4M1XA

Tetrameric ring structure of 201phi2-1p060 from pseudomonas phage 201phi2-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
LEKFKFSKGDGIKFSNTTFHIYEATRNYVTIHILKKYATAELMEFMHTRHDAVYIGPILEWTDGVHLTFRRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein 201phi2-1p060
publication title Tetrameric ring structure of 201phi2-1p060 from Pseudomonas phage 201phi2-1
rcsb
source organism Pseudomonas phage 201phi2-1
molecule tags Unknown function
total genus 16
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.240 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4m1xA00
4M1XA
chains in the Genus database with same CATH superfamily
5FLMK 4XSXA 1PJ6A 1TWGC 3H3VD 3FOFA 4C3IK 4Y7NC 2A6HA 4KM8A 4C3HK 4BY7C 5EGHA 4LOWA 5C44C 1K83C 2O5JA 3S14K 4C2MK 4KASA 3AD9C 3GTJK 1SFOC 4DDQA 1O25A 1Y1VC 3M3YC 2NVTC 3S2HK 3LPXA 5FJ8K 2JA8C 3GTQA 1WOSA 4MQ9A 3CQZC 2B63C 3HOWC 3GTPC 4KMUA 4A93K 4LK0A 5IP9K 4BKWA 1VH2A 4BLAA 4A3KC 4KDDA 3HKZD 2RH6A 1TWCK 4KMHA 3S16C 2A6EA 2NVXK 2GAHC 2JA5C 1O2AA 1WSVA 1IQ0A 2EBBA 1TWGK 1I50C 1TWAC 3GTJA 2GSOA 4A3FC 4Y7NK 3HKZL 3SZZA 4FZBA 3NUHA 1O27A 4BY7K 2YU9C 5C44K 1K83K 2A68A 1XZPA 1F7UA 1F93A 3GEHA 1SFOK 1XZPB 3Q3QA 5JFEA 1TWHA 3GIRA 4A3MC 1Y1VK 4XLPA 3M3YK 3FKIC 4P9SA 2NVTK 4A3BC 1TWCA 2Y3PA 4OIPA 5IOSA 3CQZK 3HOWK 3GTPK 2BE5A 2NVXA 1IS1A 1O2FB 3LAJA 1DCPA 3N0CA 3S0XA 1TWGA 4A3KK 1WCMC 4WILA 1ZBSA 2JA7C 4GTEA 3G4AA 4A3GC 2GSUA 3ERED 4PAAA 4OIRA 3S16K 4KMAA 1ZYRA 3N3YA 1ZXOA 1YNJA 2JA5K 1K83A 5M5XK 1R9TC 1I50K 1TWAK 1O24A 4A3FK 1SFOA 3S1MC 4J3NA 1USOA 2NVYC 2FQOA 1DCOA 1WOPA 3GTMC 3DXJA 1Y1VA 2YU9K 2KWAA 3AH5A 4O2DA 1TWFC 4RMFA 4XCHA 2P5MA 1Y1WA 2CFAA 3S1QC 3CQZA 5CJ9A 2B63A 2CFAB 4XSZA 4A3MK 3FKIK 3S2DC 4A3BK 5M5WK 4OIOA 2V6UA 4M1XA 3GEEA 2E2IC 2JA5A 4GFQA 4YFXA 1WCMK 4X6AC 2JA7K 1I50A 4A3GK 3TFJA 2ZUFA 3AD7C 1WQFA 1O29A 1R9TK 1EFWA 4GTFA 3S15C 3S1MK 4YG2A 2NVYK 3AQOA 2PPBA 2VUMC 1BS2A 3GTMK 4GTLA 4LR2A 1I3QC 2A69A 3FKIA 1TWFK 1XXBA 2GAGC 4KB4A 3I4NC 3S1QK 3PO3C 1HQMA 4MEYA 4KAWX 3BP8C 3TFIA 4KC6A 4LLGA 3G4CA 3S2DK 1WCMA 2JA7A 1WIHA 3GSIA 1KQ4A 4MEXA 4Q5SA 1O28A 2E2IK 1USMA 3A8JA 5IYBC 1X31C 4X6AK 1R9TA 4KB2A 2NVYA 4GTDA 5C4JK 2JA6C 1VJEA 3V4GA 5IOQA 2XCRB 3K7AC 1TWFA 4GTBA 3BUEA 3S15K 4OINA 3S17C 2VUMK 4A3LC 4C45A 1I3QK 4GTAA 4LJZA 5TMCA 3MMLB 2CW0A 4C3JC 1AB4A 1F7VA 3I4NK 5D4DA 1J6XA 3PO3K 1YCLA 3IPJA 4LQYA 1XXAA 1YNNA 2E2IA 2PA8D 3SZYA 1WORA 2V6SA 2PMZD 4AYBL 4BBRC 4G7ZA 1BJTA 1DCHA 2P8TA 3TTGA 3T00A 5IYBK 4YFNA 3GDZA 2PA8L 3T02A 2PHCB 2JA6K 1EQRA 1BGWA 2VUMA 1EH1A 2XCQA 4KATA 1RU0A 2PMZL 2E2HC 3K7AK 4LK1A 4KM9A 3S17K 4KN7A 4G7HA 4ILDA 4A3LK 3EQLA 1EI6A 2O5IA 3L4JA 4C3JK 5M5YK 3I4MC 3FOEA 2D6FC 4Q4ZA 4A3IC 5TJ3A 4FM9A 1WQHA 3RZOC 4A3DC 2R92C 3GTQC 2ZUEA 3GTPA 3T01A 4GZYA 4GT9A 3HXAA 4KARA 1G51A 1IL2A 1J98A 4AH6A 2JA6A 4BBRK 4BY1C 4YFKA 3JSTA 3HOVC 4A3JC 4XLNA 1ZQ1C 1TWAA 5C4JC 3S1RC 3RZDC 4JK1A 2E2HK 2YU9A 3M4OC 3HOXC 2V6TA 4ZH4A 1I6HC 1TWHC 3GTOC 3I4MK 4A3IK 3OREA 2W7VA 3H0GC 5IYCC 2RGRA 4G0UA 2R92K 3RZOK 4A3DK 3GTQK 2ZFZA 4Y52C 1JVIA 5M3MK 5IYDC 1VRQC 2FQTA 1C0AA 3HOZC 1XPPA 5EGEA 4BY1K 2NVQC 1BDFA 3HOYC 3ADAC 1ZVUA 2E2HA 3HOVK 4PABA 4A3JK 2WB1D 1XXCA 1XZQA 1B4AA 1XZQB 4A3CC 3S1RK 3N0BA 3RZDK 3GTMA 3QX3A 3H3VL 3PO2C 2Y0SD 3M4OK 3HOXK 2R7ZC 3TFHA 2WB1L 5TMFA 4WJ4A 2R92A 2R93C 4QIWD 1GE9A 1J6WA 1Y1WC 1I6HK 3HOUC 1JQWA 1TWHK 3GTOK 4G0VA 1O2BA 4AYBD 1WQGA 5CHPA 3GTGC 2Y0SL 3H0GK 5IYCK 4BLBA 3GTKC 2JH3A 1PJ7A 4Y52K 3GTLC 5IYDK 1IW7A 4QIWL 2WAQD 1INNA 1O26A 1DD5A 4KMDA 3HOZK 1EK8A 1VLOA 1HI9A 2NVQK 4A3EC 3HOYK 3OEPA 1PJ5A 3S1NC 1IE0A 4G0WA 4BXXC 5IP7C 2WAQL 5IOTA 4A3CK 5JVOA 5C3EC 1WOOA 3A8KA 1I3QA 3PO2K 1L0WA 3GTOA 3WODA 2R7ZK 3CAGA 1B4BA 1J6VA 3H0GA 1V5VA 2JA8K 2R93K 4KN4A 1Y1WK 1UV7A 3HOUK 4BBSC 2B63K 1I6VA 3A8IA 3GEIA 4NOIA 5M3FK 3OPFA 3GTGK 2E2JC 3LAPA 3GTKK 3GTLK 5C4XC 1IBAA 5FLMC 1ISEA 2XCOA 4QJVA 4A3EK 4C3IC 1VGXA 3S1NK 4QJVB 4C3HC 4BXXK 3AD8C 2R7ZA 5IP7K 2GSNA 3AQPA 3S14C 4C2MC 2R93A 5C3EK 5L46A 3GTJC 4GTCA 4P5BA 5E68A 3VA7A 5IORA 4OIQA 3GTGA 3S2HC 3GTKA 1YX2A 3GTLA 4P5AA 4BBSK 4WJ3M 1F9NA 4A93C 5IP9C 1JOEA 1WSRA 2E2JK 4G7OA 3L4KA 1TWCC 5C4XK 3BP3A 1SMYA 3FHZA 2NVXC 5HL8A
chains in the Genus database with same CATH topology
1Y1WA 2CFAA 1GE9A 3CQZA 5CJ9A 2B63A 2CFAB 2PHCB 3FOFA 4G0VA 1O2BA 1BGWA 2VUMA 1WQGA 5CHPA 1EH1A 4KM8A 2XCQA 4KATA 4BLBA 2JH3A 5EGHA 4KM9A 4M1XA 2JA5A 4KASA 4GFQA 1O26A 1DD5A 4ILDA 4KMDA 1I50A 1EK8A 4DDQA 1O25A 3L4JA 3OEPA 3FOEA 1WQFA 3LPXA 5TJ3A 4FM9A 1WQHA 3GTQA 1O29A 4G0WA 3GTPA 4BKWA 4GTFA 5IOTA 5JVOA 4GT9A 4KARA 3AQOA 4BLAA 4KDDA 4GTLA 4LR2A 2RH6A 1I3QA 3GTOA 2JA6A 3FKIA 3CAGA 1XXBA 1B4BA 4KB4A 4KMHA 3H0GA 1O2AA 1TWAA 4KAWX 3GTJA 2GSOA 4KC6A 3OPFA 3G4CA 1WCMA 2JA7A 1WIHA 3LAPA 4FZBA 3NUHA 1O27A 2YU9A 1KQ4A 1O28A 1R9TA 3Q3QA 5JFEA 1ISEA 1TWHA 2XCOA 4KB2A 2NVYA 4GTDA 4C3IC 3V4GA 5IOQA 3OREA 1TWCA 2XCRB 4G0UA 2RGRA 4C3HC 2Y3PA 5IOSA 2R7ZA 1TWFA 2ZFZA 4GTBA 3BUEA 2GSNA 2NVXA 3AQPA 2R93A 1IS1A 4C2MC 3LAJA 3N0CA 3S0XA 4GTCA 1TWGA 4P5BA 3VA7A 1ZBSA 4GTEA 3G4AA 5EGEA 5IORA 4GTAA 3MMLB 4C3JC 2GSUA 1AB4A 3ERED 3GTGA 1ZVUA 2E2HA 3GTKA 4KMAA 1XXCA 1ZXOA 3N3YA 4P5AA 3GTLA 1K83A 1B4AA 1F9NA 4LQYA 1XXAA 2E2IA 1O24A 1SFOA 4J3NA 3N0BA 3GTMA 3QX3A 3L4KA 1Y1VA 2KWAA 1BJTA 3AH5A 2P5MA 3FHZA 2R92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1X A; 
#chains in the Genus database with same CATH topology
 5FLM K;  4XSX A;  1PJ6 A;  1TWG C;  3H3V D;  3FOF A;  4C3I K;  4Y7N C;  2A6H A;  4KM8 A;  4C3H K;  4BY7 C;  5EGH A;  4LOW A;  5C44 C;  1K83 C;  2O5J A;  3S14 K;  4C2M K;  4KAS A;  3AD9 C;  3GTJ K;  1SFO C;  4DDQ A;  1O25 A;  1Y1V C;  3M3Y C;  2NVT C;  3S2H K;  3LPX A;  5FJ8 K;  2JA8 C;  3GTQ A;  1WOS A;  4MQ9 A;  3CQZ C;  2B63 C;  3HOW C;  3GTP C;  4KMU A;  4A93 K;  4LK0 A;  5IP9 K;  4BKW A;  1VH2 A;  4BLA A;  4A3K C;  4KDD A;  3HKZ D;  2RH6 A;  1TWC K;  4KMH A;  3S16 C;  2A6E A;  2NVX K;  2GAH C;  2JA5 C;  1O2A A;  1WSV A;  1IQ0 A;  2EBB A;  1TWG K;  1I50 C;  1TWA C;  3GTJ A;  2GSO A;  4A3F C;  4Y7N K;  3HKZ L;  3SZZ A;  4FZB A;  3NUH A;  1O27 A;  4BY7 K;  2YU9 C;  5C44 K;  1K83 K;  2A68 A;  1XZP A;  1F7U A;  1F93 A;  3GEH A;  1SFO K;  1XZP B;  3Q3Q A;  5JFE A;  1TWH A;  3GIR A;  4A3M C;  1Y1V K;  4XLP A;  3M3Y K;  3FKI C;  4P9S A;  2NVT K;  4A3B C;  1TWC A;  2Y3P A;  4OIP A;  5IOS A;  3CQZ K;  3HOW K;  3GTP K;  2BE5 A;  2NVX A;  1IS1 A;  1O2F B;  3LAJ A;  1DCP A;  3N0C A;  3S0X A;  1TWG A;  4A3K K;  1WCM C;  4WIL A;  1ZBS A;  2JA7 C;  4GTE A;  3G4A A;  4A3G C;  2GSU A;  3ERE D;  4PAA A;  4OIR A;  3S16 K;  4KMA A;  1ZYR A;  3N3Y A;  1ZXO A;  1YNJ A;  2JA5 K;  1K83 A;  5M5X K;  1R9T C;  1I50 K;  1TWA K;  1O24 A;  4A3F K;  1SFO A;  3S1M C;  4J3N A;  1USO A;  2NVY C;  2FQO A;  1DCO A;  1WOP A;  3GTM C;  3DXJ A;  1Y1V A;  2YU9 K;  2KWA A;  3AH5 A;  4O2D A;  1TWF C;  4RMF A;  4XCH A;  2P5M A;  1Y1W A;  2CFA A;  3S1Q C;  3CQZ A;  5CJ9 A;  2B63 A;  2CFA B;  4XSZ A;  4A3M K;  3FKI K;  3S2D C;  4A3B K;  5M5W K;  4OIO A;  2V6U A;  4M1X A;  3GEE A;  2E2I C;  2JA5 A;  4GFQ A;  4YFX A;  1WCM K;  4X6A C;  2JA7 K;  1I50 A;  4A3G K;  3TFJ A;  2ZUF A;  3AD7 C;  1WQF A;  1O29 A;  1R9T K;  1EFW A;  4GTF A;  3S15 C;  3S1M K;  4YG2 A;  2NVY K;  3AQO A;  2PPB A;  2VUM C;  1BS2 A;  3GTM K;  4GTL A;  4LR2 A;  1I3Q C;  2A69 A;  3FKI A;  1TWF K;  1XXB A;  2GAG C;  4KB4 A;  3I4N C;  3S1Q K;  3PO3 C;  1HQM A;  4MEY A;  4KAW X;  3BP8 C;  3TFI A;  4KC6 A;  4LLG A;  3G4C A;  3S2D K;  1WCM A;  2JA7 A;  1WIH A;  3GSI A;  1KQ4 A;  4MEX A;  4Q5S A;  1O28 A;  2E2I K;  1USM A;  3A8J A;  5IYB C;  1X31 C;  4X6A K;  1R9T A;  4KB2 A;  2NVY A;  4GTD A;  5C4J K;  2JA6 C;  1VJE A;  3V4G A;  5IOQ A;  2XCR B;  3K7A C;  1TWF A;  4GTB A;  3BUE A;  3S15 K;  4OIN A;  3S17 C;  2VUM K;  4A3L C;  4C45 A;  1I3Q K;  4GTA A;  4LJZ A;  5TMC A;  3MML B;  2CW0 A;  4C3J C;  1AB4 A;  1F7V A;  3I4N K;  5D4D A;  1J6X A;  3PO3 K;  1YCL A;  3IPJ A;  4LQY A;  1XXA A;  1YNN A;  2E2I A;  2PA8 D;  3SZY A;  1WOR A;  2V6S A;  2PMZ D;  4AYB L;  4BBR C;  4G7Z A;  1BJT A;  1DCH A;  2P8T A;  3TTG A;  3T00 A;  5IYB K;  4YFN A;  3GDZ A;  2PA8 L;  3T02 A;  2PHC B;  2JA6 K;  1EQR A;  1BGW A;  2VUM A;  1EH1 A;  2XCQ A;  4KAT A;  1RU0 A;  2PMZ L;  2E2H C;  3K7A K;  4LK1 A;  4KM9 A;  3S17 K;  4KN7 A;  4G7H A;  4ILD A;  4A3L K;  3EQL A;  1EI6 A;  2O5I A;  3L4J A;  4C3J K;  5M5Y K;  3I4M C;  3FOE A;  2D6F C;  4Q4Z A;  4A3I C;  5TJ3 A;  4FM9 A;  1WQH A;  3RZO C;  4A3D C;  2R92 C;  3GTQ C;  2ZUE A;  3GTP A;  3T01 A;  4GZY A;  4GT9 A;  3HXA A;  4KAR A;  1G51 A;  1IL2 A;  1J98 A;  4AH6 A;  2JA6 A;  4BBR K;  4BY1 C;  4YFK A;  3JST A;  3HOV C;  4A3J C;  4XLN A;  1ZQ1 C;  1TWA A;  5C4J C;  3S1R C;  3RZD C;  4JK1 A;  2E2H K;  2YU9 A;  3M4O C;  3HOX C;  2V6T A;  4ZH4 A;  1I6H C;  1TWH C;  3GTO C;  3I4M K;  4A3I K;  3ORE A;  2W7V A;  3H0G C;  5IYC C;  2RGR A;  4G0U A;  2R92 K;  3RZO K;  4A3D K;  3GTQ K;  2ZFZ A;  4Y52 C;  1JVI A;  5M3M K;  5IYD C;  1VRQ C;  2FQT A;  1C0A A;  3HOZ C;  1XPP A;  5EGE A;  4BY1 K;  2NVQ C;  1BDF A;  3HOY C;  3ADA C;  1ZVU A;  2E2H A;  3HOV K;  4PAB A;  4A3J K;  2WB1 D;  1XXC A;  1XZQ A;  1B4A A;  1XZQ B;  4A3C C;  3S1R K;  3N0B A;  3RZD K;  3GTM A;  3QX3 A;  3H3V L;  3PO2 C;  2Y0S D;  3M4O K;  3HOX K;  2R7Z C;  3TFH A;  2WB1 L;  5TMF A;  4WJ4 A;  2R92 A;  2R93 C;  4QIW D;  1GE9 A;  1J6W A;  1Y1W C;  1I6H K;  3HOU C;  1JQW A;  1TWH K;  3GTO K;  4G0V A;  1O2B A;  4AYB D;  1WQG A;  5CHP A;  3GTG C;  2Y0S L;  3H0G K;  5IYC K;  4BLB A;  3GTK C;  2JH3 A;  1PJ7 A;  4Y52 K;  3GTL C;  5IYD K;  1IW7 A;  4QIW L;  2WAQ D;  1INN A;  1O26 A;  1DD5 A;  4KMD A;  3HOZ K;  1EK8 A;  1VLO A;  1HI9 A;  2NVQ K;  4A3E C;  3HOY K;  3OEP A;  1PJ5 A;  3S1N C;  1IE0 A;  4G0W A;  4BXX C;  5IP7 C;  2WAQ L;  5IOT A;  4A3C K;  5JVO A;  5C3E C;  1WOO A;  3A8K A;  1I3Q A;  3PO2 K;  1L0W A;  3GTO A;  3WOD A;  2R7Z K;  3CAG A;  1B4B A;  1J6V A;  3H0G A;  1V5V A;  2JA8 K;  2R93 K;  4KN4 A;  1Y1W K;  1UV7 A;  3HOU K;  4BBS C;  2B63 K;  1I6V A;  3A8I A;  3GEI A;  4NOI A;  5M3F K;  3OPF A;  3GTG K;  2E2J C;  3LAP A;  3GTK K;  3GTL K;  5C4X C;  1IBA A;  5FLM C;  1ISE A;  2XCO A;  4QJV A;  4A3E K;  4C3I C;  1VGX A;  3S1N K;  4QJV B;  4C3H C;  4BXX K;  3AD8 C;  2R7Z A;  5IP7 K;  2GSN A;  3AQP A;  3S14 C;  4C2M C;  2R93 A;  5C3E K;  5L46 A;  3GTJ C;  4GTC A;  4P5B A;  5E68 A;  3VA7 A;  5IOR A;  4OIQ A;  3GTG A;  3S2H C;  3GTK A;  1YX2 A;  3GTL A;  4P5A A;  4BBS K;  4WJ3 M;  1F9N A;  4A93 C;  5IP9 C;  1JOE A;  1WSR A;  2E2J K;  4G7O A;  3L4K A;  1TWC C;  5C4X K;  3BP3 A;  1SMY A;  3FHZ A;  2NVX C;  5HL8 A; 
#chains in the Genus database with same CATH homology
 1Y1W A;  2CFA A;  1GE9 A;  3CQZ A;  5CJ9 A;  2B63 A;  2CFA B;  2PHC B;  3FOF A;  4G0V A;  1O2B A;  1BGW A;  2VUM A;  1WQG A;  5CHP A;  1EH1 A;  4KM8 A;  2XCQ A;  4KAT A;  4BLB A;  2JH3 A;  5EGH A;  4KM9 A;  4M1X A;  2JA5 A;  4KAS A;  4GFQ A;  1O26 A;  1DD5 A;  4ILD A;  4KMD A;  1I50 A;  1EK8 A;  4DDQ A;  1O25 A;  3L4J A;  3OEP A;  3FOE A;  1WQF A;  3LPX A;  5TJ3 A;  4FM9 A;  1WQH A;  3GTQ A;  1O29 A;  4G0W A;  3GTP A;  4BKW A;  4GTF A;  5IOT A;  5JVO A;  4GT9 A;  4KAR A;  3AQO A;  4BLA A;  4KDD A;  4GTL A;  4LR2 A;  2RH6 A;  1I3Q A;  3GTO A;  2JA6 A;  3FKI A;  3CAG A;  1XXB A;  1B4B A;  4KB4 A;  4KMH A;  3H0G A;  1O2A A;  1TWA A;  4KAW X;  3GTJ A;  2GSO A;  4KC6 A;  3OPF A;  3G4C A;  1WCM A;  2JA7 A;  1WIH A;  3LAP A;  4FZB A;  3NUH A;  1O27 A;  2YU9 A;  1KQ4 A;  1O28 A;  1R9T A;  3Q3Q A;  5JFE A;  1ISE A;  1TWH A;  2XCO A;  4KB2 A;  2NVY A;  4GTD A;  4C3I C;  3V4G A;  5IOQ A;  3ORE A;  1TWC A;  2XCR B;  4G0U A;  2RGR A;  4C3H C;  2Y3P A;  5IOS A;  2R7Z A;  1TWF A;  2ZFZ A;  4GTB A;  3BUE A;  2GSN A;  2NVX A;  3AQP A;  2R93 A;  1IS1 A;  4C2M C;  3LAJ A;  3N0C A;  3S0X A;  4GTC A;  1TWG A;  4P5B A;  3VA7 A;  1ZBS A;  4GTE A;  3G4A A;  5EGE A;  5IOR A;  4GTA A;  3MML B;  4C3J C;  2GSU A;  1AB4 A;  3ERE D;  3GTG A;  1ZVU A;  2E2H A;  3GTK A;  4KMA A;  1XXC A;  1ZXO A;  3N3Y A;  4P5A A;  3GTL A;  1K83 A;  1B4A A;  1F9N A;  4LQY A;  1XXA A;  2E2I A;  1O24 A;  1SFO A;  4J3N A;  3N0B A;  3GTM A;  3QX3 A;  3L4K A;  1Y1V A;  2KWA A;  1BJT A;  3AH5 A;  2P5M A;  3FHZ A;  2R92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...