3HOWK

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3howK00
1I3QC 4JK1A 4A3JK 3S16K 3M4OC 3S1QK 3RZDC 1YNJA 3S1RK 4NOIA 5FLMK 2YU9C 1WCMC 4BY7C 2A6HA 3GTLK 1TWAC 3S14C 5IYBK 2E2IK 2NVTK 1IW7A 1I50C 4QIWL 3S2HC 1TWHK 3CQZK 5C4XK 3S2DC 3GTQC 2NVXK 3M3YK 4XSZA 3I4MK 4C3JK 2E2HC 3DXJA 3HKZL 4ZH4A 4C3HK 4A3KK 5C44K 5IYCK 4A3FK 4YG2A 3GTOC 5IP7K 4YFNA 4BY1K 2R7ZK 2YU9K 2CW0A 2PA8L 4MQ9A 3HOUC 4A3BK 1WCMK 4KN4A 3GTGK 3WODA 4BBSC 3S1MK 4KN7A 4A93C 1I50K 3GTKC 4X6AK 3HOXC 3S17C 3PO3K 4Y7NC 2B63K 3GTQK 2PPBA 2E2HK 3H3VL 3HOWK 4OIOA 2NVYC 4BBRK 2JA6C 4QIWD 2WB1L 3GTOK 2JA5K 2A69A 5M3FK 4A3GK 2Y0SL 1TWFK 2JA7C 4A3DC 4MEYA 5C3EK 5IP9K 1SFOK 4A3CC 3S15K 3GTKK 2JA8K 1Y1WK 2PA8D 4Y7NK 3PO2C 4BXXC 2WAQL 1K83K 3HOVK 4Q5SA 2E2JC 1TWGC 5M5XK 3I4NC 2R93C 2VUMK 1I3QK 2PMZL 3M4OK 5M3MK 4A3IC 3RZOC 3RZDK 4Y52C 3S1NC 2JA7K 4A3EC 3GTJC 3HOYC 4A3CK 1TWAK 4BY7K 3H0GC 2O5IA 3S14K 4OINA 4C2MK 3HOZC 3FKIC 3S2HK 1I6VA 4OIQA 5M5WK 4XLPA 3S2DK 4A3LC 4A3LK 2E2JK 2O5JA 4XLNA 4LK0A 5C4JC 3K7AC 4QJVA 1I6HC 1HQMA 2WAQD 4Y52K 5IYDC 1R9TC 3HOUK 1TWCC 3HKZD 3GTJK 3GTPC 2NVQC 3H0GK 4C3IK 4BBSK 3GTMC 4A93K 4Q4ZA 3HOZK 3HOXK 3S17K 5FJ8K 4G7HA 4AYBL 4A3JC 3S16C 2NVYK 3S1RC 2JA6K 5FLMC 4OIPA 1Y1VC 4LJZA 2R92C 4YFXA 1I6HK 5IYBC 4A3MC 3H3VD 1TWHC 4A3DK 2NVQK 1ZYRA 2WB1D 3GTMK 2NVXC 3M3YC 1XPPA 4A3KC 4GZYA 5TMFA 3PO2K 2Y0SD 5IYCC 4A3FC 4BXXK 4LLGA 5IP7C 4BY1C 2R7ZC 2A68A 1TWGK 2R93K 3I4NK 4KMUA 4A3BC 1Y1VK 2R92K 3GTGC 4A3IK 3RZOK 4AYBD 3S1MC 4A3MK 5M5YK 4X6AC 1BDFA 3S1NK 1SMYA 5TMCA 4A3EK 3PO3C 3HOYK 2B63C 4XSXA 2PMZD 3HOWC 3FKIK 4BBRC 5D4DA 2A6EA 1YNNA 2JA5C 3S1QC 4A3GC 1TWFC 5C4JK 3K7AK 5C3EC 4G7ZA 5IP9C 1SFOC 3GTLC 4OIRA 4MEXA 2E2IC 4QJVB 2NVTC 3S15C 1R9TK 5IYDK 2JA8C 3EQLA 1TWCK 3CQZC 1Y1WC 4YFKA 3GTPK 5C4XC 2BE5A 1K83C 4LK1A 3HOVC 4G7OA 3I4MC 2VUMC 5C44C
chains in the Genus database with same CATH superfamily
4A3JK 3RZDC 4KASA 1YNJA 1TWHA 2A6HA 1O24A 3S14C 2E2IK 3JSTA 3S2HC 4A3LC 3M3YK 2Y3PA 3N0BA 1O26A 4C3HK 5C44K 4A3FK 2R7ZK 4BY1K 4J3NA 1F7VA 3N3YA 3WODA 3GTKC 4GTFA 5IOQA 3PO3K 1ZBSA 2P5MA 2NVYC 4BBRK 4GTAA 4QIWD 2WB1L 1SFOA 4P5AA 1Y1WA 3CQZA 4A3DC 5C3EK 4A3CC 3BP8C 3S15K 3GTKK 3SZZA 2PA8D 4RMFA 2WAQL 3HOVK 3AH5A 2YU9A 4GTLA 3M4OK 1WSRA 3HOYC 4A3CK 4BY7K 1TWAK 5L46A 4OINA 3FKIC 4OIQA 3SZYA 3BUEA 3T02A 1TWFA 3K7AC 2D6FC 4GTDA 4WILA 5E68A 1IE0A 3GTPC 4C3IK 5CJ9A 4A93K 5FJ8K 3S16C 1WQGA 4KB4A 2JA6K 4OIPA 1XXCA 1Y1VC 2KWAA 1TWHC 3TTGA 1ZYRA 2WB1D 4BLAA 2RGRA 4A3KC 4AH6A 3PO2K 5IYCC 5IP7C 4BLBA 3NUHA 1TWGK 1Y1VK 3GTJA 1EH1A 1F9NA 3GTGC 3H0GA 3RZOK 4AYBD 5M5YK 4X6AC 1BDFA 5TMCA 4A3EK 3TFIA 2NVYA 3OPFA 4A3GC 5IP9C 1SFOC 1R9TK 1Y1WC 1TWCK 3CQZC 4YFKA 5C4XC 2XCOA 2RH6A 3I4MC 2R92A 4JK1A 2PHCB 1YCLA 3S1RK 2YU9C 1IQ0A 5JFEA 4G0WA 5IYBK 1IW7A 4QIWL 3CQZK 4LR2A 1BS2A 5C4XK 1GE9A 2P8TA 3S2DC 2NVXK 1DD5A 4XSZA 4C3JK 3I4MK 3HKZL 3VA7A 1KQ4A 4KDDA 4YG2A 4YFNA 2YU9K 3HOUC 1F93A 2PA8L 4KN4A 5CHPA 2B63A 3S1MK 1BJTA 3HOXC 3S17C 3HOWK 3QX3A 3GTLA 3MMLB 2JA5K 2A69A 5M3FK 3V4GA 1TWFK 3G4AA 1ZXOA 4GTCA 2JA8K 2VUMA 4BXXC 2EBBA 1K83K 1X31C 5M5XK 2PMZL 3GTGA 4WJ3M 5M3MK 4A3IC 3RZDK 4Y52C 1WOSA 5TJ3A 1I50A 3S1NC 2XCQA 3FOFA 3GTJC 3LPXA 3H0GC 2O5IA 3S14K 2E2HA 3S2HK 1I6VA 5M5WK 3GTOA 4A3LK 1G51A 1XZQA 3AD8C 5C4JC 4QJVA 5EGHA 1JQWA 4Y52K 3HKZD 1PJ6A 3GTJK 4XCHA 3H0GK 4BKWA 4Q4ZA 4P9SA 4G7HA 4AYBL 1WIHA 2NVYK 4KC6A 5FLMC 1AB4A 2JA7A 2R92C 4A3MC 4A3DK 1USOA 1VJEA 1ZQ1C 5TMFA 1J98A 3CAGA 4LLGA 2A68A 1C0AA 4A3BC 2R92K 3N0CA 1L0WA 4A3MK 4FZBA 1XZPA 3L4KA 3HOYK 2B63C 4XSXA 4GTEA 4KB2A 2PMZD 3FKIK 5D4DA 2V6UA 1INNA 1ZVUA 1O2BA 2V6TA 3K7AK 3GTLC 3GTMA 1O29A 4QJVB 3A8JA 3EQLA 3GTPK 4KARA 2FQTA 4GFQA 4KMHA 2VUMC 1O28A 1I3QC 3S16K 1B4AA 3OREA 1IBAA 4NOIA 3GTLK 4C2MC 1I50C 1TWHK 4WJ4A 1VRQC 2E2HC 4A3KK 5IYCK 3GTOC 5IP7K 4LOWA 3GTGK 4BBSC 2JH3A 1F7UA 4KN7A 4X6AK 1I50K 1VLOA 2V6SA 2PPBA 1XXBA 3OEPA 2E2HK 4OIOA 3T00A 3GTOK 3T01A 4A3GK 2Y0SL 2JA7C 1JOEA 3L4JA 4MEYA 5EGEA 1O25A 5IP9K 1SFOK 4DDQA 5IOSA 1Y1WK 3GDZA 2CFAA 2E2JC 2R93C 5IOTA 3I4NC 1WCMA 1TWAA 3Q3QA 1IL2A 1WOPA 2JA7K 3GTQA 3BP3A 1WORA 1WQHA 2GSUA 3S0XA 3S2DK 2E2JK 2O5JA 4XLNA 4LK0A 5IYDC 3HOUK 3IPJA 3GTMC 3HOXK 3S17K 3FHZA 1I3QA 4A3JC 4LJZA 3GEEA 1J6XA 3GTMK 1BGWA 3M3YC 1XPPA 1TWGA 4GZYA 4C3HC 2Y0SD 4BXXK 4A3FC 4PAAA 4BY1C 2R7ZC 3FOEA 2CFAB 4GT9A 4KMUA 3AQOA 1EQRA 1HI9A 4A3IK 3S1NK 3PO3C 3TFHA 4BBRC 2ZFZA 1PJ5A 3S1QC 1DCPA 1R9TA 1TWCA 4KAWX 4GTBA 5C4JK 4G0VA 5C3EC 4OIRA 4MEXA 2NVTC 3S15C 4LK1A 1RU0A 2BE5A 3HOVC 1WSVA 4G7OA 2R93A 3AD9C 4C45A 4KM9A 3M4OC 3S1QK 5FLMK 1WCMC 4BY7C 1TWAC 2NVXA 2NVTK 4KM8A 1IS1A 3HXAA 1O2AA 2ZUFA 4P5BA 3GTQC 3DXJA 4ZH4A 2XCRB 1VH2A 4G0UA 1WOOA 2CW0A 4MQ9A 4A3BK 1WCMK 1XZQB 4C3IC 1O2FB 1UV7A 4A93C 1J6WA 5HL8A 4Y7NC 2B63K 3GTQK 2JA5A 3H3VL 5IORA 2JA6C 2E2IA 4KMAA 2GAHC 3G4CA 1K83A 1PJ7A 1EK8A 4Y7NK 3PO2C 2R7ZA 5JVOA 4Q5SA 1TWGC 4LQYA 3ERED 2VUMK 1I3QK 1ISEA 4KMDA 3RZOC 2GAGC 4A3EC 1VGXA 4O2DA 3A8IA 2GSNA 3A8KA 4C2MK 3HOZC 1USMA 4XLPA 1XZPB 1YX2A 4ILDA 1I6HC 1HQMA 2WAQD 3GTKA 1R9TC 1TWCC 2NVQC 1J6VA 3LAPA 4BBSK 1V5VA 1XXAA 3HOZK 1DCHA 3S1RC 3AD7C 2GSOA 3GEHA 4YFXA 1I6HK 5IYBC 3H3VD 2W7VA 4PABA 2NVQK 4KATA 2NVXC 4C3JC 2R93K 3I4NK 3LAJA 3GEIA 1JVIA 3TFJA 3S1MC 3GIRA 3FKIA 1SMYA 1DCOA 1B4BA 1EI6A 3HOWC 2ZUEA 2JA6A 1EFWA 2A6EA 4FM9A 1YNNA 2JA5C 4M1XA 1TWFC 3GTPA 4G7ZA 3ADAC 2E2IC 3AQPA 5IYDK 2JA8C 2FQOA 3GSIA 1O27A 1K83C 1WQFA 1Y1VA 5C44C
chains in the Genus database with same CATH topology
1I3QC 4JK1A 4A3JK 3S16K 3M4OC 3S1QK 3RZDC 1YNJA 3S1RK 4NOIA 5FLMK 2YU9C 1WCMC 4BY7C 2A6HA 3GTLK 1TWAC 3S14C 5IYBK 2E2IK 2NVTK 1IW7A 1I50C 4QIWL 3S2HC 1TWHK 3CQZK 5C4XK 3S2DC 3GTQC 2NVXK 3M3YK 4XSZA 3I4MK 4C3JK 2E2HC 3DXJA 3HKZL 4ZH4A 4C3HK 4A3KK 5C44K 5IYCK 4A3FK 4YG2A 3GTOC 5IP7K 4YFNA 4BY1K 2R7ZK 2YU9K 2CW0A 2PA8L 4MQ9A 3HOUC 4A3BK 1WCMK 4KN4A 3GTGK 3WODA 4BBSC 3S1MK 4KN7A 4A93C 1I50K 3GTKC 4X6AK 3HOXC 3S17C 3PO3K 4Y7NC 2B63K 3GTQK 2PPBA 2E2HK 3H3VL 3HOWK 4OIOA 2NVYC 4BBRK 2JA6C 4QIWD 2WB1L 3GTOK 2JA5K 2A69A 5M3FK 4A3GK 2Y0SL 1TWFK 2JA7C 4A3DC 4MEYA 5C3EK 5IP9K 1SFOK 4A3CC 3S15K 3GTKK 2JA8K 1Y1WK 2PA8D 4Y7NK 3PO2C 4BXXC 2WAQL 1K83K 3HOVK 4Q5SA 2E2JC 1TWGC 5M5XK 3I4NC 2R93C 2VUMK 1I3QK 2PMZL 3M4OK 5M3MK 4A3IC 3RZOC 3RZDK 4Y52C 3S1NC 2JA7K 4A3EC 3GTJC 3HOYC 4A3CK 1TWAK 4BY7K 3H0GC 2O5IA 3S14K 4OINA 4C2MK 3HOZC 3FKIC 3S2HK 1I6VA 4OIQA 5M5WK 4XLPA 3S2DK 4A3LC 4A3LK 2E2JK 2O5JA 4XLNA 4LK0A 5C4JC 3K7AC 4QJVA 1I6HC 1HQMA 2WAQD 4Y52K 5IYDC 1R9TC 3HOUK 1TWCC 3HKZD 3GTJK 3GTPC 2NVQC 3H0GK 4C3IK 4BBSK 3GTMC 4A93K 4Q4ZA 3HOZK 3HOXK 3S17K 5FJ8K 4G7HA 4AYBL 4A3JC 3S16C 2NVYK 3S1RC 2JA6K 5FLMC 4OIPA 1Y1VC 4LJZA 2R92C 4YFXA 1I6HK 5IYBC 4A3MC 3H3VD 1TWHC 4A3DK 2NVQK 1ZYRA 2WB1D 3GTMK 2NVXC 3M3YC 1XPPA 4A3KC 4GZYA 5TMFA 3PO2K 2Y0SD 5IYCC 4A3FC 4BXXK 4LLGA 5IP7C 4BY1C 2R7ZC 2A68A 1TWGK 2R93K 3I4NK 4KMUA 4A3BC 1Y1VK 2R92K 3GTGC 4A3IK 3RZOK 4AYBD 3S1MC 4A3MK 5M5YK 4X6AC 1BDFA 3S1NK 1SMYA 5TMCA 4A3EK 3PO3C 3HOYK 2B63C 4XSXA 2PMZD 3HOWC 3FKIK 4BBRC 5D4DA 2A6EA 1YNNA 2JA5C 3S1QC 4A3GC 1TWFC 5C4JK 3K7AK 5C3EC 4G7ZA 5IP9C 1SFOC 3GTLC 4OIRA 4MEXA 2E2IC 4QJVB 2NVTC 3S15C 1R9TK 5IYDK 2JA8C 3EQLA 1TWCK 3CQZC 1Y1WC 4YFKA 3GTPK 5C4XC 2BE5A 1K83C 4LK1A 3HOVC 4G7OA 3I4MC 2VUMC 5C44C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q C;  4JK1 A;  4A3J K;  3S16 K;  3M4O C;  3S1Q K;  3RZD C;  1YNJ A;  3S1R K;  4NOI A;  5FLM K;  2YU9 C;  1WCM C;  4BY7 C;  2A6H A;  3GTL K;  1TWA C;  3S14 C;  5IYB K;  2E2I K;  2NVT K;  1IW7 A;  1I50 C;  4QIW L;  3S2H C;  1TWH K;  3CQZ K;  5C4X K;  3S2D C;  3GTQ C;  2NVX K;  3M3Y K;  4XSZ A;  3I4M K;  4C3J K;  2E2H C;  3DXJ A;  3HKZ L;  4ZH4 A;  4C3H K;  4A3K K;  5C44 K;  5IYC K;  4A3F K;  4YG2 A;  3GTO C;  5IP7 K;  4YFN A;  4BY1 K;  2R7Z K;  2YU9 K;  2CW0 A;  2PA8 L;  4MQ9 A;  3HOU C;  4A3B K;  1WCM K;  4KN4 A;  3GTG K;  3WOD A;  4BBS C;  3S1M K;  4KN7 A;  4A93 C;  1I50 K;  3GTK C;  4X6A K;  3HOX C;  3S17 C;  3PO3 K;  4Y7N C;  2B63 K;  3GTQ K;  2PPB A;  2E2H K;  3H3V L;  3HOW K;  4OIO A;  2NVY C;  4BBR K;  2JA6 C;  4QIW D;  2WB1 L;  3GTO K;  2JA5 K;  2A69 A;  5M3F K;  4A3G K;  2Y0S L;  1TWF K;  2JA7 C;  4A3D C;  4MEY A;  5C3E K;  5IP9 K;  1SFO K;  4A3C C;  3S15 K;  3GTK K;  2JA8 K;  1Y1W K;  2PA8 D;  4Y7N K;  3PO2 C;  4BXX C;  2WAQ L;  1K83 K;  3HOV K;  4Q5S A;  2E2J C;  1TWG C;  5M5X K;  3I4N C;  2R93 C;  2VUM K;  1I3Q K;  2PMZ L;  3M4O K;  5M3M K;  4A3I C;  3RZO C;  3RZD K;  4Y52 C;  3S1N C;  2JA7 K;  4A3E C;  3GTJ C;  3HOY C;  4A3C K;  1TWA K;  4BY7 K;  3H0G C;  2O5I A;  3S14 K;  4OIN A;  4C2M K;  3HOZ C;  3FKI C;  3S2H K;  1I6V A;  4OIQ A;  5M5W K;  4XLP A;  3S2D K;  4A3L C;  4A3L K;  2E2J K;  2O5J A;  4XLN A;  4LK0 A;  5C4J C;  3K7A C;  4QJV A;  1I6H C;  1HQM A;  2WAQ D;  4Y52 K;  5IYD C;  1R9T C;  3HOU K;  1TWC C;  3HKZ D;  3GTJ K;  3GTP C;  2NVQ C;  3H0G K;  4C3I K;  4BBS K;  3GTM C;  4A93 K;  4Q4Z A;  3HOZ K;  3HOX K;  3S17 K;  5FJ8 K;  4G7H A;  4AYB L;  4A3J C;  3S16 C;  2NVY K;  3S1R C;  2JA6 K;  5FLM C;  4OIP A;  1Y1V C;  4LJZ A;  2R92 C;  4YFX A;  1I6H K;  5IYB C;  4A3M C;  3H3V D;  1TWH C;  4A3D K;  2NVQ K;  1ZYR A;  2WB1 D;  3GTM K;  2NVX C;  3M3Y C;  1XPP A;  4A3K C;  4GZY A;  5TMF A;  3PO2 K;  2Y0S D;  5IYC C;  4A3F C;  4BXX K;  4LLG A;  5IP7 C;  4BY1 C;  2R7Z C;  2A68 A;  1TWG K;  2R93 K;  3I4N K;  4KMU A;  4A3B C;  1Y1V K;  2R92 K;  3GTG C;  4A3I K;  3RZO K;  4AYB D;  3S1M C;  4A3M K;  5M5Y K;  4X6A C;  1BDF A;  3S1N K;  1SMY A;  5TMC A;  4A3E K;  3PO3 C;  3HOY K;  2B63 C;  4XSX A;  2PMZ D;  3HOW C;  3FKI K;  4BBR C;  5D4D A;  2A6E A;  1YNN A;  2JA5 C;  3S1Q C;  4A3G C;  1TWF C;  5C4J K;  3K7A K;  5C3E C;  4G7Z A;  5IP9 C;  1SFO C;  3GTL C;  4OIR A;  4MEX A;  2E2I C;  4QJV B;  2NVT C;  3S15 C;  1R9T K;  5IYD K;  2JA8 C;  3EQL A;  1TWC K;  3CQZ C;  1Y1W C;  4YFK A;  3GTP K;  5C4X C;  2BE5 A;  1K83 C;  4LK1 A;  3HOV C;  4G7O A;  3I4M C;  2VUM C;  5C44 C; 
#chains in the Genus database with same CATH topology
 4A3J K;  3RZD C;  4KAS A;  1YNJ A;  1TWH A;  2A6H A;  1O24 A;  3S14 C;  2E2I K;  3JST A;  3S2H C;  4A3L C;  3M3Y K;  2Y3P A;  3N0B A;  1O26 A;  4C3H K;  5C44 K;  4A3F K;  2R7Z K;  4BY1 K;  4J3N A;  1F7V A;  3N3Y A;  3WOD A;  3GTK C;  4GTF A;  5IOQ A;  3PO3 K;  1ZBS A;  2P5M A;  2NVY C;  4BBR K;  4GTA A;  4QIW D;  2WB1 L;  1SFO A;  4P5A A;  1Y1W A;  3CQZ A;  4A3D C;  5C3E K;  4A3C C;  3BP8 C;  3S15 K;  3GTK K;  3SZZ A;  2PA8 D;  4RMF A;  2WAQ L;  3HOV K;  3AH5 A;  2YU9 A;  4GTL A;  3M4O K;  1WSR A;  3HOY C;  4A3C K;  4BY7 K;  1TWA K;  5L46 A;  4OIN A;  3FKI C;  4OIQ A;  3SZY A;  3BUE A;  3T02 A;  1TWF A;  3K7A C;  2D6F C;  4GTD A;  4WIL A;  5E68 A;  1IE0 A;  3GTP C;  4C3I K;  5CJ9 A;  4A93 K;  5FJ8 K;  3S16 C;  1WQG A;  4KB4 A;  2JA6 K;  4OIP A;  1XXC A;  1Y1V C;  2KWA A;  1TWH C;  3TTG A;  1ZYR A;  2WB1 D;  4BLA A;  2RGR A;  4A3K C;  4AH6 A;  3PO2 K;  5IYC C;  5IP7 C;  4BLB A;  3NUH A;  1TWG K;  1Y1V K;  3GTJ A;  1EH1 A;  1F9N A;  3GTG C;  3H0G A;  3RZO K;  4AYB D;  5M5Y K;  4X6A C;  1BDF A;  5TMC A;  4A3E K;  3TFI A;  2NVY A;  3OPF A;  4A3G C;  5IP9 C;  1SFO C;  1R9T K;  1Y1W C;  1TWC K;  3CQZ C;  4YFK A;  5C4X C;  2XCO A;  2RH6 A;  3I4M C;  2R92 A;  4JK1 A;  2PHC B;  1YCL A;  3S1R K;  2YU9 C;  1IQ0 A;  5JFE A;  4G0W A;  5IYB K;  1IW7 A;  4QIW L;  3CQZ K;  4LR2 A;  1BS2 A;  5C4X K;  1GE9 A;  2P8T A;  3S2D C;  2NVX K;  1DD5 A;  4XSZ A;  4C3J K;  3I4M K;  3HKZ L;  3VA7 A;  1KQ4 A;  4KDD A;  4YG2 A;  4YFN A;  2YU9 K;  3HOU C;  1F93 A;  2PA8 L;  4KN4 A;  5CHP A;  2B63 A;  3S1M K;  1BJT A;  3HOX C;  3S17 C;  3HOW K;  3QX3 A;  3GTL A;  3MML B;  2JA5 K;  2A69 A;  5M3F K;  3V4G A;  1TWF K;  3G4A A;  1ZXO A;  4GTC A;  2JA8 K;  2VUM A;  4BXX C;  2EBB A;  1K83 K;  1X31 C;  5M5X K;  2PMZ L;  3GTG A;  4WJ3 M;  5M3M K;  4A3I C;  3RZD K;  4Y52 C;  1WOS A;  5TJ3 A;  1I50 A;  3S1N C;  2XCQ A;  3FOF A;  3GTJ C;  3LPX A;  3H0G C;  2O5I A;  3S14 K;  2E2H A;  3S2H K;  1I6V A;  5M5W K;  3GTO A;  4A3L K;  1G51 A;  1XZQ A;  3AD8 C;  5C4J C;  4QJV A;  5EGH A;  1JQW A;  4Y52 K;  3HKZ D;  1PJ6 A;  3GTJ K;  4XCH A;  3H0G K;  4BKW A;  4Q4Z A;  4P9S A;  4G7H A;  4AYB L;  1WIH A;  2NVY K;  4KC6 A;  5FLM C;  1AB4 A;  2JA7 A;  2R92 C;  4A3M C;  4A3D K;  1USO A;  1VJE A;  1ZQ1 C;  5TMF A;  1J98 A;  3CAG A;  4LLG A;  2A68 A;  1C0A A;  4A3B C;  2R92 K;  3N0C A;  1L0W A;  4A3M K;  4FZB A;  1XZP A;  3L4K A;  3HOY K;  2B63 C;  4XSX A;  4GTE A;  4KB2 A;  2PMZ D;  3FKI K;  5D4D A;  2V6U A;  1INN A;  1ZVU A;  1O2B A;  2V6T A;  3K7A K;  3GTL C;  3GTM A;  1O29 A;  4QJV B;  3A8J A;  3EQL A;  3GTP K;  4KAR A;  2FQT A;  4GFQ A;  4KMH A;  2VUM C;  1O28 A;  1I3Q C;  3S16 K;  1B4A A;  3ORE A;  1IBA A;  4NOI A;  3GTL K;  4C2M C;  1I50 C;  1TWH K;  4WJ4 A;  1VRQ C;  2E2H C;  4A3K K;  5IYC K;  3GTO C;  5IP7 K;  4LOW A;  3GTG K;  4BBS C;  2JH3 A;  1F7U A;  4KN7 A;  4X6A K;  1I50 K;  1VLO A;  2V6S A;  2PPB A;  1XXB A;  3OEP A;  2E2H K;  4OIO A;  3T00 A;  3GTO K;  3T01 A;  4A3G K;  2Y0S L;  2JA7 C;  1JOE A;  3L4J A;  4MEY A;  5EGE A;  1O25 A;  5IP9 K;  1SFO K;  4DDQ A;  5IOS A;  1Y1W K;  3GDZ A;  2CFA A;  2E2J C;  2R93 C;  5IOT A;  3I4N C;  1WCM A;  1TWA A;  3Q3Q A;  1IL2 A;  1WOP A;  2JA7 K;  3GTQ A;  3BP3 A;  1WOR A;  1WQH A;  2GSU A;  3S0X A;  3S2D K;  2E2J K;  2O5J A;  4XLN A;  4LK0 A;  5IYD C;  3HOU K;  3IPJ A;  3GTM C;  3HOX K;  3S17 K;  3FHZ A;  1I3Q A;  4A3J C;  4LJZ A;  3GEE A;  1J6X A;  3GTM K;  1BGW A;  3M3Y C;  1XPP A;  1TWG A;  4GZY A;  4C3H C;  2Y0S D;  4BXX K;  4A3F C;  4PAA A;  4BY1 C;  2R7Z C;  3FOE A;  2CFA B;  4GT9 A;  4KMU A;  3AQO A;  1EQR A;  1HI9 A;  4A3I K;  3S1N K;  3PO3 C;  3TFH A;  4BBR C;  2ZFZ A;  1PJ5 A;  3S1Q C;  1DCP A;  1R9T A;  1TWC A;  4KAW X;  4GTB A;  5C4J K;  4G0V A;  5C3E C;  4OIR A;  4MEX A;  2NVT C;  3S15 C;  4LK1 A;  1RU0 A;  2BE5 A;  3HOV C;  1WSV A;  4G7O A;  2R93 A;  3AD9 C;  4C45 A;  4KM9 A;  3M4O C;  3S1Q K;  5FLM K;  1WCM C;  4BY7 C;  1TWA C;  2NVX A;  2NVT K;  4KM8 A;  1IS1 A;  3HXA A;  1O2A A;  2ZUF A;  4P5B A;  3GTQ C;  3DXJ A;  4ZH4 A;  2XCR B;  1VH2 A;  4G0U A;  1WOO A;  2CW0 A;  4MQ9 A;  4A3B K;  1WCM K;  1XZQ B;  4C3I C;  1O2F B;  1UV7 A;  4A93 C;  1J6W A;  5HL8 A;  4Y7N C;  2B63 K;  3GTQ K;  2JA5 A;  3H3V L;  5IOR A;  2JA6 C;  2E2I A;  4KMA A;  2GAH C;  3G4C A;  1K83 A;  1PJ7 A;  1EK8 A;  4Y7N K;  3PO2 C;  2R7Z A;  5JVO A;  4Q5S A;  1TWG C;  4LQY A;  3ERE D;  2VUM K;  1I3Q K;  1ISE A;  4KMD A;  3RZO C;  2GAG C;  4A3E C;  1VGX A;  4O2D A;  3A8I A;  2GSN A;  3A8K A;  4C2M K;  3HOZ C;  1USM A;  4XLP A;  1XZP B;  1YX2 A;  4ILD A;  1I6H C;  1HQM A;  2WAQ D;  3GTK A;  1R9T C;  1TWC C;  2NVQ C;  1J6V A;  3LAP A;  4BBS K;  1V5V A;  1XXA A;  3HOZ K;  1DCH A;  3S1R C;  3AD7 C;  2GSO A;  3GEH A;  4YFX A;  1I6H K;  5IYB C;  3H3V D;  2W7V A;  4PAB A;  2NVQ K;  4KAT A;  2NVX C;  4C3J C;  2R93 K;  3I4N K;  3LAJ A;  3GEI A;  1JVI A;  3TFJ A;  3S1M C;  3GIR A;  3FKI A;  1SMY A;  1DCO A;  1B4B A;  1EI6 A;  3HOW C;  2ZUE A;  2JA6 A;  1EFW A;  2A6E A;  4FM9 A;  1YNN A;  2JA5 C;  4M1X A;  1TWF C;  3GTP A;  4G7Z A;  3ADA C;  2E2I C;  3AQP A;  5IYD K;  2JA8 C;  2FQO A;  3GSI A;  1O27 A;  1K83 C;  1WQF A;  1Y1V A;  5C44 C; 
#chains in the Genus database with same CATH homology
 1I3Q C;  4JK1 A;  4A3J K;  3S16 K;  3M4O C;  3S1Q K;  3RZD C;  1YNJ A;  3S1R K;  4NOI A;  5FLM K;  2YU9 C;  1WCM C;  4BY7 C;  2A6H A;  3GTL K;  1TWA C;  3S14 C;  5IYB K;  2E2I K;  2NVT K;  1IW7 A;  1I50 C;  4QIW L;  3S2H C;  1TWH K;  3CQZ K;  5C4X K;  3S2D C;  3GTQ C;  2NVX K;  3M3Y K;  4XSZ A;  3I4M K;  4C3J K;  2E2H C;  3DXJ A;  3HKZ L;  4ZH4 A;  4C3H K;  4A3K K;  5C44 K;  5IYC K;  4A3F K;  4YG2 A;  3GTO C;  5IP7 K;  4YFN A;  4BY1 K;  2R7Z K;  2YU9 K;  2CW0 A;  2PA8 L;  4MQ9 A;  3HOU C;  4A3B K;  1WCM K;  4KN4 A;  3GTG K;  3WOD A;  4BBS C;  3S1M K;  4KN7 A;  4A93 C;  1I50 K;  3GTK C;  4X6A K;  3HOX C;  3S17 C;  3PO3 K;  4Y7N C;  2B63 K;  3GTQ K;  2PPB A;  2E2H K;  3H3V L;  3HOW K;  4OIO A;  2NVY C;  4BBR K;  2JA6 C;  4QIW D;  2WB1 L;  3GTO K;  2JA5 K;  2A69 A;  5M3F K;  4A3G K;  2Y0S L;  1TWF K;  2JA7 C;  4A3D C;  4MEY A;  5C3E K;  5IP9 K;  1SFO K;  4A3C C;  3S15 K;  3GTK K;  2JA8 K;  1Y1W K;  2PA8 D;  4Y7N K;  3PO2 C;  4BXX C;  2WAQ L;  1K83 K;  3HOV K;  4Q5S A;  2E2J C;  1TWG C;  5M5X K;  3I4N C;  2R93 C;  2VUM K;  1I3Q K;  2PMZ L;  3M4O K;  5M3M K;  4A3I C;  3RZO C;  3RZD K;  4Y52 C;  3S1N C;  2JA7 K;  4A3E C;  3GTJ C;  3HOY C;  4A3C K;  1TWA K;  4BY7 K;  3H0G C;  2O5I A;  3S14 K;  4OIN A;  4C2M K;  3HOZ C;  3FKI C;  3S2H K;  1I6V A;  4OIQ A;  5M5W K;  4XLP A;  3S2D K;  4A3L C;  4A3L K;  2E2J K;  2O5J A;  4XLN A;  4LK0 A;  5C4J C;  3K7A C;  4QJV A;  1I6H C;  1HQM A;  2WAQ D;  4Y52 K;  5IYD C;  1R9T C;  3HOU K;  1TWC C;  3HKZ D;  3GTJ K;  3GTP C;  2NVQ C;  3H0G K;  4C3I K;  4BBS K;  3GTM C;  4A93 K;  4Q4Z A;  3HOZ K;  3HOX K;  3S17 K;  5FJ8 K;  4G7H A;  4AYB L;  4A3J C;  3S16 C;  2NVY K;  3S1R C;  2JA6 K;  5FLM C;  4OIP A;  1Y1V C;  4LJZ A;  2R92 C;  4YFX A;  1I6H K;  5IYB C;  4A3M C;  3H3V D;  1TWH C;  4A3D K;  2NVQ K;  1ZYR A;  2WB1 D;  3GTM K;  2NVX C;  3M3Y C;  1XPP A;  4A3K C;  4GZY A;  5TMF A;  3PO2 K;  2Y0S D;  5IYC C;  4A3F C;  4BXX K;  4LLG A;  5IP7 C;  4BY1 C;  2R7Z C;  2A68 A;  1TWG K;  2R93 K;  3I4N K;  4KMU A;  4A3B C;  1Y1V K;  2R92 K;  3GTG C;  4A3I K;  3RZO K;  4AYB D;  3S1M C;  4A3M K;  5M5Y K;  4X6A C;  1BDF A;  3S1N K;  1SMY A;  5TMC A;  4A3E K;  3PO3 C;  3HOY K;  2B63 C;  4XSX A;  2PMZ D;  3HOW C;  3FKI K;  4BBR C;  5D4D A;  2A6E A;  1YNN A;  2JA5 C;  3S1Q C;  4A3G C;  1TWF C;  5C4J K;  3K7A K;  5C3E C;  4G7Z A;  5IP9 C;  1SFO C;  3GTL C;  4OIR A;  4MEX A;  2E2I C;  4QJV B;  2NVT C;  3S15 C;  1R9T K;  5IYD K;  2JA8 C;  3EQL A;  1TWC K;  3CQZ C;  1Y1W C;  4YFK A;  3GTP K;  5C4X C;  2BE5 A;  1K83 C;  4LK1 A;  3HOV C;  4G7O A;  3I4M C;  2VUM C;  5C44 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...