4M1XA

Tetrameric ring structure of 201phi2-1p060 from pseudomonas phage 201phi2-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
LEKFKFSKGDGIKFSNTTFHIYEATRNYVTIHILKKYATAELMEFMHTRHDAVYIGPILEWTDGVHLTFRRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized protein 201phi2-1p060
publication title Tetrameric ring structure of 201phi2-1p060 from Pseudomonas phage 201phi2-1
rcsb
source organism Pseudomonas phage 201phi2-1
total genus 16
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.240 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4m1xA00
4M1XA
chains in the Genus database with same CATH superfamily
1I3QA 3S1QK 4G7OA 2D6FC 1I50A 4BLBA 3GTLK 5M5WK 1F7VA 4Y52K 1IS1A 4A3EC 3N0BA 3PO2K 5C3EC 3S14C 2NVYC 3V4GA 1VH2A 2WAQL 4KN4A 2R92K 2E2IA 2Y0SD 1TWAK 2GAHC 1ZQ1C 1DCPA 5EGEA 5HL8A 2NVXC 3HOYK 1USMA 1Y1WC 1O27A 2RH6A 4GFQA 3ADAC 5CHPA 2JA7C 1AB4A 3FOFA 5JVOA 1TWHK 2NVTC 3DXJA 3GEIA 4WJ3M 3S1MK 3GIRA 3LAPA 4OIQA 1I3QK 5IP7C 1I50K 3GTQC 4GTCA 4BBSC 2GSOA 2NVYA 3LPXA 1TWCK 4G0VA 1V5VA 3M4OC 2V6UA 5FJ8K 1XZQA 5FLMC 1O2FB 1PJ5A 2NVXA 4KMAA 2E2IK 3GTKC 2R93A 2GAGC 5TJ3A 5TMCA 2JA7A 1O25A 2CFAB 5IYBC 4C2MK 5JFEA 1GE9A 3AH5A 1YCLA 1SFOA 1RU0A 3N0CA 1F9NA 3GTPC 3G4CA 4Q4ZA 3GTGC 4BLAA 4FZBA 3LAJA 1R9TA 3HOXK 3HKZD 3OREA 1XZPA 1I6HK 3FHZA 3GTMK 4KM9A 4QJVB 5TMFA 4A93C 1WSRA 2PA8L 5IORA 2XCQA 4QIWD 3SZZA 5C4JK 4C3JK 2R93K 1KQ4A 4LK1A 4KATA 4A3IC 4A3DK 3MMLB 1DD5A 1VRQC 4A3JK 1K83C 4G7ZA 3FKIC 3GTGA 2XCRB 4A3GK 4G0UA 1SFOK 1EFWA 4A3LC 3BP3A 4BBSK 2W7VA 2EBBA 4X6AK 3L4JA 2E2JK 1R9TK 2P8TA 3BP8C 1J98A 4BY1C 5M5YK 3RZOK 4O2DA 1XXAA 5C4XC 3S16C 4GTDA 4A3KK 1VJEA 1Y1VC 4KASA 4A3MK 2PPBA 3S17C 4AYBL 4BKWA 1JVIA 4A3CK 3FKIA 1WCMC 1F7UA 3HOVK 1WQFA 2ZUEA 4KB4A 5M3FK 3HOUK 3GTGK 2R7ZK 2B63A 4WILA 3I4NC 2O5JA 1TWFA 3K7AC 5IYCC 4BXXC 1TWGC 4A3FC 2E2HC 3S1NC 2YU9C 4A3BC 5IYDK 4AH6A 3AQPA 1ISEA 1EH1A 4GTBA 4A93K 4C3IC 1VGXA 4KDDA 1BDFA 3HOZC 4KMDA 3HOWC 1I6VA 2JA8C 3S1RC 4KARA 4C3HK 4BY7C 5C44C 2GSNA 4LOWA 2WB1D 3VA7A 3WODA 3G4AA 3GTOC 4GZYA 2B63K 3A8JA 2YU9A 1O24A 2P5MA 4P9SA 1TWFK 3JSTA 2PMZD 4BY1K 5IOSA 3TFJA 4XCHA 1C0AA 4ILDA 1ZXOA 1L0WA 4XSZA 1B4AA 3M3YC 4KN7A 1Y1WA 2NVQK 4DDQA 1WIHA 1PJ7A 1WORA 1WSVA 1X31C 3AQOA 5IP9K 2A6EA 3GTJC 1JOEA 1JQWA 2A6HA 3T02A 4PABA 3GTQA 4GT9A 3AD7C 4JK1A 4C45A 4A3EK 3S2HC 3PO3C 1USOA 2VUMC 1O26A 3S2DC 5IOQA 4LLGA 5C3EK 4GTEA 3S14K 2NVYK 1WQGA 3GTKA 1PJ6A 4BBRC 4M1XA 3H0GC 4MQ9A 3CQZC 3GSIA 2NVXK 3S1QC 1DCHA 3AD8C 1Y1WK 2WAQD 5CJ9A 2JA7K 3GTLC 3L4KA 1WOPA 2Y0SL 1INNA 4Y52C 4Y7NC 2BE5A 2NVTK 3GTPA 4LQYA 3PO2C 5D4DA 3RZDC 1SMYA 2A69A 3TFIA 3AD9C 5IP7K 4P5BA 2CW0A 3Q3QA 1EQRA 3GTQK 2VUMA 3H3VD 2R92C 4YFKA 5M5XK 2KWAA 1YNNA 4GTLA 3M4OK 3HOYC 2WB1L 1VLOA 4XLPA 5FLMK 1O2AA 1IE0A 1ZBSA 3GTKK 3BUEA 1TWHC 4PAAA 3S1MC 1ZVUA 1K83A 5IYBK 1I50C 3IPJA 3NUHA 3OPFA 4J3NA 1TWCC 1WOSA 4LJZA 3GTPK 1HI9A 1DCOA 4P5AA 3OEPA 3N3YA 2JA5C 2VUMK 2O5IA 4MEYA 1TWHA 1Y1VA 1O2BA 4XLNA 4G7HA 4OIPA 2JA6C 3HKZL 2CFAA 4A3IK 1WCMA 4KMHA 2Y3PA 1TWCA 4KAWX 5IOTA 4Y7NK 1K83K 2PA8D 1EK8A 3FKIK 4QIWL 3HOXC 2XCOA 3RZDK 4A3LK 1I6HC 4WJ4A 2JA5A 1YNJA 4LK0A 1TWGA 2E2HA 3GTMC 1IQ0A 1J6VA 5C4JC 2V6TA 4KC6A 3S0XA 4QJVA 4C3JC 2R93C 5C4XK 3S16K 2V6SA 4A3DC 3FOEA 3H3VL 1IW7A 1BGWA 2JA6A 4OINA 4A3JC 1Y1VK 4GTAA 4GTFA 4XSXA 3S17K 4A3GC 1SFOC 3S15C 3QX3A 5E68A 1WCMK 2FQTA 3I4MC 4X6AC 1IL2A 3GTOA 1WOOA 2E2JC 1R9TC 1J6XA 3GTMA 4AYBD 3HXAA 3I4NK 3TTGA 3RZOC 5M3MK 4NOIA 2JA5K 3TFHA 3K7AK 5IYCK 4BXXK 1TWGK 1J6WA 4A3FK 2E2HK 3EQLA 2YU9K 3S1NK 3A8KA 4A3KC 4A3BK 2ZUFA 4A3MC 3SZYA 4C3IK 2PHCB 4A3CC 1IBAA 3T01A 2A68A 3HOVC 2JA6K 3HOZK 2GSUA 1B4BA 1F93A 3GDZA 3HOWK 3A8IA 3GTJA 3HOUC 2R7ZC 1XXCA 2JA8K 3S1RK 4BY7K 3GEHA 4YG2A 5C44K 4ZH4A 3GTOK 1O29A 5IYDC 4RMFA 4LR2A 1XZQB 1TWAC 3T00A 5L46A 1O28A 4OIOA 1HQMA 3H0GA 3CQZA 5EGHA 3M3YK 4KB2A 4C3HC 1G51A 4KM8A 2R7ZA 3GTLA 2PMZL 1BJTA 3S15K 3GEEA 1I3QC 1XXBA 1UV7A 3GTJK 2B63C 4MEXA 3I4MK 1TWFC 2RGRA 2R92A 3ERED 4FM9A 1TWAA 1XZPB 3S2HK 3PO3K 1YX2A 3S2DK 2E2IC 2ZFZA 2NVQC 1ZYRA 1XPPA 3CAGA 2FQOA 4OIRA 1EI6A 4YFXA 1BS2A 5IP9C 4BBRK 4YFNA 4G0WA 3H0GK 4C2MC 3CQZK 4Q5SA 2JH3A 1WQHA 4KMUA
chains in the Genus database with same CATH topology
1I3QA 1BGWA 2JA6A 1I50A 4BLBA 1WQGA 3L4JA 4GTAA 3GTKA 4GTFA 1IS1A 3N0BA 4M1XA 1XXAA 3QX3A 4GTDA 3V4GA 5CJ9A 3GTOA 4KASA 2E2IA 3L4KA 3GTMA 3GTPA 4BKWA 4LQYA 5EGEA 3FKIA 1WQFA 4P5BA 4GFQA 2RH6A 1O27A 3Q3QA 5CHPA 4KB4A 1AB4A 2VUMA 3FOFA 5JVOA 2B63A 2KWAA 4GTLA 2PHCB 1TWFA 3LAPA 1O2AA 2GSUA 1B4BA 1ZBSA 4GTCA 2GSOA 3GTJA 2NVYA 3AQPA 3BUEA 3LPXA 1ISEA 1EH1A 1XXCA 4GTBA 4G0VA 4C3IC 4KDDA 1ZVUA 1K83A 2NVXA 4KMDA 3NUHA 3OPFA 4KMAA 1O29A 2R93A 4J3NA 5TJ3A 4KARA 2JA7A 4LR2A 3FOEA 4P5AA 1O25A 2CFAB 2GSNA 1O28A 3OEPA 5JFEA 1GE9A 3AH5A 3N3YA 3VA7A 3G4AA 1SFOA 3H0GA 3N0CA 3CQZA 5EGHA 2YU9A 1O24A 2P5MA 1F9NA 4KB2A 4C3HC 3G4CA 4KM8A 2R7ZA 1TWHA 1Y1VA 3GTLA 4BLAA 4FZBA 1O2BA 3LAJA 1R9TA 1BJTA 5IOSA 1XXBA 4ILDA 3OREA 1ZXOA 2CFAA 1B4AA 1WCMA 4KMHA 3FHZA 1Y1WA 4KM9A 2Y3PA 4DDQA 2RGRA 1WIHA 1TWCA 4KAWX 5IOTA 2R92A 3ERED 5IORA 1EK8A 3AQOA 2XCQA 1TWAA 4FM9A 2XCOA 1KQ4A 2JA5A 4KATA 2ZFZA 3MMLB 1TWGA 2E2HA 3GTQA 1DD5A 3CAGA 4GT9A 3GTGA 2XCRB 4G0UA 4KC6A 3S0XA 4G0WA 4C2MC 4C3JC 2JH3A 1O26A 5IOQA 1WQHA 4GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1X A; 
#chains in the Genus database with same CATH topology
 1I3Q A;  3S1Q K;  4G7O A;  2D6F C;  1I50 A;  4BLB A;  3GTL K;  5M5W K;  1F7V A;  4Y52 K;  1IS1 A;  4A3E C;  3N0B A;  3PO2 K;  5C3E C;  3S14 C;  2NVY C;  3V4G A;  1VH2 A;  2WAQ L;  4KN4 A;  2R92 K;  2E2I A;  2Y0S D;  1TWA K;  2GAH C;  1ZQ1 C;  1DCP A;  5EGE A;  5HL8 A;  2NVX C;  3HOY K;  1USM A;  1Y1W C;  1O27 A;  2RH6 A;  4GFQ A;  3ADA C;  5CHP A;  2JA7 C;  1AB4 A;  3FOF A;  5JVO A;  1TWH K;  2NVT C;  3DXJ A;  3GEI A;  4WJ3 M;  3S1M K;  3GIR A;  3LAP A;  4OIQ A;  1I3Q K;  5IP7 C;  1I50 K;  3GTQ C;  4GTC A;  4BBS C;  2GSO A;  2NVY A;  3LPX A;  1TWC K;  4G0V A;  1V5V A;  3M4O C;  2V6U A;  5FJ8 K;  1XZQ A;  5FLM C;  1O2F B;  1PJ5 A;  2NVX A;  4KMA A;  2E2I K;  3GTK C;  2R93 A;  2GAG C;  5TJ3 A;  5TMC A;  2JA7 A;  1O25 A;  2CFA B;  5IYB C;  4C2M K;  5JFE A;  1GE9 A;  3AH5 A;  1YCL A;  1SFO A;  1RU0 A;  3N0C A;  1F9N A;  3GTP C;  3G4C A;  4Q4Z A;  3GTG C;  4BLA A;  4FZB A;  3LAJ A;  1R9T A;  3HOX K;  3HKZ D;  3ORE A;  1XZP A;  1I6H K;  3FHZ A;  3GTM K;  4KM9 A;  4QJV B;  5TMF A;  4A93 C;  1WSR A;  2PA8 L;  5IOR A;  2XCQ A;  4QIW D;  3SZZ A;  5C4J K;  4C3J K;  2R93 K;  1KQ4 A;  4LK1 A;  4KAT A;  4A3I C;  4A3D K;  3MML B;  1DD5 A;  1VRQ C;  4A3J K;  1K83 C;  4G7Z A;  3FKI C;  3GTG A;  2XCR B;  4A3G K;  4G0U A;  1SFO K;  1EFW A;  4A3L C;  3BP3 A;  4BBS K;  2W7V A;  2EBB A;  4X6A K;  3L4J A;  2E2J K;  1R9T K;  2P8T A;  3BP8 C;  1J98 A;  4BY1 C;  5M5Y K;  3RZO K;  4O2D A;  1XXA A;  5C4X C;  3S16 C;  4GTD A;  4A3K K;  1VJE A;  1Y1V C;  4KAS A;  4A3M K;  2PPB A;  3S17 C;  4AYB L;  4BKW A;  1JVI A;  4A3C K;  3FKI A;  1WCM C;  1F7U A;  3HOV K;  1WQF A;  2ZUE A;  4KB4 A;  5M3F K;  3HOU K;  3GTG K;  2R7Z K;  2B63 A;  4WIL A;  3I4N C;  2O5J A;  1TWF A;  3K7A C;  5IYC C;  4BXX C;  1TWG C;  4A3F C;  2E2H C;  3S1N C;  2YU9 C;  4A3B C;  5IYD K;  4AH6 A;  3AQP A;  1ISE A;  1EH1 A;  4GTB A;  4A93 K;  4C3I C;  1VGX A;  4KDD A;  1BDF A;  3HOZ C;  4KMD A;  3HOW C;  1I6V A;  2JA8 C;  3S1R C;  4KAR A;  4C3H K;  4BY7 C;  5C44 C;  2GSN A;  4LOW A;  2WB1 D;  3VA7 A;  3WOD A;  3G4A A;  3GTO C;  4GZY A;  2B63 K;  3A8J A;  2YU9 A;  1O24 A;  2P5M A;  4P9S A;  1TWF K;  3JST A;  2PMZ D;  4BY1 K;  5IOS A;  3TFJ A;  4XCH A;  1C0A A;  4ILD A;  1ZXO A;  1L0W A;  4XSZ A;  1B4A A;  3M3Y C;  4KN7 A;  1Y1W A;  2NVQ K;  4DDQ A;  1WIH A;  1PJ7 A;  1WOR A;  1WSV A;  1X31 C;  3AQO A;  5IP9 K;  2A6E A;  3GTJ C;  1JOE A;  1JQW A;  2A6H A;  3T02 A;  4PAB A;  3GTQ A;  4GT9 A;  3AD7 C;  4JK1 A;  4C45 A;  4A3E K;  3S2H C;  3PO3 C;  1USO A;  2VUM C;  1O26 A;  3S2D C;  5IOQ A;  4LLG A;  5C3E K;  4GTE A;  3S14 K;  2NVY K;  1WQG A;  3GTK A;  1PJ6 A;  4BBR C;  4M1X A;  3H0G C;  4MQ9 A;  3CQZ C;  3GSI A;  2NVX K;  3S1Q C;  1DCH A;  3AD8 C;  1Y1W K;  2WAQ D;  5CJ9 A;  2JA7 K;  3GTL C;  3L4K A;  1WOP A;  2Y0S L;  1INN A;  4Y52 C;  4Y7N C;  2BE5 A;  2NVT K;  3GTP A;  4LQY A;  3PO2 C;  5D4D A;  3RZD C;  1SMY A;  2A69 A;  3TFI A;  3AD9 C;  5IP7 K;  4P5B A;  2CW0 A;  3Q3Q A;  1EQR A;  3GTQ K;  2VUM A;  3H3V D;  2R92 C;  4YFK A;  5M5X K;  2KWA A;  1YNN A;  4GTL A;  3M4O K;  3HOY C;  2WB1 L;  1VLO A;  4XLP A;  5FLM K;  1O2A A;  1IE0 A;  1ZBS A;  3GTK K;  3BUE A;  1TWH C;  4PAA A;  3S1M C;  1ZVU A;  1K83 A;  5IYB K;  1I50 C;  3IPJ A;  3NUH A;  3OPF A;  4J3N A;  1TWC C;  1WOS A;  4LJZ A;  3GTP K;  1HI9 A;  1DCO A;  4P5A A;  3OEP A;  3N3Y A;  2JA5 C;  2VUM K;  2O5I A;  4MEY A;  1TWH A;  1Y1V A;  1O2B A;  4XLN A;  4G7H A;  4OIP A;  2JA6 C;  3HKZ L;  2CFA A;  4A3I K;  1WCM A;  4KMH A;  2Y3P A;  1TWC A;  4KAW X;  5IOT A;  4Y7N K;  1K83 K;  2PA8 D;  1EK8 A;  3FKI K;  4QIW L;  3HOX C;  2XCO A;  3RZD K;  4A3L K;  1I6H C;  4WJ4 A;  2JA5 A;  1YNJ A;  4LK0 A;  1TWG A;  2E2H A;  3GTM C;  1IQ0 A;  1J6V A;  5C4J C;  2V6T A;  4KC6 A;  3S0X A;  4QJV A;  4C3J C;  2R93 C;  5C4X K;  3S16 K;  2V6S A;  4A3D C;  3FOE A;  3H3V L;  1IW7 A;  1BGW A;  2JA6 A;  4OIN A;  4A3J C;  1Y1V K;  4GTA A;  4GTF A;  4XSX A;  3S17 K;  4A3G C;  1SFO C;  3S15 C;  3QX3 A;  5E68 A;  1WCM K;  2FQT A;  3I4M C;  4X6A C;  1IL2 A;  3GTO A;  1WOO A;  2E2J C;  1R9T C;  1J6X A;  3GTM A;  4AYB D;  3HXA A;  3I4N K;  3TTG A;  3RZO C;  5M3M K;  4NOI A;  2JA5 K;  3TFH A;  3K7A K;  5IYC K;  4BXX K;  1TWG K;  1J6W A;  4A3F K;  2E2H K;  3EQL A;  2YU9 K;  3S1N K;  3A8K A;  4A3K C;  4A3B K;  2ZUF A;  4A3M C;  3SZY A;  4C3I K;  2PHC B;  4A3C C;  1IBA A;  3T01 A;  2A68 A;  3HOV C;  2JA6 K;  3HOZ K;  2GSU A;  1B4B A;  1F93 A;  3GDZ A;  3HOW K;  3A8I A;  3GTJ A;  3HOU C;  2R7Z C;  1XXC A;  2JA8 K;  3S1R K;  4BY7 K;  3GEH A;  4YG2 A;  5C44 K;  4ZH4 A;  3GTO K;  1O29 A;  5IYD C;  4RMF A;  4LR2 A;  1XZQ B;  1TWA C;  3T00 A;  5L46 A;  1O28 A;  4OIO A;  1HQM A;  3H0G A;  3CQZ A;  5EGH A;  3M3Y K;  4KB2 A;  4C3H C;  1G51 A;  4KM8 A;  2R7Z A;  3GTL A;  2PMZ L;  1BJT A;  3S15 K;  3GEE A;  1I3Q C;  1XXB A;  1UV7 A;  3GTJ K;  2B63 C;  4MEX A;  3I4M K;  1TWF C;  2RGR A;  2R92 A;  3ERE D;  4FM9 A;  1TWA A;  1XZP B;  3S2H K;  3PO3 K;  1YX2 A;  3S2D K;  2E2I C;  2ZFZ A;  2NVQ C;  1ZYR A;  1XPP A;  3CAG A;  2FQO A;  4OIR A;  1EI6 A;  4YFX A;  1BS2 A;  5IP9 C;  4BBR K;  4YFN A;  4G0W A;  3H0G K;  4C2M C;  3CQZ K;  4Q5S A;  2JH3 A;  1WQH A;  4KMU A; 
#chains in the Genus database with same CATH homology
 1I3Q A;  1BGW A;  2JA6 A;  1I50 A;  4BLB A;  1WQG A;  3L4J A;  4GTA A;  3GTK A;  4GTF A;  1IS1 A;  3N0B A;  4M1X A;  1XXA A;  3QX3 A;  4GTD A;  3V4G A;  5CJ9 A;  3GTO A;  4KAS A;  2E2I A;  3L4K A;  3GTM A;  3GTP A;  4BKW A;  4LQY A;  5EGE A;  3FKI A;  1WQF A;  4P5B A;  4GFQ A;  2RH6 A;  1O27 A;  3Q3Q A;  5CHP A;  4KB4 A;  1AB4 A;  2VUM A;  3FOF A;  5JVO A;  2B63 A;  2KWA A;  4GTL A;  2PHC B;  1TWF A;  3LAP A;  1O2A A;  2GSU A;  1B4B A;  1ZBS A;  4GTC A;  2GSO A;  3GTJ A;  2NVY A;  3AQP A;  3BUE A;  3LPX A;  1ISE A;  1EH1 A;  1XXC A;  4GTB A;  4G0V A;  4C3I C;  4KDD A;  1ZVU A;  1K83 A;  2NVX A;  4KMD A;  3NUH A;  3OPF A;  4KMA A;  1O29 A;  2R93 A;  4J3N A;  5TJ3 A;  4KAR A;  2JA7 A;  4LR2 A;  3FOE A;  4P5A A;  1O25 A;  2CFA B;  2GSN A;  1O28 A;  3OEP A;  5JFE A;  1GE9 A;  3AH5 A;  3N3Y A;  3VA7 A;  3G4A A;  1SFO A;  3H0G A;  3N0C A;  3CQZ A;  5EGH A;  2YU9 A;  1O24 A;  2P5M A;  1F9N A;  4KB2 A;  4C3H C;  3G4C A;  4KM8 A;  2R7Z A;  1TWH A;  1Y1V A;  3GTL A;  4BLA A;  4FZB A;  1O2B A;  3LAJ A;  1R9T A;  1BJT A;  5IOS A;  1XXB A;  4ILD A;  3ORE A;  1ZXO A;  2CFA A;  1B4A A;  1WCM A;  4KMH A;  3FHZ A;  1Y1W A;  4KM9 A;  2Y3P A;  4DDQ A;  2RGR A;  1WIH A;  1TWC A;  4KAW X;  5IOT A;  2R92 A;  3ERE D;  5IOR A;  1EK8 A;  3AQO A;  2XCQ A;  1TWA A;  4FM9 A;  2XCO A;  1KQ4 A;  2JA5 A;  4KAT A;  2ZFZ A;  3MML B;  1TWG A;  2E2H A;  3GTQ A;  1DD5 A;  3CAG A;  4GT9 A;  3GTG A;  2XCR B;  4G0U A;  4KC6 A;  3S0X A;  4G0W A;  4C2M C;  4C3J C;  2JH3 A;  1O26 A;  5IOQ A;  1WQH A;  4GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...