4KASA

Crystal structure of fdts from t. maritima mutant (h53d) with fad and dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDDEERDRHLIEYLMKHGDETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
publication title Flavin-Dependent Thymidylate Synthase as a Drug Target for Deadly Microbes: Mutational Study and a Strategy for Inhibitor Design.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 80
structure length 213
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kasA00
3AH5A 4GTAA 4KASA 1O24A 2CFAB 3G4CA 4GTFA 4GTCA 5IOTA 3N3YA 4GTLA 3N0BA 1O27A 4GT9A 5IOQA 4GTBA 4KARA 3G4AA 3N0CA 5CHPA 4KATA 5IORA 5IOSA 1O26A 1O25A 4GTDA 1O28A 4P5AA 1O2BA 4GTEA 1O2AA 5JFEA 1KQ4A 4P5BA 1O29A 4FZBA 2CFAA
chains in the Genus database with same CATH superfamily
4XCHA 3GTMK 2JA7C 2PMZL 5M5XK 4A3JC 3HOYK 1I50C 2A6HA 1O24A 5FLMK 1JVIA 2GAHC 3BP8C 2VUMK 2P5MA 1RU0A 4AYBL 3HOVC 4KB2A 3S2DC 1J98A 2FQTA 4QIWD 2E2IK 3N0CA 3HOZK 3GTKA 3SZZA 5D4DA 4OIPA 1G51A 5IORA 4JK1A 4C2MK 1YX2A 3FOEA 3GEIA 4XSZA 1I3QC 3PO3K 4KN4A 1HQMA 1DCOA 3AH5A 3HOUK 4YFXA 1WCMC 4KB4A 5C44K 4BY1K 3CQZC 3T01A 1IE0A 1JOEA 5FJ8K 4QJVB 4GTBA 5IP9K 3S2HC 3S16C 3GTQC 1TWAC 5CHPA 4LJZA 2V6UA 1F93A 4G7ZA 3RZDC 4A3MK 3CAGA 4LK0A 4MEXA 3GTGC 3GTKK 1O25A 4P5AA 3AQPA 1XXCA 5TMCA 1VRQC 2R93C 4BBRC 1TWHC 2Y0SL 2WAQL 4LQYA 3GTOA 3S15C 2JA5C 3L4KA 2PHCB 5M5WK 4QJVA 2Y3PA 3GTJC 3HOYC 1O27A 1VJEA 4BBSK 3G4AA 4YFNA 3M4OC 3Q3QA 5HL8A 4C3HK 1WQGA 4A3IC 4MEYA 2JH3A 2WAQD 5TJ3A 2ZFZA 4Y52C 3SZYA 1F7VA 3I4MK 3PO3C 3S1QK 2B63C 3GTOK 3ADAC 1WSRA 1YCLA 3A8IA 4BY1C 4A3FC 1VLOA 3RZOK 2XCOA 2E2JK 1Y1VA 4YFKA 5C4JC 4A93K 5IP9C 1XXBA 4BKWA 1J6WA 1BS2A 2NVYA 2JA8K 1Y1WC 2JA6A 4WJ3M 4KMAA 5IYCC 4BY7C 4GTCA 1VH2A 4C3JK 4LR2A 3S1NC 3EQLA 4J3NA 1IW7A 2NVTC 3S1MC 4QIWL 1J6XA 4A3GK 1Y1VK 5CJ9A 5IYBK 4KM8A 1TWGA 1K83K 1IQ0A 4A3LC 3HOXK 5JFEA 3ERED 2A6EA 5C3EK 3PO2K 1TWCA 4ILDA 4G0UA 2NVYK 1SFOA 3S14C 4GTAA 1TWFA 1C0AA 1IL2A 4G0WA 1IBAA 2YU9A 4A3CC 5C4XK 3N3YA 3N0BA 3AQOA 4KMUA 4XLNA 3FKIC 4BXXC 1ZBSA 3VA7A 2E2HA 3S1RK 3H0GC 4LLGA 3H3VD 2WB1D 3GTPK 3GEHA 5M3FK 4X6AK 1X31C 1TWGK 3GTLA 2GSNA 4AH6A 1USOA 1UV7A 2GSUA 2JA8C 4RMFA 5IP7K 5M3MK 1TWCK 2CFAB 4KC6A 1TWFK 2R92A 4GT9A 1XXAA 3K7AC 2KWAA 1V5VA 4A3KC 1SMYA 2NVXA 4MQ9A 1I6VA 1DD5A 2E2HK 4Y7NC 5EGEA 1INNA 1K83C 4P5BA 5M5YK 2A68A 4GFQA 2CFAA 5L46A 2R7ZC 3PO2C 3WODA 1HI9A 4PAAA 1YNNA 1R9TC 3GTMC 3S17K 2D6FC 3L4JA 5FLMC 4KARA 1IS1A 2VUMC 4C3IK 4KATA 2JA7A 2E2IC 3HOZC 2NVXK 1I50A 3GTPC 4C2MC 4ZH4A 1BJTA 4A3BK 4NOIA 5IYDK 2PPBA 1WSVA 3BP3A 2PA8L 3HOUC 1PJ6A 5EGHA 4GTLA 1I3QA 5C44C 1GE9A 4A3DK 1WQHA 3GIRA 2NVQK 1ZQ1C 4G0VA 1I6HK 4WILA 1WCMA 1XZPB 1XZQB 4KM9A 1WQFA 2JA7K 3CQZA 4A3JK 4A3MC 3GTKC 1I50K 4WJ4A 4FZBA 3T00A 4KMHA 3FOFA 2ZUEA 1WOPA 3GTQA 1TWAA 3S2DK 3JSTA 2PA8D 3G4CA 4GTFA 3MMLB 4KMDA 3GTGA 4XSXA 1ZYRA 2O5IA 3M3YK 1TWHA 2R93A 1XZPA 1XZQA 3LAPA 1I3QK 3DXJA 4BBSC 2JA5A 3H3VL 2WB1L 3OREA 1L0WA 1ZXOA 4C3HC 3GTJA 4BLAA 1WCMK 2O5JA 5TMFA 3QX3A 2XCQA 3CQZK 1DCPA 2CW0A 3HOWK 3LAJA 1F9NA 2JA6K 3T02A 3AD9C 3I4MC 3S2HK 3S16K 1TWAK 3S1QC 4OIRA 1F7UA 4M1XA 3RZDK 3GTGK 3GTOC 3NUHA 4A3DC 1ZVUA 4BBRK 1TWHK 2NVQC 3RZOC 2R93K 2RH6A 3TFIA 2E2JC 3TFHA 4A93C 2B63A 1O2BA 2JA5K 2V6TA 3GTJK 3GSIA 1VGXA 3HKZL 4O2DA 3BUEA 1SFOK 2ZUFA 4C45A 3M4OK 1EFWA 5E68A 2YU9K 1Y1WA 4A3IK 4C3JC 3A8KA 1DCHA 3M3YC 4Y52K 4GTDA 3A8JA 1O2AA 1O2FB 1PJ7A 4A3GC 4G7HA 2GAGC 1Y1VC 2PMZD 5IYBC 1B4BA 2B63K 1EH1A 3I4NK 3V4GA 1EK8A 1XPPA 3HOXC 5C3EC 3HKZD 3GTLK 4AYBD 4GZYA 4A3FK 2NVYC 4YG2A 3HOWC 5C4JK 2JA6C 1EQRA 2GSOA 4PABA 2XCRB 5C4XC 4A3EK 2R92K 1Y1WK 2BE5A 5IOSA 1O26A 3OEPA 3S1RC 3HXAA 1USMA 1O29A 1YNJA 5IYCK 4X6AC 3FKIA 4BY7K 1WORA 1TWGC 3H0GA 3S1NK 5IP7C 2NVTK 3S1MK 1TWCC 4G7OA 1SFOC 3LPXA 1TWFC 4A3LK 4DDQA 4LK1A 4OINA 2YU9C 1BGWA 2Y0SD 1O28A 3S14K 2E2HC 4P9SA 4KDDA 2RGRA 4A3CK 1ISEA 4OIQA 4KASA 3I4NC 3HOVK 1B4AA 3FKIK 1WIHA 4BXXK 3OPFA 4KAWX 4XLPA 3GTLC 3AD7C 1WOOA 3H0GK 3TTGA 4LOWA 3IPJA 1K83A 4OIOA 2W7VA 3GEEA 4FM9A 3S17C 2R7ZA 2FQOA 2A69A 4A3EC 1R9TA 4Q5SA 1J6VA 2R92C 4KN7A 4C3IC 3GTMA 2NVXC 3FHZA 2P8TA 2VUMA 1BDFA 4A3BC 3K7AK 4BLBA 2E2IA 3GDZA 1PJ5A 5IOTA 5JVOA 5IYDC 4A3KK 3GTQK 1AB4A 3GTPA 5IOQA 4Y7NK 3S0XA 1JQWA 2V6SA 3TFJA 2EBBA 3AD8C 1WOSA 1EI6A 4GTEA 4Q4ZA 2R7ZK 3S15K 1I6HC 1KQ4A 1R9TK
chains in the Genus database with same CATH topology
4KMAA 1O24A 4GTCA 2P5MA 5EGHA 4GTLA 4KB2A 4LR2A 2GSOA 1I3QA 1GE9A 1WQHA 4J3NA 3N0CA 3GTKA 2XCRB 4G0VA 5IORA 1WCMA 5CJ9A 1TWGA 4KM8A 5IOSA 1O26A 3OEPA 4KM9A 1WQFA 3FOEA 3ERED 5JFEA 3CQZA 1O29A 1TWCA 4ILDA 4FZBA 4G0UA 3FKIA 4KMHA 1SFOA 3AH5A 4GTAA 3FOFA 1TWFA 3GTQA 1TWAA 3H0GA 4KB4A 4G0WA 3G4CA 4GTFA 3MMLB 4KMDA 2YU9A 3GTGA 3N3YA 3N0BA 3AQOA 4GTBA 3LPXA 1ZBSA 2R93A 3VA7A 1TWHA 2E2HA 5CHPA 3LAPA 4DDQA 3CAGA 2JA5A 1BGWA 1O25A 1O28A 4P5AA 3AQPA 3OREA 1XXCA 1ZXOA 4C3HC 3GTJA 4BLAA 3GTLA 2GSNA 4KDDA 2RGRA 3QX3A 2GSUA 2XCQA 4LQYA 3GTOA 1ISEA 3L4KA 2PHCB 4KASA 3LAJA 1F9NA 1B4AA 2CFAB 4KC6A 1WIHA 3OPFA 2Y3PA 4KAWX 4M1XA 1O27A 2R92A 4GT9A 3G4AA 1XXAA 1K83A 2KWAA 3NUHA 2NVXA 3Q3QA 4FM9A 1DD5A 1WQGA 1ZVUA 2R7ZA 2RH6A 5EGEA 1R9TA 2B63A 1O2BA 2JH3A 5TJ3A 2ZFZA 4C3IC 3GTMA 4P5BA 4GFQA 2CFAA 3FHZA 2VUMA 3BUEA 4BLBA 2E2IA 5IOTA 5JVOA 3L4JA 1AB4A 3GTPA 5IOQA 4KARA 2XCOA 1Y1WA 1Y1VA 4C3JC 1IS1A 3S0XA 4KATA 2JA7A 1XXBA 4BKWA 1I50A 4GTDA 2NVYA 4GTEA 1O2AA 1KQ4A 4C2MC 2JA6A 1B4BA 1EH1A 3V4GA 1EK8A 1BJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH5 A;  4GTA A;  4KAS A;  1O24 A;  2CFA B;  3G4C A;  4GTF A;  4GTC A;  5IOT A;  3N3Y A;  4GTL A;  3N0B A;  1O27 A;  4GT9 A;  5IOQ A;  4GTB A;  4KAR A;  3G4A A;  3N0C A;  5CHP A;  4KAT A;  5IOR A;  5IOS A;  1O26 A;  1O25 A;  4GTD A;  1O28 A;  4P5A A;  1O2B A;  4GTE A;  1O2A A;  5JFE A;  1KQ4 A;  4P5B A;  1O29 A;  4FZB A;  2CFA A; 
#chains in the Genus database with same CATH topology
 4XCH A;  3GTM K;  2JA7 C;  2PMZ L;  5M5X K;  4A3J C;  3HOY K;  1I50 C;  2A6H A;  1O24 A;  5FLM K;  1JVI A;  2GAH C;  3BP8 C;  2VUM K;  2P5M A;  1RU0 A;  4AYB L;  3HOV C;  4KB2 A;  3S2D C;  1J98 A;  2FQT A;  4QIW D;  2E2I K;  3N0C A;  3HOZ K;  3GTK A;  3SZZ A;  5D4D A;  4OIP A;  1G51 A;  5IOR A;  4JK1 A;  4C2M K;  1YX2 A;  3FOE A;  3GEI A;  4XSZ A;  1I3Q C;  3PO3 K;  4KN4 A;  1HQM A;  1DCO A;  3AH5 A;  3HOU K;  4YFX A;  1WCM C;  4KB4 A;  5C44 K;  4BY1 K;  3CQZ C;  3T01 A;  1IE0 A;  1JOE A;  5FJ8 K;  4QJV B;  4GTB A;  5IP9 K;  3S2H C;  3S16 C;  3GTQ C;  1TWA C;  5CHP A;  4LJZ A;  2V6U A;  1F93 A;  4G7Z A;  3RZD C;  4A3M K;  3CAG A;  4LK0 A;  4MEX A;  3GTG C;  3GTK K;  1O25 A;  4P5A A;  3AQP A;  1XXC A;  5TMC A;  1VRQ C;  2R93 C;  4BBR C;  1TWH C;  2Y0S L;  2WAQ L;  4LQY A;  3GTO A;  3S15 C;  2JA5 C;  3L4K A;  2PHC B;  5M5W K;  4QJV A;  2Y3P A;  3GTJ C;  3HOY C;  1O27 A;  1VJE A;  4BBS K;  3G4A A;  4YFN A;  3M4O C;  3Q3Q A;  5HL8 A;  4C3H K;  1WQG A;  4A3I C;  4MEY A;  2JH3 A;  2WAQ D;  5TJ3 A;  2ZFZ A;  4Y52 C;  3SZY A;  1F7V A;  3I4M K;  3PO3 C;  3S1Q K;  2B63 C;  3GTO K;  3ADA C;  1WSR A;  1YCL A;  3A8I A;  4BY1 C;  4A3F C;  1VLO A;  3RZO K;  2XCO A;  2E2J K;  1Y1V A;  4YFK A;  5C4J C;  4A93 K;  5IP9 C;  1XXB A;  4BKW A;  1J6W A;  1BS2 A;  2NVY A;  2JA8 K;  1Y1W C;  2JA6 A;  4WJ3 M;  4KMA A;  5IYC C;  4BY7 C;  4GTC A;  1VH2 A;  4C3J K;  4LR2 A;  3S1N C;  3EQL A;  4J3N A;  1IW7 A;  2NVT C;  3S1M C;  4QIW L;  1J6X A;  4A3G K;  1Y1V K;  5CJ9 A;  5IYB K;  4KM8 A;  1TWG A;  1K83 K;  1IQ0 A;  4A3L C;  3HOX K;  5JFE A;  3ERE D;  2A6E A;  5C3E K;  3PO2 K;  1TWC A;  4ILD A;  4G0U A;  2NVY K;  1SFO A;  3S14 C;  4GTA A;  1TWF A;  1C0A A;  1IL2 A;  4G0W A;  1IBA A;  2YU9 A;  4A3C C;  5C4X K;  3N3Y A;  3N0B A;  3AQO A;  4KMU A;  4XLN A;  3FKI C;  4BXX C;  1ZBS A;  3VA7 A;  2E2H A;  3S1R K;  3H0G C;  4LLG A;  3H3V D;  2WB1 D;  3GTP K;  3GEH A;  5M3F K;  4X6A K;  1X31 C;  1TWG K;  3GTL A;  2GSN A;  4AH6 A;  1USO A;  1UV7 A;  2GSU A;  2JA8 C;  4RMF A;  5IP7 K;  5M3M K;  1TWC K;  2CFA B;  4KC6 A;  1TWF K;  2R92 A;  4GT9 A;  1XXA A;  3K7A C;  2KWA A;  1V5V A;  4A3K C;  1SMY A;  2NVX A;  4MQ9 A;  1I6V A;  1DD5 A;  2E2H K;  4Y7N C;  5EGE A;  1INN A;  1K83 C;  4P5B A;  5M5Y K;  2A68 A;  4GFQ A;  2CFA A;  5L46 A;  2R7Z C;  3PO2 C;  3WOD A;  1HI9 A;  4PAA A;  1YNN A;  1R9T C;  3GTM C;  3S17 K;  2D6F C;  3L4J A;  5FLM C;  4KAR A;  1IS1 A;  2VUM C;  4C3I K;  4KAT A;  2JA7 A;  2E2I C;  3HOZ C;  2NVX K;  1I50 A;  3GTP C;  4C2M C;  4ZH4 A;  1BJT A;  4A3B K;  4NOI A;  5IYD K;  2PPB A;  1WSV A;  3BP3 A;  2PA8 L;  3HOU C;  1PJ6 A;  5EGH A;  4GTL A;  1I3Q A;  5C44 C;  1GE9 A;  4A3D K;  1WQH A;  3GIR A;  2NVQ K;  1ZQ1 C;  4G0V A;  1I6H K;  4WIL A;  1WCM A;  1XZP B;  1XZQ B;  4KM9 A;  1WQF A;  2JA7 K;  3CQZ A;  4A3J K;  4A3M C;  3GTK C;  1I50 K;  4WJ4 A;  4FZB A;  3T00 A;  4KMH A;  3FOF A;  2ZUE A;  1WOP A;  3GTQ A;  1TWA A;  3S2D K;  3JST A;  2PA8 D;  3G4C A;  4GTF A;  3MML B;  4KMD A;  3GTG A;  4XSX A;  1ZYR A;  2O5I A;  3M3Y K;  1TWH A;  2R93 A;  1XZP A;  1XZQ A;  3LAP A;  1I3Q K;  3DXJ A;  4BBS C;  2JA5 A;  3H3V L;  2WB1 L;  3ORE A;  1L0W A;  1ZXO A;  4C3H C;  3GTJ A;  4BLA A;  1WCM K;  2O5J A;  5TMF A;  3QX3 A;  2XCQ A;  3CQZ K;  1DCP A;  2CW0 A;  3HOW K;  3LAJ A;  1F9N A;  2JA6 K;  3T02 A;  3AD9 C;  3I4M C;  3S2H K;  3S16 K;  1TWA K;  3S1Q C;  4OIR A;  1F7U A;  4M1X A;  3RZD K;  3GTG K;  3GTO C;  3NUH A;  4A3D C;  1ZVU A;  4BBR K;  1TWH K;  2NVQ C;  3RZO C;  2R93 K;  2RH6 A;  3TFI A;  2E2J C;  3TFH A;  4A93 C;  2B63 A;  1O2B A;  2JA5 K;  2V6T A;  3GTJ K;  3GSI A;  1VGX A;  3HKZ L;  4O2D A;  3BUE A;  1SFO K;  2ZUF A;  4C45 A;  3M4O K;  1EFW A;  5E68 A;  2YU9 K;  1Y1W A;  4A3I K;  4C3J C;  3A8K A;  1DCH A;  3M3Y C;  4Y52 K;  4GTD A;  3A8J A;  1O2A A;  1O2F B;  1PJ7 A;  4A3G C;  4G7H A;  2GAG C;  1Y1V C;  2PMZ D;  5IYB C;  1B4B A;  2B63 K;  1EH1 A;  3I4N K;  3V4G A;  1EK8 A;  1XPP A;  3HOX C;  5C3E C;  3HKZ D;  3GTL K;  4AYB D;  4GZY A;  4A3F K;  2NVY C;  4YG2 A;  3HOW C;  5C4J K;  2JA6 C;  1EQR A;  2GSO A;  4PAB A;  2XCR B;  5C4X C;  4A3E K;  2R92 K;  1Y1W K;  2BE5 A;  5IOS A;  1O26 A;  3OEP A;  3S1R C;  3HXA A;  1USM A;  1O29 A;  1YNJ A;  5IYC K;  4X6A C;  3FKI A;  4BY7 K;  1WOR A;  1TWG C;  3H0G A;  3S1N K;  5IP7 C;  2NVT K;  3S1M K;  1TWC C;  4G7O A;  1SFO C;  3LPX A;  1TWF C;  4A3L K;  4DDQ A;  4LK1 A;  4OIN A;  2YU9 C;  1BGW A;  2Y0S D;  1O28 A;  3S14 K;  2E2H C;  4P9S A;  4KDD A;  2RGR A;  4A3C K;  1ISE A;  4OIQ A;  4KAS A;  3I4N C;  3HOV K;  1B4A A;  3FKI K;  1WIH A;  4BXX K;  3OPF A;  4KAW X;  4XLP A;  3GTL C;  3AD7 C;  1WOO A;  3H0G K;  3TTG A;  4LOW A;  3IPJ A;  1K83 A;  4OIO A;  2W7V A;  3GEE A;  4FM9 A;  3S17 C;  2R7Z A;  2FQO A;  2A69 A;  4A3E C;  1R9T A;  4Q5S A;  1J6V A;  2R92 C;  4KN7 A;  4C3I C;  3GTM A;  2NVX C;  3FHZ A;  2P8T A;  2VUM A;  1BDF A;  4A3B C;  3K7A K;  4BLB A;  2E2I A;  3GDZ A;  1PJ5 A;  5IOT A;  5JVO A;  5IYD C;  4A3K K;  3GTQ K;  1AB4 A;  3GTP A;  5IOQ A;  4Y7N K;  3S0X A;  1JQW A;  2V6S A;  3TFJ A;  2EBB A;  3AD8 C;  1WOS A;  1EI6 A;  4GTE A;  4Q4Z A;  2R7Z K;  3S15 K;  1I6H C;  1KQ4 A;  1R9T K; 
#chains in the Genus database with same CATH homology
 4KMA A;  1O24 A;  4GTC A;  2P5M A;  5EGH A;  4GTL A;  4KB2 A;  4LR2 A;  2GSO A;  1I3Q A;  1GE9 A;  1WQH A;  4J3N A;  3N0C A;  3GTK A;  2XCR B;  4G0V A;  5IOR A;  1WCM A;  5CJ9 A;  1TWG A;  4KM8 A;  5IOS A;  1O26 A;  3OEP A;  4KM9 A;  1WQF A;  3FOE A;  3ERE D;  5JFE A;  3CQZ A;  1O29 A;  1TWC A;  4ILD A;  4FZB A;  4G0U A;  3FKI A;  4KMH A;  1SFO A;  3AH5 A;  4GTA A;  3FOF A;  1TWF A;  3GTQ A;  1TWA A;  3H0G A;  4KB4 A;  4G0W A;  3G4C A;  4GTF A;  3MML B;  4KMD A;  2YU9 A;  3GTG A;  3N3Y A;  3N0B A;  3AQO A;  4GTB A;  3LPX A;  1ZBS A;  2R93 A;  3VA7 A;  1TWH A;  2E2H A;  5CHP A;  3LAP A;  4DDQ A;  3CAG A;  2JA5 A;  1BGW A;  1O25 A;  1O28 A;  4P5A A;  3AQP A;  3ORE A;  1XXC A;  1ZXO A;  4C3H C;  3GTJ A;  4BLA A;  3GTL A;  2GSN A;  4KDD A;  2RGR A;  3QX3 A;  2GSU A;  2XCQ A;  4LQY A;  3GTO A;  1ISE A;  3L4K A;  2PHC B;  4KAS A;  3LAJ A;  1F9N A;  1B4A A;  2CFA B;  4KC6 A;  1WIH A;  3OPF A;  2Y3P A;  4KAW X;  4M1X A;  1O27 A;  2R92 A;  4GT9 A;  3G4A A;  1XXA A;  1K83 A;  2KWA A;  3NUH A;  2NVX A;  3Q3Q A;  4FM9 A;  1DD5 A;  1WQG A;  1ZVU A;  2R7Z A;  2RH6 A;  5EGE A;  1R9T A;  2B63 A;  1O2B A;  2JH3 A;  5TJ3 A;  2ZFZ A;  4C3I C;  3GTM A;  4P5B A;  4GFQ A;  2CFA A;  3FHZ A;  2VUM A;  3BUE A;  4BLB A;  2E2I A;  5IOT A;  5JVO A;  3L4J A;  1AB4 A;  3GTP A;  5IOQ A;  4KAR A;  2XCO A;  1Y1W A;  1Y1V A;  4C3J C;  1IS1 A;  3S0X A;  4KAT A;  2JA7 A;  1XXB A;  4BKW A;  1I50 A;  4GTD A;  2NVY A;  4GTE A;  1O2A A;  1KQ4 A;  4C2M C;  2JA6 A;  1B4B A;  1EH1 A;  3V4G A;  1EK8 A;  1BJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...