4KASA

Crystal structure of fdts from t. maritima mutant (h53d) with fad and dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 80
structure length 213
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kasA00
5IOTA 3N3YA 1KQ4A 5JFEA 4KATA 5IOSA 4GT9A 1O24A 1O27A 5IOQA 4P5BA 3N0BA 4GTAA 4GTEA 2CFAB 1O29A 2CFAA 4KASA 3G4CA 1O25A 4GTCA 3N0CA 5IORA 4GTFA 1O2AA 3AH5A 1O28A 4GTBA 1O2BA 4KARA 4GTLA 1O26A 4GTDA 4P5AA 3G4AA 4FZBA 5CHPA
chains in the Genus database with same CATH superfamily
1EK8A 3S1NC 4A3MK 3S2HK 4A3CC 2Y0SL 4Y7NK 3GTJC 1I6HC 4A3JK 5IOSA 3FKIC 4GT9A 3LAJA 1EQRA 3H3VL 3I4MK 4BBSC 4OIOA 1WCMA 2NVTC 2R7ZK 1TWGK 1USOA 4BBRC 4RMFA 3HOZC 1XPPA 5IORA 3GTKK 3HOUK 3AQOA 1O2BA 3FOEA 4QIWD 1VGXA 3NUHA 1AB4A 1IE0A 4C3JK 1J6XA 5IYBK 3GTMA 5JFEA 5M3FK 1IL2A 1BS2A 3RZDC 2ZUEA 4A3GC 3BP8C 3GIRA 3S1QC 3I4NK 1I50K 4A3BC 3GTOK 2Y0SD 3QX3A 4LK0A 4KC6A 3H3VD 4X6AK 3GTPA 1WQFA 2KWAA 4OINA 1Y1WK 4GTLA 5IYDK 3I4MC 2R93C 4FZBA 4WILA 1TWFA 5IP9C 2GAGC 3N3YA 1TWHC 5D4DA 4LOWA 4M1XA 4A3FK 1WIHA 1K83K 1ISEA 1USMA 2PMZL 4GTAA 2CFAB 3GDZA 1DCPA 2E2IK 5C4XK 3GTJA 2VUMK 2FQOA 3FKIA 4KB4A 2XCRB 5IYBC 4MQ9A 2JA6K 3TTGA 4KDDA 2PA8L 4OIRA 3GTGK 4G0VA 1C0AA 1R9TK 4KMAA 1JOEA 3I4NC 3V4GA 4KM8A 4LJZA 5EGEA 3GTOC 1WSRA 4ZH4A 4Q4ZA 4OIPA 4A3IK 3CQZC 5M5YK 1EH1A 4A3KK 1O29A 3SZYA 3GSIA 3S1RC 4GTCA 1BGWA 4YFKA 4AH6A 3FOFA 1BJTA 1O2AA 2R92K 1O26A 4GTDA 4G0UA 1SFOK 4J3NA 4C3IC 1TWAC 1ZXOA 3CAGA 5L46A 2VUMC 4KATA 3S16C 2R93A 3A8IA 5EGHA 1ZYRA 4P5BA 2NVQK 4LQYA 3M3YC 1TWHA 1R9TC 2JA5C 4KM9A 1VJEA 3S2DK 4A93K 4QIWL 4BY1K 1J6WA 4C2MK 3GTLC 2GSOA 2WAQD 5C3EC 1YCLA 4MEYA 1B4BA 2ZUFA 3PO3K 2JA7K 2E2HC 5CHPA 4O2DA 3HKZD 2XCOA 3AD7C 3GEHA 5C44K 2NVXK 3S17K 1Y1VC 1O2FB 3HOXK 3HOYC 4G7OA 2O5JA 1J98A 3K7AC 2JA8K 4Y52K 1O24A 1O27A 2E2JK 2R92C 3GTOA 2NVYK 2RGRA 5M3MK 5FLMK 2BE5A 3HXAA 3GTQK 3S1MK 1I3QK 3CQZA 1WSVA 3H0GK 1ZQ1C 2YU9K 2B63K 3OPFA 4A3DK 4JK1A 3MMLB 4C3HC 1TWCK 4P9SA 4G0WA 1IW7A 1VRQC 1ZVUA 3IPJA 1TWAA 4XLNA 1WOOA 3VA7A 1DCHA 2VUMA 2CFAA 4BY7C 4A3MC 3S2HC 3AH5A 3HOXC 1EI6A 3T00A 2A68A 1R9TA 2JA5A 4Y7NC 4Y52C 4A3JC 1WQGA 3A8JA 3GTLA 2R7ZC 1TWGC 4GFQA 4FM9A 2V6TA 5TMFA 3LPXA 5FLMC 3GTQC 1BDFA 1IS1A 3S15K 2FQTA 2E2HA 4XSZA 1WCMK 5IOQA 3GTKC 3HOUC 1Y1VA 1EFWA 2YU9C 4KN7A 1XXBA 3L4KA 4C3JC 2R92A 1TWCC 3BP3A 4LR2A 4WJ3M 5IYCK 1V5VA 1I50C 5IOTA 5IP7K 3AD8C 1XZPB 4A3LK 3S14K 3GTMK 3Q3QA 2GSNA 2CW0A 4BXXK 1I6VA 2ZFZA 2PPBA 4X6AC 2WAQL 4GTEA 5CJ9A 1Y1WC 4MEXA 2V6SA 5IYDC 5M5XK 1VH2A 5C4JK 1GE9A 3LAPA 5JVOA 1XZQA 3HKZL 3S15C 1SMYA 4A3FC 1K83C 2Y3PA 3HOVK 1XXCA 4KMUA 4C45A 3TFIA 1J6VA 2V6UA 2E2IC 2A6EA 3RZOK 5C4XC 3PO2K 1XXAA 1PJ5A 3S1NK 2EBBA 4XLPA 2R7ZA 2JA6C 1TWGA 3ERED 3GTGC 3AD9C 3GTJK 2O5IA 1I6HK 3TFJA 5IYCC 3FKIK 1HQMA 3GTQA 1XZQB 4BKWA 4KAWX 4A3LC 4GTFA 3T01A 3GTKA 2YU9A 1HI9A 1L0WA 4P5AA 4BBRK 3HOZK 4A3IC 4A3KC 1TWCA 1PJ7A 1KQ4A 2A69A 3GEIA 2P5MA 3T02A 1I50A 1IQ0A 1RU0A 1DCOA 3RZDK 1SFOC 3S1QK 4KMDA 1X31C 5TMCA 4ILDA 1O28A 1Y1WA 2GSUA 3SZZA 4PAAA 1WQHA 2NVQC 5HL8A 3S2DC 4A93C 2R93K 1K83A 4NOIA 4BY1C 4C2MC 2D6FC 5IP9K 3N0BA 1TWHK 3PO3C 2PHCB 2E2IA 2JA7C 1F7UA 5C44C 2NVXC 3S17C 4QJVA 1G51A 2JA6A 3HOWK 1WOSA 3GTGA 2XCQA 3OEPA 1F7VA 2JA8C 3AQPA 3JSTA 3WODA 2E2JC 1WORA 3S0XA 1XZPA 2NVYC 1PJ6A 5E68A 3S1MC 1I3QC 3OREA 5FJ8K 3A8KA 3H0GC 2B63C 4A3DC 4G7ZA 1O25A 4QJVB 1F93A 3CQZK 3N0CA 4GTBA 2RH6A 3ADAC 1SFOA 3S1RK 4GZYA 5TJ3A 1YNNA 1YX2A 4Q5SA 4KMHA 1INNA 4KN4A 4KB2A 1YNJA 4BLAA 1WOPA 4A3EK 1JQWA 3HOWC 4C3IK 2A6HA 1TWAK 5M5WK 3S16K 2P8TA 2WB1L 3GTPK 3M4OK 4LK1A 1DD5A 4XSXA 3M3YK 2JA5K 1IBAA 3DXJA 2JA7A 4AYBL 1TWFK 1WCMC 3GTLK 4OIQA 5C3EK 4WJ4A 2NVXA 4G7HA 1VLOA 4YFNA 1ZBSA 2E2HK 4YFXA 3TFHA 3BUEA 1Y1VK 3HOYK 4A3CK 4YG2A 2NVYA 3K7AK 2GAHC 4KASA 3G4CA 2PMZD 2W7VA 5IP7C 1I3QA 4BBSK 2NVTK 3S14C 3H0GA 4LLGA 3GTMC 4DDQA 1JVIA 4BXXC 3G4AA 2B63A 4A3EC 2WB1D 2PA8D 4BLBA 3GEEA 5C4JC 4AYBD 3GTPC 3M4OC 4C3HK 1TWFC 2JH3A 4A3GK 3L4JA 3EQLA 3HOVC 4A3BK 1UV7A 4KARA 4PABA 3RZOC 1B4AA 3FHZA 3PO2C 1F9NA 4BY7K 4XCHA
chains in the Genus database with same CATH topology
1EK8A 5IOTA 3S0XA 4C3IC 1ZXOA 3CAGA 2GSNA 3Q3QA 4KATA 5IOSA 2R93A 3LAJA 4GT9A 2ZFZA 5EGHA 4P5BA 1WCMA 4LQYA 3OREA 1TWHA 4GTEA 5CJ9A 4KM9A 1GE9A 1O25A 2GSOA 3N0CA 3LAPA 5IORA 5JVOA 1B4BA 4GTBA 2RH6A 1O2BA 3AQOA 3FOEA 3NUHA 5CHPA 1SFOA 1AB4A 5TJ3A 2Y3PA 1XXCA 2XCOA 4KMHA 3GTMA 5JFEA 1XXAA 4KB2A 1O24A 4BLAA 1O27A 2R7ZA 1TWGA 3GTOA 3ERED 3QX3A 2RGRA 3GTQA 4KC6A 3GTPA 1WQFA 4BKWA 3CQZA 4KAWX 2KWAA 4GTFA 1DD5A 3GTKA 2YU9A 4GTLA 4P5AA 2JA7A 3OPFA 4FZBA 1TWFA 3N3YA 3MMLB 2NVXA 4C3HC 1TWCA 1KQ4A 4M1XA 1ZBSA 1WIHA 2P5MA 1ISEA 4G0WA 3BUEA 1I50A 4GTAA 1ZVUA 2CFAB 1TWAA 3VA7A 2VUMA 3GTJA 2NVYA 2CFAA 3FKIA 3G4CA 4KB4A 4KASA 4KMDA 1I3QA 2XCRB 3AH5A 4ILDA 1O28A 3H0GA 4KDDA 4DDQA 1R9TA 4G0VA 1Y1WA 2JA5A 2GSUA 3G4AA 4KMAA 2B63A 1WQGA 3V4GA 4KM8A 3GTLA 1WQHA 5EGEA 4BLBA 4GFQA 4FM9A 3LPXA 1IS1A 2E2HA 1K83A 4C2MC 5IOQA 1EH1A 3N0BA 1Y1VA 1O29A 2E2IA 2PHCB 1XXBA 2JH3A 3L4JA 4GTCA 1BGWA 3L4KA 4C3JC 3FOFA 1BJTA 2R92A 1O2AA 2JA6A 4LR2A 4KARA 3GTGA 2XCQA 1O26A 3OEPA 1B4AA 4GTDA 4G0UA 3FHZA 3AQPA 1F9NA 4J3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOT A;  3N3Y A;  1KQ4 A;  5JFE A;  4KAT A;  5IOS A;  4GT9 A;  1O24 A;  1O27 A;  5IOQ A;  4P5B A;  3N0B A;  4GTA A;  4GTE A;  2CFA B;  1O29 A;  2CFA A;  4KAS A;  3G4C A;  1O25 A;  4GTC A;  3N0C A;  5IOR A;  4GTF A;  1O2A A;  3AH5 A;  1O28 A;  4GTB A;  1O2B A;  4KAR A;  4GTL A;  1O26 A;  4GTD A;  4P5A A;  3G4A A;  4FZB A;  5CHP A; 
#chains in the Genus database with same CATH topology
 1EK8 A;  3S1N C;  4A3M K;  3S2H K;  4A3C C;  2Y0S L;  4Y7N K;  3GTJ C;  1I6H C;  4A3J K;  5IOS A;  3FKI C;  4GT9 A;  3LAJ A;  1EQR A;  3H3V L;  3I4M K;  4BBS C;  4OIO A;  1WCM A;  2NVT C;  2R7Z K;  1TWG K;  1USO A;  4BBR C;  4RMF A;  3HOZ C;  1XPP A;  5IOR A;  3GTK K;  3HOU K;  3AQO A;  1O2B A;  3FOE A;  4QIW D;  1VGX A;  3NUH A;  1AB4 A;  1IE0 A;  4C3J K;  1J6X A;  5IYB K;  3GTM A;  5JFE A;  5M3F K;  1IL2 A;  1BS2 A;  3RZD C;  2ZUE A;  4A3G C;  3BP8 C;  3GIR A;  3S1Q C;  3I4N K;  1I50 K;  4A3B C;  3GTO K;  2Y0S D;  3QX3 A;  4LK0 A;  4KC6 A;  3H3V D;  4X6A K;  3GTP A;  1WQF A;  2KWA A;  4OIN A;  1Y1W K;  4GTL A;  5IYD K;  3I4M C;  2R93 C;  4FZB A;  4WIL A;  1TWF A;  5IP9 C;  2GAG C;  3N3Y A;  1TWH C;  5D4D A;  4LOW A;  4M1X A;  4A3F K;  1WIH A;  1K83 K;  1ISE A;  1USM A;  2PMZ L;  4GTA A;  2CFA B;  3GDZ A;  1DCP A;  2E2I K;  5C4X K;  3GTJ A;  2VUM K;  2FQO A;  3FKI A;  4KB4 A;  2XCR B;  5IYB C;  4MQ9 A;  2JA6 K;  3TTG A;  4KDD A;  2PA8 L;  4OIR A;  3GTG K;  4G0V A;  1C0A A;  1R9T K;  4KMA A;  1JOE A;  3I4N C;  3V4G A;  4KM8 A;  4LJZ A;  5EGE A;  3GTO C;  1WSR A;  4ZH4 A;  4Q4Z A;  4OIP A;  4A3I K;  3CQZ C;  5M5Y K;  1EH1 A;  4A3K K;  1O29 A;  3SZY A;  3GSI A;  3S1R C;  4GTC A;  1BGW A;  4YFK A;  4AH6 A;  3FOF A;  1BJT A;  1O2A A;  2R92 K;  1O26 A;  4GTD A;  4G0U A;  1SFO K;  4J3N A;  4C3I C;  1TWA C;  1ZXO A;  3CAG A;  5L46 A;  2VUM C;  4KAT A;  3S16 C;  2R93 A;  3A8I A;  5EGH A;  1ZYR A;  4P5B A;  2NVQ K;  4LQY A;  3M3Y C;  1TWH A;  1R9T C;  2JA5 C;  4KM9 A;  1VJE A;  3S2D K;  4A93 K;  4QIW L;  4BY1 K;  1J6W A;  4C2M K;  3GTL C;  2GSO A;  2WAQ D;  5C3E C;  1YCL A;  4MEY A;  1B4B A;  2ZUF A;  3PO3 K;  2JA7 K;  2E2H C;  5CHP A;  4O2D A;  3HKZ D;  2XCO A;  3AD7 C;  3GEH A;  5C44 K;  2NVX K;  3S17 K;  1Y1V C;  1O2F B;  3HOX K;  3HOY C;  4G7O A;  2O5J A;  1J98 A;  3K7A C;  2JA8 K;  4Y52 K;  1O24 A;  1O27 A;  2E2J K;  2R92 C;  3GTO A;  2NVY K;  2RGR A;  5M3M K;  5FLM K;  2BE5 A;  3HXA A;  3GTQ K;  3S1M K;  1I3Q K;  3CQZ A;  1WSV A;  3H0G K;  1ZQ1 C;  2YU9 K;  2B63 K;  3OPF A;  4A3D K;  4JK1 A;  3MML B;  4C3H C;  1TWC K;  4P9S A;  4G0W A;  1IW7 A;  1VRQ C;  1ZVU A;  3IPJ A;  1TWA A;  4XLN A;  1WOO A;  3VA7 A;  1DCH A;  2VUM A;  2CFA A;  4BY7 C;  4A3M C;  3S2H C;  3AH5 A;  3HOX C;  1EI6 A;  3T00 A;  2A68 A;  1R9T A;  2JA5 A;  4Y7N C;  4Y52 C;  4A3J C;  1WQG A;  3A8J A;  3GTL A;  2R7Z C;  1TWG C;  4GFQ A;  4FM9 A;  2V6T A;  5TMF A;  3LPX A;  5FLM C;  3GTQ C;  1BDF A;  1IS1 A;  3S15 K;  2FQT A;  2E2H A;  4XSZ A;  1WCM K;  5IOQ A;  3GTK C;  3HOU C;  1Y1V A;  1EFW A;  2YU9 C;  4KN7 A;  1XXB A;  3L4K A;  4C3J C;  2R92 A;  1TWC C;  3BP3 A;  4LR2 A;  4WJ3 M;  5IYC K;  1V5V A;  1I50 C;  5IOT A;  5IP7 K;  3AD8 C;  1XZP B;  4A3L K;  3S14 K;  3GTM K;  3Q3Q A;  2GSN A;  2CW0 A;  4BXX K;  1I6V A;  2ZFZ A;  2PPB A;  4X6A C;  2WAQ L;  4GTE A;  5CJ9 A;  1Y1W C;  4MEX A;  2V6S A;  5IYD C;  5M5X K;  1VH2 A;  5C4J K;  1GE9 A;  3LAP A;  5JVO A;  1XZQ A;  3HKZ L;  3S15 C;  1SMY A;  4A3F C;  1K83 C;  2Y3P A;  3HOV K;  1XXC A;  4KMU A;  4C45 A;  3TFI A;  1J6V A;  2V6U A;  2E2I C;  2A6E A;  3RZO K;  5C4X C;  3PO2 K;  1XXA A;  1PJ5 A;  3S1N K;  2EBB A;  4XLP A;  2R7Z A;  2JA6 C;  1TWG A;  3ERE D;  3GTG C;  3AD9 C;  3GTJ K;  2O5I A;  1I6H K;  3TFJ A;  5IYC C;  3FKI K;  1HQM A;  3GTQ A;  1XZQ B;  4BKW A;  4KAW X;  4A3L C;  4GTF A;  3T01 A;  3GTK A;  2YU9 A;  1HI9 A;  1L0W A;  4P5A A;  4BBR K;  3HOZ K;  4A3I C;  4A3K C;  1TWC A;  1PJ7 A;  1KQ4 A;  2A69 A;  3GEI A;  2P5M A;  3T02 A;  1I50 A;  1IQ0 A;  1RU0 A;  1DCO A;  3RZD K;  1SFO C;  3S1Q K;  4KMD A;  1X31 C;  5TMC A;  4ILD A;  1O28 A;  1Y1W A;  2GSU A;  3SZZ A;  4PAA A;  1WQH A;  2NVQ C;  5HL8 A;  3S2D C;  4A93 C;  2R93 K;  1K83 A;  4NOI A;  4BY1 C;  4C2M C;  2D6F C;  5IP9 K;  3N0B A;  1TWH K;  3PO3 C;  2PHC B;  2E2I A;  2JA7 C;  1F7U A;  5C44 C;  2NVX C;  3S17 C;  4QJV A;  1G51 A;  2JA6 A;  3HOW K;  1WOS A;  3GTG A;  2XCQ A;  3OEP A;  1F7V A;  2JA8 C;  3AQP A;  3JST A;  3WOD A;  2E2J C;  1WOR A;  3S0X A;  1XZP A;  2NVY C;  1PJ6 A;  5E68 A;  3S1M C;  1I3Q C;  3ORE A;  5FJ8 K;  3A8K A;  3H0G C;  2B63 C;  4A3D C;  4G7Z A;  1O25 A;  4QJV B;  1F93 A;  3CQZ K;  3N0C A;  4GTB A;  2RH6 A;  3ADA C;  1SFO A;  3S1R K;  4GZY A;  5TJ3 A;  1YNN A;  1YX2 A;  4Q5S A;  4KMH A;  1INN A;  4KN4 A;  4KB2 A;  1YNJ A;  4BLA A;  1WOP A;  4A3E K;  1JQW A;  3HOW C;  4C3I K;  2A6H A;  1TWA K;  5M5W K;  3S16 K;  2P8T A;  2WB1 L;  3GTP K;  3M4O K;  4LK1 A;  1DD5 A;  4XSX A;  3M3Y K;  2JA5 K;  1IBA A;  3DXJ A;  2JA7 A;  4AYB L;  1TWF K;  1WCM C;  3GTL K;  4OIQ A;  5C3E K;  4WJ4 A;  2NVX A;  4G7H A;  1VLO A;  4YFN A;  1ZBS A;  2E2H K;  4YFX A;  3TFH A;  3BUE A;  1Y1V K;  3HOY K;  4A3C K;  4YG2 A;  2NVY A;  3K7A K;  2GAH C;  4KAS A;  3G4C A;  2PMZ D;  2W7V A;  5IP7 C;  1I3Q A;  4BBS K;  2NVT K;  3S14 C;  3H0G A;  4LLG A;  3GTM C;  4DDQ A;  1JVI A;  4BXX C;  3G4A A;  2B63 A;  4A3E C;  2WB1 D;  2PA8 D;  4BLB A;  3GEE A;  5C4J C;  4AYB D;  3GTP C;  3M4O C;  4C3H K;  1TWF C;  2JH3 A;  4A3G K;  3L4J A;  3EQL A;  3HOV C;  4A3B K;  1UV7 A;  4KAR A;  4PAB A;  3RZO C;  1B4A A;  3FHZ A;  3PO2 C;  1F9N A;  4BY7 K;  4XCH A; 
#chains in the Genus database with same CATH homology
 1EK8 A;  5IOT A;  3S0X A;  4C3I C;  1ZXO A;  3CAG A;  2GSN A;  3Q3Q A;  4KAT A;  5IOS A;  2R93 A;  3LAJ A;  4GT9 A;  2ZFZ A;  5EGH A;  4P5B A;  1WCM A;  4LQY A;  3ORE A;  1TWH A;  4GTE A;  5CJ9 A;  4KM9 A;  1GE9 A;  1O25 A;  2GSO A;  3N0C A;  3LAP A;  5IOR A;  5JVO A;  1B4B A;  4GTB A;  2RH6 A;  1O2B A;  3AQO A;  3FOE A;  3NUH A;  5CHP A;  1SFO A;  1AB4 A;  5TJ3 A;  2Y3P A;  1XXC A;  2XCO A;  4KMH A;  3GTM A;  5JFE A;  1XXA A;  4KB2 A;  1O24 A;  4BLA A;  1O27 A;  2R7Z A;  1TWG A;  3GTO A;  3ERE D;  3QX3 A;  2RGR A;  3GTQ A;  4KC6 A;  3GTP A;  1WQF A;  4BKW A;  3CQZ A;  4KAW X;  2KWA A;  4GTF A;  1DD5 A;  3GTK A;  2YU9 A;  4GTL A;  4P5A A;  2JA7 A;  3OPF A;  4FZB A;  1TWF A;  3N3Y A;  3MML B;  2NVX A;  4C3H C;  1TWC A;  1KQ4 A;  4M1X A;  1ZBS A;  1WIH A;  2P5M A;  1ISE A;  4G0W A;  3BUE A;  1I50 A;  4GTA A;  1ZVU A;  2CFA B;  1TWA A;  3VA7 A;  2VUM A;  3GTJ A;  2NVY A;  2CFA A;  3FKI A;  3G4C A;  4KB4 A;  4KAS A;  4KMD A;  1I3Q A;  2XCR B;  3AH5 A;  4ILD A;  1O28 A;  3H0G A;  4KDD A;  4DDQ A;  1R9T A;  4G0V A;  1Y1W A;  2JA5 A;  2GSU A;  3G4A A;  4KMA A;  2B63 A;  1WQG A;  3V4G A;  4KM8 A;  3GTL A;  1WQH A;  5EGE A;  4BLB A;  4GFQ A;  4FM9 A;  3LPX A;  1IS1 A;  2E2H A;  1K83 A;  4C2M C;  5IOQ A;  1EH1 A;  3N0B A;  1Y1V A;  1O29 A;  2E2I A;  2PHC B;  1XXB A;  2JH3 A;  3L4J A;  4GTC A;  1BGW A;  3L4K A;  4C3J C;  3FOF A;  1BJT A;  2R92 A;  1O2A A;  2JA6 A;  4LR2 A;  4KAR A;  3GTG A;  2XCQ A;  1O26 A;  3OEP A;  1B4A A;  4GTD A;  4G0U A;  3FHZ A;  3AQP A;  1F9N A;  4J3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...