4KASA

Crystal structure of fdts from t. maritima mutant (h53d) with fad and dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 80
structure length 213
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kasA00
5IOQA 4GTFA 4GT9A 4P5AA 1O29A 4GTEA 4KASA 3AH5A 4GTLA 4GTDA 1O2BA 1O26A 4GTCA 4KARA 4FZBA 3N3YA 1O27A 3G4CA 4KATA 5IOSA 3N0BA 1O25A 5IORA 1O28A 4P5BA 4GTBA 5CHPA 1KQ4A 2CFAB 4GTAA 3N0CA 5JFEA 2CFAA 1O2AA 5IOTA 3G4AA 1O24A
chains in the Genus database with same CATH superfamily
3HOVK 3HKZD 1ISEA 3SZYA 4Y52C 1YX2A 4A3JK 1ZXOA 3S2DC 5HL8A 1DD5A 1TWAC 4DDQA 3HOWK 1WQGA 4OIQA 1WOSA 3PO3K 2O5JA 1O28A 5C44C 4QIWL 2A69A 3GTMA 3S1NK 3S2DK 2YU9C 1XZQA 1O24A 2NVTK 5IYBC 4P5AA 3GTJK 2NVXA 4G0UA 5M3FK 4KM9A 1EQRA 1WSRA 1XZQB 2A6EA 4LK0A 2WB1D 3GEHA 4GTDA 4A3CK 3S14K 3AD9C 2NVXC 3S16C 4Q5SA 4BLBA 5M5YK 4WJ3M 3CAGA 2JA7K 2VUMK 1IS1A 1TWHK 3QX3A 3I4NK 5TMCA 3GTPA 5M5XK 4A3DK 4BBRK 4C3IK 1TWFA 2E2IC 2FQTA 5JFEA 5CJ9A 2JA6K 1GE9A 1WSVA 4A93K 4C3IC 2E2IK 4KATA 4BBSK 4KDDA 1EI6A 1B4BA 4BKWA 3S1QC 5C4XK 3Q3QA 1YCLA 4A3FC 3TFIA 4KMUA 1ZVUA 1V5VA 1Y1WA 2NVYC 1DCPA 3FHZA 2E2JK 3GTGK 3ERED 1O29A 4KC6A 1TWGK 2RGRA 3PO2C 1WCMK 2PHCB 1O2BA 3FKIC 2EBBA 1IBAA 3HOXC 4P9SA 2D6FC 1VH2A 4AYBD 4QJVA 5CHPA 1KQ4A 3PO3C 3HOYC 2NVQC 2GSOA 3GTKK 3A8JA 4YFXA 2V6UA 2CFAA 1HQMA 4BY7K 1USOA 4A3MC 4GTFA 4GT9A 3I4MK 1BS2A 2P8TA 3FOFA 1I50K 1YNNA 2PA8L 4A3IC 2R92A 1I6HC 3AD7C 3GSIA 2E2HA 1Y1VK 5C3EC 3T00A 1JOEA 4AYBL 5IP7K 3GTMC 3BUEA 2B63K 3M4OK 1XPPA 4BXXK 1VGXA 2Y3PA 2ZUFA 3H0GC 1ZBSA 1JVIA 1Y1VC 5EGHA 1F9NA 3L4KA 4A3IK 4C2MC 5M3MK 2JA8C 4WILA 3BP8C 3K7AK 4KARA 2PPBA 3AQPA 3EQLA 5IYDC 2NVQK 4G0VA 5E68A 3G4CA 3GTLK 2Y0SD 4JK1A 3A8KA 3T02A 1O25A 1VLOA 1BDFA 4AH6A 2XCQA 2E2HC 1PJ6A 1PJ5A 5FLMK 3VA7A 4Y7NC 3OPFA 4X6AC 2JA5A 1Y1WC 3S0XA 3RZOK 2JA6A 4GZYA 3GEIA 1ZYRA 3DXJA 1R9TC 2B63A 2FQOA 4XCHA 2PMZD 1Y1WK 3S1RC 1WIHA 4X6AK 1WOPA 5M5WK 4A3FK 5FLMC 1AB4A 5C4XC 1F7UA 3S17K 4BBSC 2GAGC 2CFAB 4C3HK 4LJZA 3GTQK 4A3KK 4A3LK 3S15C 2BE5A 4KM8A 3K7AC 1I3QC 4G7ZA 3GEEA 1DCOA 1SMYA 4GTEA 4PABA 4GTLA 2JA8K 4LQYA 4BBRC 4OIRA 3ADAC 1WCMA 3GTJA 1XXAA 2A6HA 3IPJA 1RU0A 3GTPK 2VUMC 3GDZA 2PA8D 3H0GK 4O2DA 4G7HA 4PAAA 3GTMK 4A3CC 1Y1VA 5C3EK 2R93K 4J3NA 3GTKA 1VJEA 1I50C 2WAQD 2NVTC 3I4MC 4A3BC 2R7ZC 4A3MK 2R92C 4KASA 3AH5A 4KAWX 2E2IA 4LOWA 4QJVB 3S1NC 1XZPB 4KB2A 1VRQC 4BY1C 1J6VA 1HI9A 5C44K 4KMAA 3V4GA 4A3EC 3HOYK 4FM9A 3GTQA 4BLAA 3FOEA 4XSZA 1C0AA 3HXAA 3AD8C 4C3JC 4A3EK 3HOXK 4BY1K 1X31C 3HOWC 4GTAA 3FKIK 4XSXA 2R92K 5IOTA 3TTGA 3HOUK 1XXCA 1TWGC 3H3VL 1UV7A 1ZQ1C 2E2JC 2YU9A 2ZFZA 3RZDC 3A8IA 5TMFA 2V6TA 1SFOC 4ILDA 1WQHA 3OEPA 1TWFC 4YFNA 3HKZL 2RH6A 5IORA 4LK1A 1SFOA 3GTPC 3S1QK 1F93A 4KN4A 3LAJA 3N0CA 4A93C 1XXBA 3G4AA 3JSTA 3OREA 2WAQL 3GIRA 2JA6C 2CW0A 3GTOK 2JH3A 3GTOC 3S15K 1YNJA 4A3LC 4GTCA 3GTQC 1BGWA 4FZBA 3S2HC 4XLPA 4G0WA 3S17C 1TWHA 2WB1L 3I4NC 2R7ZA 2JA7A 1PJ7A 5JVOA 2JA7C 2W7VA 2A68A 3CQZC 3S1RK 1G51A 3S16K 3HOZC 4GFQA 3S14C 1SFOK 1IQ0A 4QIWD 3GTJC 5IYBK 3HOUC 2YU9K 4MEYA 3N3YA 1O27A 3LPXA 2GSUA 2E2HK 3N0BA 3SZZA 4C3JK 4A3GC 4P5BA 1J6WA 3GTLC 5FJ8K 1TWAK 4ZH4A 2R7ZK 1J98A 3BP3A 4A3JC 4LLGA 4A3BK 1IW7A 4M1XA 4Y52K 5TJ3A 5C4JK 3HOVC 3WODA 2Y0SL 3LAPA 3L4JA 2R93C 2P5MA 4BXXC 5IYCK 4KB4A 2B63C 3M4OC 1F7VA 3FKIA 4LR2A 1K83A 4XLNA 4RMFA 2V6SA 2XCRB 3NUHA 5C4JC 4KMHA 2JA5C 1IE0A 1I3QK 2NVYA 1O2FB 4NOIA 1I6VA 3TFHA 4BY7C 1USMA 2PMZL 3S1MK 1I50A 1K83C 1B4AA 3GTKC 4A3KC 1BJTA 4G7OA 4C3HC 1XZPA 1J6XA 4A3GK 5D4DA 1L0WA 5IP9C 2R93A 1TWCK 2ZUEA 2VUMA 4MEXA 3T01A 1WCMC 3PO2K 1O2AA 3H0GA 3M3YK 5IOQA 1TWCA 3GTGC 4YFKA 2XCOA 1R9TK 2O5IA 2NVYK 1I3QA 1INNA 3RZOC 4C45A 1EH1A 4Q4ZA 3HOZK 3M3YC 3CQZK 4Y7NK 3AQOA 3GTLA 3GTGA 1DCHA 1EFWA 1TWCC 5IP9K 4GTBA 3S2HK 5L46A 4MQ9A 4YG2A 1JQWA 3TFJA 1WQFA 5IYDK 4KMDA 1K83K 3S1MC 3H3VD 1R9TA 4WJ4A 4OIOA 1EK8A 2JA5K 3CQZA 1O26A 4C2MK 1WORA 1WOOA 1IL2A 4A3DC 4KN7A 5IOSA 4OINA 1TWHC 2GAHC 5IYCC 1TWFK 2NVXK 2GSNA 1TWAA 5IP7C 1TWGA 3RZDK 2KWAA 1I6HK 3MMLB 5EGEA 3GTOA 4OIPA
chains in the Genus database with same CATH topology
4GTFA 4GT9A 1ISEA 4M1XA 3FOFA 5TJ3A 1ZXOA 4KASA 3AH5A 4KAWX 1DD5A 2E2IA 2R92A 4DDQA 1WQGA 3LAPA 4KB2A 3L4JA 2E2HA 4KMAA 3V4GA 3BUEA 4FM9A 2P5MA 3GTQA 4BLAA 3FOEA 2Y3PA 4KB4A 1O28A 1ZBSA 4C3JC 3FKIA 4LR2A 5EGHA 1K83A 3GTMA 4GTAA 1F9NA 3L4KA 4C2MC 5IOTA 2XCRB 3NUHA 4KMHA 1O24A 1XXCA 4P5AA 2NVXA 2NVYA 2YU9A 4G0UA 4KM9A 2ZFZA 4GTDA 4KARA 1I50A 4ILDA 1B4AA 3AQPA 1BJTA 1WQHA 3OEPA 4G0VA 3G4CA 4C3HC 2RH6A 4BLBA 1O25A 5IORA 3CAGA 1SFOA 1IS1A 2XCQA 3QX3A 3GTPA 2R93A 3LAJA 2VUMA 3N0CA 1TWFA 3VA7A 3OPFA 5JFEA 2JA5A 1O2AA 3H0GA 1XXBA 3S0XA 3G4AA 3OREA 5IOQA 2JA6A 1TWCA 5CJ9A 2XCOA 2JH3A 1I3QA 2B63A 1GE9A 4GTCA 1EH1A 1BGWA 4FZBA 1WIHA 3AQOA 3GTLA 4C3IC 4KATA 3GTGA 4KDDA 4G0WA 1AB4A 1B4BA 1TWHA 4BKWA 2R7ZA 3Q3QA 2JA7A 5JVOA 4GTBA 2CFAB 1ZVUA 1WQFA 4GFQA 4KMDA 1Y1WA 4KM8A 3FHZA 3ERED 1R9TA 1O29A 4KC6A 4GTEA 2RGRA 2PHCB 4GTLA 1EK8A 1O2BA 1O26A 3CQZA 4LQYA 3N3YA 1WCMA 1O27A 3LPXA 2GSUA 1XXAA 3GTJA 5IOSA 3N0BA 4P5BA 5CHPA 1KQ4A 2GSNA 1TWAA 2GSOA 1Y1VA 1TWGA 4J3NA 2KWAA 2CFAA 3MMLB 5EGEA 3GTKA 3GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOQ A;  4GTF A;  4GT9 A;  4P5A A;  1O29 A;  4GTE A;  4KAS A;  3AH5 A;  4GTL A;  4GTD A;  1O2B A;  1O26 A;  4GTC A;  4KAR A;  4FZB A;  3N3Y A;  1O27 A;  3G4C A;  4KAT A;  5IOS A;  3N0B A;  1O25 A;  5IOR A;  1O28 A;  4P5B A;  4GTB A;  5CHP A;  1KQ4 A;  2CFA B;  4GTA A;  3N0C A;  5JFE A;  2CFA A;  1O2A A;  5IOT A;  3G4A A;  1O24 A; 
#chains in the Genus database with same CATH topology
 3HOV K;  3HKZ D;  1ISE A;  3SZY A;  4Y52 C;  1YX2 A;  4A3J K;  1ZXO A;  3S2D C;  5HL8 A;  1DD5 A;  1TWA C;  4DDQ A;  3HOW K;  1WQG A;  4OIQ A;  1WOS A;  3PO3 K;  2O5J A;  1O28 A;  5C44 C;  4QIW L;  2A69 A;  3GTM A;  3S1N K;  3S2D K;  2YU9 C;  1XZQ A;  1O24 A;  2NVT K;  5IYB C;  4P5A A;  3GTJ K;  2NVX A;  4G0U A;  5M3F K;  4KM9 A;  1EQR A;  1WSR A;  1XZQ B;  2A6E A;  4LK0 A;  2WB1 D;  3GEH A;  4GTD A;  4A3C K;  3S14 K;  3AD9 C;  2NVX C;  3S16 C;  4Q5S A;  4BLB A;  5M5Y K;  4WJ3 M;  3CAG A;  2JA7 K;  2VUM K;  1IS1 A;  1TWH K;  3QX3 A;  3I4N K;  5TMC A;  3GTP A;  5M5X K;  4A3D K;  4BBR K;  4C3I K;  1TWF A;  2E2I C;  2FQT A;  5JFE A;  5CJ9 A;  2JA6 K;  1GE9 A;  1WSV A;  4A93 K;  4C3I C;  2E2I K;  4KAT A;  4BBS K;  4KDD A;  1EI6 A;  1B4B A;  4BKW A;  3S1Q C;  5C4X K;  3Q3Q A;  1YCL A;  4A3F C;  3TFI A;  4KMU A;  1ZVU A;  1V5V A;  1Y1W A;  2NVY C;  1DCP A;  3FHZ A;  2E2J K;  3GTG K;  3ERE D;  1O29 A;  4KC6 A;  1TWG K;  2RGR A;  3PO2 C;  1WCM K;  2PHC B;  1O2B A;  3FKI C;  2EBB A;  1IBA A;  3HOX C;  4P9S A;  2D6F C;  1VH2 A;  4AYB D;  4QJV A;  5CHP A;  1KQ4 A;  3PO3 C;  3HOY C;  2NVQ C;  2GSO A;  3GTK K;  3A8J A;  4YFX A;  2V6U A;  2CFA A;  1HQM A;  4BY7 K;  1USO A;  4A3M C;  4GTF A;  4GT9 A;  3I4M K;  1BS2 A;  2P8T A;  3FOF A;  1I50 K;  1YNN A;  2PA8 L;  4A3I C;  2R92 A;  1I6H C;  3AD7 C;  3GSI A;  2E2H A;  1Y1V K;  5C3E C;  3T00 A;  1JOE A;  4AYB L;  5IP7 K;  3GTM C;  3BUE A;  2B63 K;  3M4O K;  1XPP A;  4BXX K;  1VGX A;  2Y3P A;  2ZUF A;  3H0G C;  1ZBS A;  1JVI A;  1Y1V C;  5EGH A;  1F9N A;  3L4K A;  4A3I K;  4C2M C;  5M3M K;  2JA8 C;  4WIL A;  3BP8 C;  3K7A K;  4KAR A;  2PPB A;  3AQP A;  3EQL A;  5IYD C;  2NVQ K;  4G0V A;  5E68 A;  3G4C A;  3GTL K;  2Y0S D;  4JK1 A;  3A8K A;  3T02 A;  1O25 A;  1VLO A;  1BDF A;  4AH6 A;  2XCQ A;  2E2H C;  1PJ6 A;  1PJ5 A;  5FLM K;  3VA7 A;  4Y7N C;  3OPF A;  4X6A C;  2JA5 A;  1Y1W C;  3S0X A;  3RZO K;  2JA6 A;  4GZY A;  3GEI A;  1ZYR A;  3DXJ A;  1R9T C;  2B63 A;  2FQO A;  4XCH A;  2PMZ D;  1Y1W K;  3S1R C;  1WIH A;  4X6A K;  1WOP A;  5M5W K;  4A3F K;  5FLM C;  1AB4 A;  5C4X C;  1F7U A;  3S17 K;  4BBS C;  2GAG C;  2CFA B;  4C3H K;  4LJZ A;  3GTQ K;  4A3K K;  4A3L K;  3S15 C;  2BE5 A;  4KM8 A;  3K7A C;  1I3Q C;  4G7Z A;  3GEE A;  1DCO A;  1SMY A;  4GTE A;  4PAB A;  4GTL A;  2JA8 K;  4LQY A;  4BBR C;  4OIR A;  3ADA C;  1WCM A;  3GTJ A;  1XXA A;  2A6H A;  3IPJ A;  1RU0 A;  3GTP K;  2VUM C;  3GDZ A;  2PA8 D;  3H0G K;  4O2D A;  4G7H A;  4PAA A;  3GTM K;  4A3C C;  1Y1V A;  5C3E K;  2R93 K;  4J3N A;  3GTK A;  1VJE A;  1I50 C;  2WAQ D;  2NVT C;  3I4M C;  4A3B C;  2R7Z C;  4A3M K;  2R92 C;  4KAS A;  3AH5 A;  4KAW X;  2E2I A;  4LOW A;  4QJV B;  3S1N C;  1XZP B;  4KB2 A;  1VRQ C;  4BY1 C;  1J6V A;  1HI9 A;  5C44 K;  4KMA A;  3V4G A;  4A3E C;  3HOY K;  4FM9 A;  3GTQ A;  4BLA A;  3FOE A;  4XSZ A;  1C0A A;  3HXA A;  3AD8 C;  4C3J C;  4A3E K;  3HOX K;  4BY1 K;  1X31 C;  3HOW C;  4GTA A;  3FKI K;  4XSX A;  2R92 K;  5IOT A;  3TTG A;  3HOU K;  1XXC A;  1TWG C;  3H3V L;  1UV7 A;  1ZQ1 C;  2E2J C;  2YU9 A;  2ZFZ A;  3RZD C;  3A8I A;  5TMF A;  2V6T A;  1SFO C;  4ILD A;  1WQH A;  3OEP A;  1TWF C;  4YFN A;  3HKZ L;  2RH6 A;  5IOR A;  4LK1 A;  1SFO A;  3GTP C;  3S1Q K;  1F93 A;  4KN4 A;  3LAJ A;  3N0C A;  4A93 C;  1XXB A;  3G4A A;  3JST A;  3ORE A;  2WAQ L;  3GIR A;  2JA6 C;  2CW0 A;  3GTO K;  2JH3 A;  3GTO C;  3S15 K;  1YNJ A;  4A3L C;  4GTC A;  3GTQ C;  1BGW A;  4FZB A;  3S2H C;  4XLP A;  4G0W A;  3S17 C;  1TWH A;  2WB1 L;  3I4N C;  2R7Z A;  2JA7 A;  1PJ7 A;  5JVO A;  2JA7 C;  2W7V A;  2A68 A;  3CQZ C;  3S1R K;  1G51 A;  3S16 K;  3HOZ C;  4GFQ A;  3S14 C;  1SFO K;  1IQ0 A;  4QIW D;  3GTJ C;  5IYB K;  3HOU C;  2YU9 K;  4MEY A;  3N3Y A;  1O27 A;  3LPX A;  2GSU A;  2E2H K;  3N0B A;  3SZZ A;  4C3J K;  4A3G C;  4P5B A;  1J6W A;  3GTL C;  5FJ8 K;  1TWA K;  4ZH4 A;  2R7Z K;  1J98 A;  3BP3 A;  4A3J C;  4LLG A;  4A3B K;  1IW7 A;  4M1X A;  4Y52 K;  5TJ3 A;  5C4J K;  3HOV C;  3WOD A;  2Y0S L;  3LAP A;  3L4J A;  2R93 C;  2P5M A;  4BXX C;  5IYC K;  4KB4 A;  2B63 C;  3M4O C;  1F7V A;  3FKI A;  4LR2 A;  1K83 A;  4XLN A;  4RMF A;  2V6S A;  2XCR B;  3NUH A;  5C4J C;  4KMH A;  2JA5 C;  1IE0 A;  1I3Q K;  2NVY A;  1O2F B;  4NOI A;  1I6V A;  3TFH A;  4BY7 C;  1USM A;  2PMZ L;  3S1M K;  1I50 A;  1K83 C;  1B4A A;  3GTK C;  4A3K C;  1BJT A;  4G7O A;  4C3H C;  1XZP A;  1J6X A;  4A3G K;  5D4D A;  1L0W A;  5IP9 C;  2R93 A;  1TWC K;  2ZUE A;  2VUM A;  4MEX A;  3T01 A;  1WCM C;  3PO2 K;  1O2A A;  3H0G A;  3M3Y K;  5IOQ A;  1TWC A;  3GTG C;  4YFK A;  2XCO A;  1R9T K;  2O5I A;  2NVY K;  1I3Q A;  1INN A;  3RZO C;  4C45 A;  1EH1 A;  4Q4Z A;  3HOZ K;  3M3Y C;  3CQZ K;  4Y7N K;  3AQO A;  3GTL A;  3GTG A;  1DCH A;  1EFW A;  1TWC C;  5IP9 K;  4GTB A;  3S2H K;  5L46 A;  4MQ9 A;  4YG2 A;  1JQW A;  3TFJ A;  1WQF A;  5IYD K;  4KMD A;  1K83 K;  3S1M C;  3H3V D;  1R9T A;  4WJ4 A;  4OIO A;  1EK8 A;  2JA5 K;  3CQZ A;  1O26 A;  4C2M K;  1WOR A;  1WOO A;  1IL2 A;  4A3D C;  4KN7 A;  5IOS A;  4OIN A;  1TWH C;  2GAH C;  5IYC C;  1TWF K;  2NVX K;  2GSN A;  1TWA A;  5IP7 C;  1TWG A;  3RZD K;  2KWA A;  1I6H K;  3MML B;  5EGE A;  3GTO A;  4OIP A; 
#chains in the Genus database with same CATH homology
 4GTF A;  4GT9 A;  1ISE A;  4M1X A;  3FOF A;  5TJ3 A;  1ZXO A;  4KAS A;  3AH5 A;  4KAW X;  1DD5 A;  2E2I A;  2R92 A;  4DDQ A;  1WQG A;  3LAP A;  4KB2 A;  3L4J A;  2E2H A;  4KMA A;  3V4G A;  3BUE A;  4FM9 A;  2P5M A;  3GTQ A;  4BLA A;  3FOE A;  2Y3P A;  4KB4 A;  1O28 A;  1ZBS A;  4C3J C;  3FKI A;  4LR2 A;  5EGH A;  1K83 A;  3GTM A;  4GTA A;  1F9N A;  3L4K A;  4C2M C;  5IOT A;  2XCR B;  3NUH A;  4KMH A;  1O24 A;  1XXC A;  4P5A A;  2NVX A;  2NVY A;  2YU9 A;  4G0U A;  4KM9 A;  2ZFZ A;  4GTD A;  4KAR A;  1I50 A;  4ILD A;  1B4A A;  3AQP A;  1BJT A;  1WQH A;  3OEP A;  4G0V A;  3G4C A;  4C3H C;  2RH6 A;  4BLB A;  1O25 A;  5IOR A;  3CAG A;  1SFO A;  1IS1 A;  2XCQ A;  3QX3 A;  3GTP A;  2R93 A;  3LAJ A;  2VUM A;  3N0C A;  1TWF A;  3VA7 A;  3OPF A;  5JFE A;  2JA5 A;  1O2A A;  3H0G A;  1XXB A;  3S0X A;  3G4A A;  3ORE A;  5IOQ A;  2JA6 A;  1TWC A;  5CJ9 A;  2XCO A;  2JH3 A;  1I3Q A;  2B63 A;  1GE9 A;  4GTC A;  1EH1 A;  1BGW A;  4FZB A;  1WIH A;  3AQO A;  3GTL A;  4C3I C;  4KAT A;  3GTG A;  4KDD A;  4G0W A;  1AB4 A;  1B4B A;  1TWH A;  4BKW A;  2R7Z A;  3Q3Q A;  2JA7 A;  5JVO A;  4GTB A;  2CFA B;  1ZVU A;  1WQF A;  4GFQ A;  4KMD A;  1Y1W A;  4KM8 A;  3FHZ A;  3ERE D;  1R9T A;  1O29 A;  4KC6 A;  4GTE A;  2RGR A;  2PHC B;  4GTL A;  1EK8 A;  1O2B A;  1O26 A;  3CQZ A;  4LQY A;  3N3Y A;  1WCM A;  1O27 A;  3LPX A;  2GSU A;  1XXA A;  3GTJ A;  5IOS A;  3N0B A;  4P5B A;  5CHP A;  1KQ4 A;  2GSN A;  1TWA A;  2GSO A;  1Y1V A;  1TWG A;  4J3N A;  2KWA A;  2CFA A;  3MML B;  5EGE A;  3GTK A;  3GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...