A A;  5IP7 C;  5JFE A;  4Y7N K;  4WJ3 M;  5HL8 A;  3K7A C;  4A3B C;  1YCL A;  2JA5 C;  1WQF A;  3FOF A;  4A3D C;  2E2I K;  4C3H C;  1XPP A;  3PO2 C;  4KM8 A;  3GIR A;  4A3J C;  3TFJ A;  4A3E K;  5FJ8 K;  2ZUF A;  2NVQ C;  2GSU A;  1F7U A;  1JOE A;  4ZH4 A;  1O2A A;  5IYC K;  2XCO A;  3FOE A;  3TFH A;  1RU0 A;  2WAQ L;  1BGW A;  3SZY A;  4LJZ A;  4GT9 A;  4C2M C;  5TMC A;  4A3C K;  2PHC B;  4GTC A;  3JST A;  4BBR C;  3GTG C;  4FM9 A;  1WSV A;  3HOV C;  1G51 A;  2FQT A;  2GSN A;  3GTL K;  5FLM K;  2JA6 C;  4KAR A;  3AH5 A;  1SFO K;  3HXA A;  3TFI A;  4Y52 C;  5IOR A;  3HOX C;  5CHP A;  4MEX A;  4OIQ A;  4FZB A;  3RZD C;  4WIL A;  3S1N C;  5M3M K;  2NVX A;  2JA7 C;  3H3V L;  4A3L C;  1O26 A;  3RZO K;  1Y1W A;  3HOU C;  4OIR A;  3HOW K;  2Y0S L;  3S0X A;  3L4K A;  2PMZ L;  1ZVU A;  1J6V A;  2V6S A;  4BLB A;  5C4J C;  1VGX A;  1O2F B;  4BY7 C;  5IYB K;  4X6A K;  4WJ4 A;  1Y1V C;  1K83 A;  3T00 A;  4G7H A;  2JA5 A;  3PO3 K;  1XZQ B;  5C4X C;  1INN A;  4LLG A;  1WSR A;  3M3Y C;  1F7V A;  4KMH A;  5IOT A;  4GTD A;  3GTP C;  1GE9 A;  4A3F C;  1TWA C;  2EBB A;  1HI9 A;  5IYD K;  3GTK K;  3GTO K;  2R92 K;  1HQM A;  1ZXO A;  2NVT K;  1IE0 A;  1O2B A;  2GSO A;  2CFA B;  2R93 K;  3S15 K;  4LK0 A;  1TWF C;  4GTF A;  4A3G C;  1VJE A;  2E2J C;  2NVY K;  3I4M C;  1ISE A;  2PA8 D;  1IQ0 A;  4C3J C;  3CQZ C;  1XZP B;  3GDZ A;  3K7A K;  4OIO A;  4A3B K;  4OIN A;  3HOY C;  3S14 C;  4C3H K;  2WB1 L;  3LAJ A;  3PO2 K;  4LR2 A;  1KQ4 A;  4KAW X;  2JA6 A;  1I50 C;  4A3J K;  1DCP A;  3HKZ L;  4AYB D;  1K83 C;  3GTM K;  3QX3 A;  2A69 A;  1WCM K;  3LPX A;  3FKI K;  2JA8 C;  2YU9 A;  3S1R C;  2VUM A;  4YFX A;  2JA7 A;  1DCO A;  1XXC A;  1ZYR A;  2RH6 A;  1VH2 A;  4GFQ A;  4O2D A;  4P9S A;  3CAG A;  4BBR K;  3H0G K;  3GTG K;  3S2D C;  4ILD A;  3GTQ K;  3I4N K;  2WAQ D;  1I3Q C;  1TWC C;  4XLN A;  2JH3 A;  1R9T C;  3S1M C;  4Y7N C;  3HOZ K;  3S1Q K;  1TWH A;  1Y1V A;  3Q3Q A;  2E2I C;  3GTJ K;  2B63 A;  1TWG K;  4Y52 K;  1L0W A;  3S1N K;  4LOW A;  5E68 A;  4GTB A;  3WOD A;  4BBS C;  4BXX C;  3MML B;  1O28 A;  5IYC C;  3GTP A;  1IS1 A;  5D4D A;  2R7Z A;  3N0C A;  1TWA A;  4QJV B;  5CJ9 A;  5TJ3 A;  4A3K K;  2YU9 C;  1O29 A;  2VUM C;  4JK1 A;  4M1X A;  2D6F C;  3G4C A;  2P5M A;  4YFK A;  1BS2 A;  1DD5 A;  4XSZ A;  3ERE D;  3H3V D;  1TWF A;  4XSX A;  1EK8 A;  4BY7 K;  3N0B A;  2Y0S D;  3AD9 C;  3S2H K;  2PMZ D;  3CQZ A;  5M5W K;  4XCH A;  4A3I C;  2CFA A;  5C3E C;  4BY1 C;  3NUH A;  1AB4 A;  1I50 A;  5EGE A;  1TWH C;  5C44 C;  2B63 C;  3S17 K;  1ZBS A;  3GEH A;  1XZP A;  2E2H A;  2A68 A;  4KDD A;  4A3F K;  1USO A;  3N3Y A;  2PPB A;  1I6H C;  4A3M K;  3VA7 A;  3FHZ A;  2A6E A;  3LAP A;  2NVX K;  4G0V A;  1PJ5 A;  4NOI A;  4P5A A;  1O27 A;  1WQG A;  4OIP A;  2R7Z C;  4QIW L;  3A8I A;  1Y1W K;  4KM9 A;  3ORE A;  3AD7 C;  1B4A A;  1EH1 A;  1IW7 A;  4QIW D;  4A3G K;  2E2J K;  1YX2 A;  3TTG A;  4C3J K;  3BP3 A;  1I3Q A;  1TWC A;  5IYB C;  4A93 C;  4X6A C;  3M4O C;  5L46 A;  1R9T A;  3HOY K;  4PAA A;  3EQL A;  5IP9 K;  3T01 A;  1BDF A;  3L4J A;  1USM A;  1O25 A;  2E2I A;  5IP7 K;  4C3I C;  1K83 K;  2JA5 K;  4GZY A;  4A3D K;  1F93 A;  3SZZ A;  2KWA A;  1IL2 A;  1VLO A;  1ZQ1 C;  2WB1 D;  3S1R K;  3HKZ D;  1F9N A;  2NVQ K;  2E2H C;  4BLA A;  4KN7 A;  3GTO C;  4P5B A;  3V4G A;  2XCQ A;  2ZUE A;  3S2D K;  3S16 C;  4KMA A;  5M5Y K;  4KMD A;  4XLP A;  4C2M K;  2NVY C;  4QJV A;  2BE5 A;  3S1M K;  4KB2 A;  1C0A A;  1PJ7 A;  1EQR A;  3GTL A;  3HOV K;  1XXA A;  2O5J A;  2A6H A;  3GTM C;  1WOP A;  1SFO A;  2JA6 K;  5M5X K;  2Y3P A;  1SMY A;  1WCM C;  4G0W A;  3FKI C;  4BBS K;  1DCH A;  4A3E C;  4BXX K;  4PAB A;  4C45 A;  3HOX K;  4GTE A;  4G7Z A;  2YU9 K;  3RZD K;  3OPF A;  2VUM K;  1YNJ A;  3T02 A;  1WIH A;  5JVO A;  2JA7 K;  4A3L K;  5M3F K;  3H0G C;  1I6V A;  3HOU K;  1YNN A;  1XZQ A;  3GTQ C;  3I4N C;  1PJ6 A;  1IBA A;  4MEY A;  4A3C C;  1XXB A;  5EGH A;  1WQH A;  3HOZ C;  5C4J K;  4A3I K;  3S1Q C;  2V6U A;  4KN4 A;  4LQY A;  3GTJ C;  1TWG C;  3IPJ A;  5C3E K;  4BY1 K;  2V6T A;  1TWH K;  1Y1V K;  5C44 K;  4MQ9 A;  2B63 K;  3GTL C;  3BUE A;  1B4B A;  5FLM C;  4GTA A;  3BP8 C;  1V5V A;  1X31 C;  3OEP A;  4KAT A;  5TMF A;  5C4X K;  1SFO C;  4AH6 A;  4GTL A;  1EI6 A;  1EFW A;  1WOO A;  3M3Y K;  3GSI A;  1I6H K;  4A3K C;  4G0U A;  4DDQ A;  3AQO A;  3GEE A;  3GTP K;  2R7Z K;  3GTK A;  1J6W A;  1TWA K;  3GTO A;  4Q5S A;  3ADA C;  2W7V A;  4YG2 A;  2R92 A;  4G7O A;  3GEI A;  3RZO C;  4KB4 A;  1O24 A;  3HOW C;  2R93 A;  3DXJ A;  2XCR B;  2NVY A;  4A93 K;  3M4O K;  3S2H C;  1TWF K;  2P8T A;  3AQP A;  3A8J A;  3I4M K;  5IOS A;  3CQZ K;  4C3I K;  5IOQ A;  1WOR A;  3S14 K;  3S17 C;  3GTM A;  1I50 K;  4RMF A;  4YFN A;  3PO3 C;  1J98 A;  4J3N A;  1WCM A;  3FKI A;  2FQO A;  2E2H K;  2GAH C;  4A3M C;  2JA8 K;  2NVX C;  1JQW A;  1WOS A;  1J6X A;  4LK1 A;  1BJT A;  1VRQ C;  3A8K A;  1Y1W C;  4KAS A;  3S16 K;  4KMU A;  2CW0 A;  1JVI A;  1UV7 A;  5IYD C;  2PA8 L;  3H0G A;  3GTG A;  4Q4Z A;  3GTK C;  4KC6 A;  2R92 C;  3GTQ A;  2ZFZ A; 
#chains in the Genus database with same CATH homology
 4LLG A;  3FKI C;  3H3V D;  2NVT C;  3M3Y C;  4XSX A;  2O5I A;  4BXX K;  4A3E C;  4BBS K;  4BY7 K;  2R93 C;  3S15 C;  2Y0S D;  3HOX K;  3S2H K;  5IP9 C;  4G7Z A;  4AYB L;  1I3Q K;  1TWC K;  2PMZ D;  3GTP C;  2YU9 K;  5M5W K;  4A3F C;  1TWA C;  3RZD K;  1R9T K;  4A3I C;  2VUM K;  5IP7 C;  4Y7N K;  1YNJ A;  5IYD K;  3K7A C;  4A3B C;  5C3E C;  4BY1 C;  2JA7 K;  2JA5 C;  3GTK K;  3GTO K;  2R92 K;  4A3L K;  5M3F K;  2E2I K;  4A3D C;  1HQM A;  3H0G C;  1I6V A;  1TWH C;  1XPP A;  1YNN A;  5C44 C;  3HOU K;  3PO2 C;  2B63 C;  4A3J C;  3GTQ C;  3S17 K;  3I4N C;  2NVT K;  4A3E K;  2R93 K;  3S15 K;  4LK0 A;  5FJ8 K;  4MEY A;  1TWF C;  4A3C C;  4A3G C;  2E2J C;  2NVY K;  2A68 A;  2NVQ C;  3I4M C;  4A3F K;  2PA8 D;  3HOZ C;  5C4J K;  4A3I K;  3S1Q C;  3CQZ C;  3K7A K;  4KN4 A;  4ZH4 A;  4OIO A;  1TWG C;  5IYC K;  5C3E K;  3GTJ C;  4A3M K;  2PPB A;  4BY1 K;  4OIN A;  3HOY C;  2A6E A;  4C3H K;  2NVX K;  3S14 C;  4NOI A;  2WB1 L;  1TWH K;  1Y1V K;  2WAQ L;  4MQ9 A;  4OIP A;  5C44 K;  2R7Z C;  3PO2 K;  1I50 C;  4QIW L;  4A3J K;  2B63 K;  3HKZ L;  1Y1W K;  3GTL C;  5FLM C;  4LJZ A;  4AYB D;  1K83 C;  5TMC A;  4QIW D;  1IW7 A;  3GTM K;  4A3C K;  4A3G K;  2E2J K;  2A69 A;  5TMF A;  4BBR C;  5C4X K;  3GTG C;  1SFO C;  4C3J K;  1WCM K;  3FKI K;  5IYB C;  2JA8 C;  4A93 C;  4X6A C;  3M3Y K;  3M4O C;  3S1R C;  1I6H K;  3HOY K;  4A3K C;  3HOV C;  3EQL A;  4YFX A;  5IP9 K;  1BDF A;  3GTP K;  2R7Z K;  1TWA K;  3GTL K;  4Q5S A;  4YG2 A;  5FLM K;  5IP7 K;  2JA6 C;  4G7O A;  1ZYR A;  1K83 K;  3RZO C;  1I6H C;  2JA5 K;  3HOW C;  4GZY A;  4A3D K;  4BBR K;  3H0G K;  3DXJ A;  1SFO K;  3GTG K;  3S2D C;  4Y52 C;  3GTQ K;  3I4N K;  4A93 K;  3HOX C;  3M4O K;  3S2H C;  2WB1 D;  3S1R K;  4MEX A;  4OIQ A;  2WAQ D;  1I3Q C;  1TWC C;  1TWF K;  4XLN A;  3HKZ D;  3RZD C;  3S1N C;  2NVQ K;  1R9T C;  5M3M K;  3I4M K;  4Y7N C;  3S1M C;  2E2H C;  3HOZ K;  3S1Q K;  2JA7 C;  3CQZ K;  4KN7 A;  4C3I K;  3GTO C;  3H3V L;  2E2I C;  3GTJ K;  3RZO K;  4A3L C;  1TWG K;  3HOU C;  4OIR A;  3HOW K;  3S14 K;  2Y0S L;  3S17 C;  3S2D K;  3S16 C;  2PMZ L;  4Y52 K;  1I50 K;  5M5Y K;  4YFN A;  4XLP A;  4C2M K;  2NVY C;  3PO3 C;  3S1N K;  4QJV A;  4A3B K;  5C4J C;  2BE5 A;  3S1M K;  2E2H K;  3WOD A;  4BBS C;  4BXX C;  4BY7 C;  5IYC C;  5IYB K;  4A3M C;  2JA8 K;  4X6A K;  5D4D A;  2NVX C;  4QJV B;  1Y1V C;  4A3K K;  4LK1 A;  3HOV K;  2YU9 C;  1Y1W C;  2O5J A;  2VUM C;  4KMU A;  2CW0 A;  4G7H A;  3S16 K;  2A6H A;  4JK1 A;  5IYD C;  3GTM C;  2PA8 L;  3PO3 K;  2JA6 K;  5M5X K;  4Q4Z A;  3GTK C;  4YFK A;  2R92 C;  5C4X C;  4XSZ A;  1SMY A;  1WCM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...