1SFOK

Rna polymerase ii strand separated elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1sfoK00
4C3HK 4A3IK 3S16K 4A3FC 1HQMA 2A69A 4XSZA 5IP7C 5IP7K 4Y7NC 4KN7A 4A3MK 3RZDC 3HOVC 3S14K 3S14C 3S17K 4MEYA 4GZYA 1WCMC 4LJZA 4LK1A 3CQZK 4LLGA 2PMZD 1TWFK 4A3JC 3PO2K 4BY7K 5TMFA 4G7HA 2R92K 3GTPC 3H3VD 1TWCC 4BXXK 4YG2A 2E2HK 1I50K 5FLMC 1R9TC 4QIWD 2WB1D 4Q4ZA 1SFOC 2PA8L 1I6HC 4XSXA 1I3QC 4C3IK 4ZH4A 4XLPA 2YU9C 2JA6C 2VUMK 3HOWC 3M3YC 5C4XC 5FJ8K 2R93K 5C44C 3GTMC 3HOYK 5TMCA 1K83C 4Y52C 3S1NC 3S1QK 4A3KC 2JA7C 1TWGK 2NVYC 5IYDC 1Y1VC 5IYCK 4A3EK 2CW0A 4G7OA 1TWAC 2A6EA 1TWAK 3GTQC 3S15K 3S15C 2BE5A 4A3LK 4A3IC 3S16C 3HOZK 2NVQK 4A3MC 3K7AK 3S17C 4BBSK 4NOIA 4Q5SA 4KMUA 3GTKK 5M3FK 3CQZC 4C2MK 1TWFC 4YFNA 3PO2C 1TWHK 3GTGK 4BY7C 2R92C 5M5YK 2JA5K 1YNNA 2E2HC 3I4MK 4KN4A 4BXXC 4A3DK 1I50C 2PA8D 3GTQK 1XPPA 3HKZL 2R7ZK 2VUMC 1YNJA 4QJVB 2A68A 4A3BK 2R93C 3HOYC 3FKIK 1Y1WK 3HOUK 3PO3K 3S2DK 3S1QC 3S1RC 3S1RK 5IP9C 3DXJA 1I6VA 5IP9K 3GTLK 1ZYRA 1TWGC 4A3EC 5IYCC 2NVTK 4OIPA 2NVXK 4A3LC 2O5IA 3HOXK 3GTOK 3HOZC 2NVQC 1IW7A 3K7AC 4LK0A 2B63K 5C4JK 2JA8K 1SMYA 4BY1K 4C3JK 4BBSC 3M4OC 3GTKC 3M4OK 2PPBA 1TWHC 3GTGC 4OINA 5D4DA 4X6AK 2E2JK 2JA5C 3GTJK 3I4MC 4A3DC 2WB1L 3HKZD 4A93K 4OIRA 2WAQL 4BBRK 4QJVA 2R7ZC 4A3GK 5IYBK 3S2HC 4A3CK 2A6HA 3H0GK 2Y0SL 4AYBL 3S2HK 4A3BC 3FKIC 1Y1WC 3HOUC 3PO3C 3S2DC 3RZOK 3I4NC 3WODA 3I4NK 3GTLC 5C3EK 1BDFA 3EQLA 4YFKA 2NVTC 4A3FK 2NVXC 3RZDK 3HOVK 4Y7NK 4OIQA 2O5JA 1WCMK 3HOXC 3GTOC 2JA8C 2B63C 4XLNA 5C4JC 4A3JK 4BY1C 3GTPK 2E2IC 2PMZL 5M3MK 2E2IK 1TWCK 3H3VL 5FLMK 1R9TK 4X6AC 2E2JC 5M5XK 4OIOA 4MQ9A 3GTJC 4MEXA 2WAQD 4QIWL 4A3GC 1SFOK 4G7ZA 1I6HK 4A93C 1I3QK 2JA6K 2YU9K 3HOWK 4BBRC 2Y0SD 4AYBD 5C4XK 4YFXA 3M3YK 3S1MK 3S1MC 5C44K 5IYBC 3GTMK 3H0GC 4JK1A 1K83K 3S1NK 4A3CC 4Y52K 4A3KK 5M5WK 2JA7K 2NVYK 5IYDK 1Y1VK 3RZOC 5C3EC
chains in the Genus database with same CATH superfamily
4C3HK 1UV7A 5CJ9A 4KB4A 1BGWA 1HQMA 1C0AA 2ZFZA 1TWGA 4Y7NC 4A3MK 4MEYA 4LK1A 3CQZK 2XCOA 2PMZD 1TWFK 1O29A 4GTCA 3H3VD 3T00A 1TWCC 4BXXK 4YG2A 3SZYA 3GTKA 2WB1D 3Q3QA 4GFQA 3GTGA 2EBBA 1I6HC 4XSXA 3OREA 4ZH4A 4C3IK 2JA6C 4P5AA 3GTMC 4Y52C 3S1QK 4A3KC 2NVYC 5IYDC 5IYCK 2CW0A 3VA7A 3BUEA 1PJ7A 4LQYA 3GTLA 5TJ3A 3S17C 2P8TA 3K7AK 4NOIA 4Q5SA 4KMUA 2W7VA 4BLAA 4YFNA 4PAAA 2R92C 2B63A 2E2HC 3I4MK 2RGRA 4KM9A 3AD9C 3GSIA 2XCRB 3HKZL 3BP8C 3T01A 2VUMC 1XXAA 1EI6A 1F9NA 3HOYC 3PO3K 1I6VA 1HI9A 4A3LC 3GEEA 2V6SA 1XXBA 3HOXK 2FQOA 2NVQC 1O2AA 2JA8K 4BBSC 1EQRA 5C4JK 5IOQA 4BLBA 1TWHC 1JOEA 4OINA 2E2JK 4GTLA 4GT9A 2GAGC 1TWCA 3HKZD 4OIRA 2WAQL 4KMAA 5IYBK 2Y0SL 3GIRA 3ERED 4GTBA 2JA6A 3FKIC 1Y1WC 3RZOK 3I4NC 3I4NK 1WORA 3GTMA 4A3FK 4KATA 3HOVK 2NVYA 1WCMK 3GTOC 4KB2A 4XLNA 4C3JC 3QX3A 4C45A 5M3MK 3FOFA 3OEPA 4OIOA 4MEXA 2WAQD 2R92A 4G7ZA 3SZZA 1F7UA 2E2HA 4BBRC 2Y0SD 3S1MC 4P9SA 3S1MK 3S1NK 2FQTA 2VUMA 5C3EC 3GTQK 1IL2A 2GAHC 3A8JA 3S16K 5IP7C 3AH5A 5IP7K 4KN7A 1VRQC 4G0VA 5L46A 5TMFA 1WSVA 1J6WA 1TWHA 1DCOA 5IOSA 2YU9C 1O24A 3M3YC 5FJ8K 1ISEA 5C44C 3AD8C 1BS2A 2JA7C 4G7OA 1Y1VC 3FKIA 1Y1WA 2A6EA 1F7VA 3S15C 4C3HC 3S15K 1DCPA 2BE5A 3N3YA 1WOPA 4A3MC 5M3FK 3CQZC 1BJTA 1TWFC 3GTOA 5M5YK 2JA5K 4KAWX 4BXXC 4A3DK 2XCQA 2R7ZK 2KWAA 1G51A 4C3IC 2A68A 4A3BK 1JVIA 3HOUK 3S1QC 3V4GA 1ZYRA 1YX2A 5IYCC 2NVTK 4OIPA 2NVXK 2O5IA 3K7AC 4BY1K 2PPBA 1ZVUA 4GTEA 5EGHA 5D4DA 3GTJK 3I4MC 1VH2A 3A8IA 1ZXOA 1VGXA 3AQPA 4FM9A 4A3CK 3S2HC 3H0GK 3S2HK 3TFJA 4AYBL 5HL8A 4AH6A 2YU9A 3PO3C 2JH3A 1DCHA 1BDFA 4KMHA 4YFKA 1WOOA 3RZDK 2JA7A 1Y1VA 2O5JA 3A8KA 3HOXC 2JA8C 1XZQA 5C4JC 4A3JK 3MMLB 4PABA 3GTPK 1KQ4A 5FLMK 1R9TK 3CQZA 2E2JC 5M5XK 1TWFA 2GSUA 1SFOK 1I3QK 3HOWK 1VJEA 3L4JA 4AYBD 5C4XK 4GTFA 5IYBC 4G0WA 4JK1A 1K83K 1USOA 3RZOC 4RMFA 4A3IK 4A3FC 3HOVC 4DDQA 1J6VA 3S14C 3S14K 4GZYA 3GDZA 1WCMC 1IS1A 3PO2K 4BY7K 1WQHA 3T02A 3N0CA 1I50K 1XXCA 4P5BA 2Y3PA 1WOSA 1INNA 4Q4ZA 2PA8L 4KMDA 1J6XA 5CHPA 4XLPA 2R93K 5E68A 3S1NC 1WQGA 1TWGK 4FZBA 4A3EK 3LPXA 1TWAC 3GTQC 1TWAK 1WQFA 3GEIA 3S16C 3HOZK 4WJ3M 3GTKK 1XZPA 4C2MK 3GTGK 1VLOA 4KN4A 2PA8D 3OPFA 3TFHA 1O25A 1AB4A 3S2DK 3S1RC 1JQWA 5IP9C 3DXJA 3S1RK 5IP9K 3GTLK 4M1XA 1WSRA 1O28A 3BP3A 3FHZA 3AQOA 2B63K 4LK0A 1SMYA 2V6UA 1EH1A 2PHCB 4KASA 5IOTA 1XZQB 1WCMA 4X6AK 2JA5C 4LOWA 4A3DC 3FOEA 5JVOA 2WB1L 4A93K 3GEHA 3HXAA 4QJVA 1X31C 2R7ZC 1O2BA 4A3GK 1PJ6A 2A6HA 1B4BA 4WJ4A 1ZQ1C 4A3BC 3ADAC 3HOUC 4KDDA 3EQLA 2NVTC 2NVXC 4Y7NK 4XCHA 3LAJA 5JFEA 1TWAA 3GTQA 4BY1C 4G0UA 2E2IC 4O2DA 2E2IK 1B4AA 1TWCK 2V6TA 3JSTA 3L4KA 3IPJA 4J3NA 3GTJC 4QIWL 1I6HK 3G4AA 2JA6K 1J98A 3GTMK 4A3CC 3H0GC 4Y52K 4A3KK 1EK8A 2NVYK 5IYDK 4BKWA 3RZDC 2A69A 2CFAA 4XSZA 3S17K 2ZUEA 4LJZA 4LLGA 2GSOA 4A3JC 4G7HA 3GTPC 2R92K 1XZPB 2E2HK 5FLMC 1R9TC 4QIWD 3AD7C 1SFOC 2JA5A 1I3QC 3N0BA 2VUMK 3HOWC 5C4XC 3HOYK 3TTGA 5TMCA 1K83C 5EGEA 2R7ZA 4A3LK 4A3IC 2NVQK 4BBSK 1IBAA 3G4CA 2NVXA 3PO2C 4BY7C 1TWHK 4ILDA 1L0WA 1YNNA 1I50C 2E2IA 1O26A 1ZBSA 1XPPA 2D6FC 5IORA 3GTJA 3LAPA 1YNJA 4QJVB 2R93C 3FKIK 1Y1WK 4WILA 3H0GA 1TWGC 4A3EC 1F93A 1O2FB 3GTOK 3HOZC 1IW7A 1EFWA 2GSNA 4C3JK 3M4OC 3GTKC 3M4OK 3NUHA 2ZUFA 4KC6A 4C2MC 3CAGA 1DD5A 3GTGC 1PJ5A 4KM8A 3GTPA 4BBRK 1R9TA 4LR2A 1SFOA 1I3QA 1USMA 3S2DC 3WODA 1O27A 3GTLC 5C3EK 1K83A 1V5VA 2RH6A 4OIQA 4GTAA 1GE9A 2CFAB 2B63C 2PMZL 3H3VL 4KARA 4X6AC 4MQ9A 1RU0A 1WIHA 2P5MA 1IQ0A 4A93C 2YU9K 1I50A 1YCLA 3S0XA 4YFXA 3M3YK 4A3GC 5C44K 1IE0A 5M5WK 2JA7K 3TFIA 1Y1VK 2R93A 4GTDA
chains in the Genus database with same CATH topology
4C3HK 4A3IK 3S16K 4A3FC 1HQMA 2A69A 4XSZA 5IP7C 5IP7K 4Y7NC 4KN7A 4A3MK 3RZDC 3HOVC 3S14K 3S14C 3S17K 4MEYA 4GZYA 1WCMC 4LJZA 4LK1A 3CQZK 4LLGA 2PMZD 1TWFK 4A3JC 3PO2K 4BY7K 5TMFA 4G7HA 2R92K 3GTPC 3H3VD 1TWCC 4BXXK 4YG2A 2E2HK 1I50K 5FLMC 1R9TC 4QIWD 2WB1D 4Q4ZA 1SFOC 2PA8L 1I6HC 4XSXA 1I3QC 4C3IK 4ZH4A 4XLPA 2YU9C 2JA6C 2VUMK 3HOWC 3M3YC 5C4XC 5FJ8K 2R93K 5C44C 3GTMC 3HOYK 5TMCA 1K83C 4Y52C 3S1NC 3S1QK 4A3KC 2JA7C 1TWGK 2NVYC 5IYDC 1Y1VC 5IYCK 4A3EK 2CW0A 4G7OA 1TWAC 2A6EA 1TWAK 3GTQC 3S15K 3S15C 2BE5A 4A3LK 4A3IC 3S16C 3HOZK 2NVQK 4A3MC 3K7AK 3S17C 4BBSK 4NOIA 4Q5SA 4KMUA 3GTKK 5M3FK 3CQZC 4C2MK 1TWFC 4YFNA 3PO2C 1TWHK 3GTGK 4BY7C 2R92C 5M5YK 2JA5K 1YNNA 2E2HC 3I4MK 4KN4A 4BXXC 4A3DK 1I50C 2PA8D 3GTQK 1XPPA 3HKZL 2R7ZK 2VUMC 1YNJA 4QJVB 2A68A 4A3BK 2R93C 3HOYC 3FKIK 1Y1WK 3HOUK 3PO3K 3S2DK 3S1QC 3S1RC 3S1RK 5IP9C 3DXJA 1I6VA 5IP9K 3GTLK 1ZYRA 1TWGC 4A3EC 5IYCC 2NVTK 4OIPA 2NVXK 4A3LC 2O5IA 3HOXK 3GTOK 3HOZC 2NVQC 1IW7A 3K7AC 4LK0A 2B63K 5C4JK 2JA8K 1SMYA 4BY1K 4C3JK 4BBSC 3M4OC 3GTKC 3M4OK 2PPBA 1TWHC 3GTGC 4OINA 5D4DA 4X6AK 2E2JK 2JA5C 3GTJK 3I4MC 4A3DC 2WB1L 3HKZD 4A93K 4OIRA 2WAQL 4BBRK 4QJVA 2R7ZC 4A3GK 5IYBK 3S2HC 4A3CK 2A6HA 3H0GK 2Y0SL 4AYBL 3S2HK 4A3BC 3FKIC 1Y1WC 3HOUC 3PO3C 3S2DC 3RZOK 3I4NC 3WODA 3I4NK 3GTLC 5C3EK 1BDFA 3EQLA 4YFKA 2NVTC 4A3FK 2NVXC 3RZDK 3HOVK 4Y7NK 4OIQA 2O5JA 1WCMK 3HOXC 3GTOC 2JA8C 2B63C 4XLNA 5C4JC 4A3JK 4BY1C 3GTPK 2E2IC 2PMZL 5M3MK 2E2IK 1TWCK 3H3VL 5FLMK 1R9TK 4X6AC 2E2JC 5M5XK 4OIOA 4MQ9A 3GTJC 4MEXA 2WAQD 4QIWL 4A3GC 1SFOK 4G7ZA 1I6HK 4A93C 1I3QK 2JA6K 2YU9K 3HOWK 4BBRC 2Y0SD 4AYBD 5C4XK 4YFXA 3M3YK 3S1MK 3S1MC 5C44K 5IYBC 3GTMK 3H0GC 4JK1A 1K83K 3S1NK 4A3CC 4Y52K 4A3KK 5M5WK 2JA7K 2NVYK 5IYDK 1Y1VK 3RZOC 5C3EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H K;  4A3I K;  3S16 K;  4A3F C;  1HQM A;  2A69 A;  4XSZ A;  5IP7 C;  5IP7 K;  4Y7N C;  4KN7 A;  4A3M K;  3RZD C;  3HOV C;  3S14 K;  3S14 C;  3S17 K;  4MEY A;  4GZY A;  1WCM C;  4LJZ A;  4LK1 A;  3CQZ K;  4LLG A;  2PMZ D;  1TWF K;  4A3J C;  3PO2 K;  4BY7 K;  5TMF A;  4G7H A;  2R92 K;  3GTP C;  3H3V D;  1TWC C;  4BXX K;  4YG2 A;  2E2H K;  1I50 K;  5FLM C;  1R9T C;  4QIW D;  2WB1 D;  4Q4Z A;  1SFO C;  2PA8 L;  1I6H C;  4XSX A;  1I3Q C;  4C3I K;  4ZH4 A;  4XLP A;  2YU9 C;  2JA6 C;  2VUM K;  3HOW C;  3M3Y C;  5C4X C;  5FJ8 K;  2R93 K;  5C44 C;  3GTM C;  3HOY K;  5TMC A;  1K83 C;  4Y52 C;  3S1N C;  3S1Q K;  4A3K C;  2JA7 C;  1TWG K;  2NVY C;  5IYD C;  1Y1V C;  5IYC K;  4A3E K;  2CW0 A;  4G7O A;  1TWA C;  2A6E A;  1TWA K;  3GTQ C;  3S15 K;  3S15 C;  2BE5 A;  4A3L K;  4A3I C;  3S16 C;  3HOZ K;  2NVQ K;  4A3M C;  3K7A K;  3S17 C;  4BBS K;  4NOI A;  4Q5S A;  4KMU A;  3GTK K;  5M3F K;  3CQZ C;  4C2M K;  1TWF C;  4YFN A;  3PO2 C;  1TWH K;  3GTG K;  4BY7 C;  2R92 C;  5M5Y K;  2JA5 K;  1YNN A;  2E2H C;  3I4M K;  4KN4 A;  4BXX C;  4A3D K;  1I50 C;  2PA8 D;  3GTQ K;  1XPP A;  3HKZ L;  2R7Z K;  2VUM C;  1YNJ A;  4QJV B;  2A68 A;  4A3B K;  2R93 C;  3HOY C;  3FKI K;  1Y1W K;  3HOU K;  3PO3 K;  3S2D K;  3S1Q C;  3S1R C;  3S1R K;  5IP9 C;  3DXJ A;  1I6V A;  5IP9 K;  3GTL K;  1ZYR A;  1TWG C;  4A3E C;  5IYC C;  2NVT K;  4OIP A;  2NVX K;  4A3L C;  2O5I A;  3HOX K;  3GTO K;  3HOZ C;  2NVQ C;  1IW7 A;  3K7A C;  4LK0 A;  2B63 K;  5C4J K;  2JA8 K;  1SMY A;  4BY1 K;  4C3J K;  4BBS C;  3M4O C;  3GTK C;  3M4O K;  2PPB A;  1TWH C;  3GTG C;  4OIN A;  5D4D A;  4X6A K;  2E2J K;  2JA5 C;  3GTJ K;  3I4M C;  4A3D C;  2WB1 L;  3HKZ D;  4A93 K;  4OIR A;  2WAQ L;  4BBR K;  4QJV A;  2R7Z C;  4A3G K;  5IYB K;  3S2H C;  4A3C K;  2A6H A;  3H0G K;  2Y0S L;  4AYB L;  3S2H K;  4A3B C;  3FKI C;  1Y1W C;  3HOU C;  3PO3 C;  3S2D C;  3RZO K;  3I4N C;  3WOD A;  3I4N K;  3GTL C;  5C3E K;  1BDF A;  3EQL A;  4YFK A;  2NVT C;  4A3F K;  2NVX C;  3RZD K;  3HOV K;  4Y7N K;  4OIQ A;  2O5J A;  1WCM K;  3HOX C;  3GTO C;  2JA8 C;  2B63 C;  4XLN A;  5C4J C;  4A3J K;  4BY1 C;  3GTP K;  2E2I C;  2PMZ L;  5M3M K;  2E2I K;  1TWC K;  3H3V L;  5FLM K;  1R9T K;  4X6A C;  2E2J C;  5M5X K;  4OIO A;  4MQ9 A;  3GTJ C;  4MEX A;  2WAQ D;  4QIW L;  4A3G C;  1SFO K;  4G7Z A;  1I6H K;  4A93 C;  1I3Q K;  2JA6 K;  2YU9 K;  3HOW K;  4BBR C;  2Y0S D;  4AYB D;  5C4X K;  4YFX A;  3M3Y K;  3S1M K;  3S1M C;  5C44 K;  5IYB C;  3GTM K;  3H0G C;  4JK1 A;  1K83 K;  3S1N K;  4A3C C;  4Y52 K;  4A3K K;  5M5W K;  2JA7 K;  2NVY K;  5IYD K;  1Y1V K;  3RZO C;  5C3E C; 
#chains in the Genus database with same CATH topology
 4C3H K;  1UV7 A;  5CJ9 A;  4KB4 A;  1BGW A;  1HQM A;  1C0A A;  2ZFZ A;  1TWG A;  4Y7N C;  4A3M K;  4MEY A;  4LK1 A;  3CQZ K;  2XCO A;  2PMZ D;  1TWF K;  1O29 A;  4GTC A;  3H3V D;  3T00 A;  1TWC C;  4BXX K;  4YG2 A;  3SZY A;  3GTK A;  2WB1 D;  3Q3Q A;  4GFQ A;  3GTG A;  2EBB A;  1I6H C;  4XSX A;  3ORE A;  4ZH4 A;  4C3I K;  2JA6 C;  4P5A A;  3GTM C;  4Y52 C;  3S1Q K;  4A3K C;  2NVY C;  5IYD C;  5IYC K;  2CW0 A;  3VA7 A;  3BUE A;  1PJ7 A;  4LQY A;  3GTL A;  5TJ3 A;  3S17 C;  2P8T A;  3K7A K;  4NOI A;  4Q5S A;  4KMU A;  2W7V A;  4BLA A;  4YFN A;  4PAA A;  2R92 C;  2B63 A;  2E2H C;  3I4M K;  2RGR A;  4KM9 A;  3AD9 C;  3GSI A;  2XCR B;  3HKZ L;  3BP8 C;  3T01 A;  2VUM C;  1XXA A;  1EI6 A;  1F9N A;  3HOY C;  3PO3 K;  1I6V A;  1HI9 A;  4A3L C;  3GEE A;  2V6S A;  1XXB A;  3HOX K;  2FQO A;  2NVQ C;  1O2A A;  2JA8 K;  4BBS C;  1EQR A;  5C4J K;  5IOQ A;  4BLB A;  1TWH C;  1JOE A;  4OIN A;  2E2J K;  4GTL A;  4GT9 A;  2GAG C;  1TWC A;  3HKZ D;  4OIR A;  2WAQ L;  4KMA A;  5IYB K;  2Y0S L;  3GIR A;  3ERE D;  4GTB A;  2JA6 A;  3FKI C;  1Y1W C;  3RZO K;  3I4N C;  3I4N K;  1WOR A;  3GTM A;  4A3F K;  4KAT A;  3HOV K;  2NVY A;  1WCM K;  3GTO C;  4KB2 A;  4XLN A;  4C3J C;  3QX3 A;  4C45 A;  5M3M K;  3FOF A;  3OEP A;  4OIO A;  4MEX A;  2WAQ D;  2R92 A;  4G7Z A;  3SZZ A;  1F7U A;  2E2H A;  4BBR C;  2Y0S D;  3S1M C;  4P9S A;  3S1M K;  3S1N K;  2FQT A;  2VUM A;  5C3E C;  3GTQ K;  1IL2 A;  2GAH C;  3A8J A;  3S16 K;  5IP7 C;  3AH5 A;  5IP7 K;  4KN7 A;  1VRQ C;  4G0V A;  5L46 A;  5TMF A;  1WSV A;  1J6W A;  1TWH A;  1DCO A;  5IOS A;  2YU9 C;  1O24 A;  3M3Y C;  5FJ8 K;  1ISE A;  5C44 C;  3AD8 C;  1BS2 A;  2JA7 C;  4G7O A;  1Y1V C;  3FKI A;  1Y1W A;  2A6E A;  1F7V A;  3S15 C;  4C3H C;  3S15 K;  1DCP A;  2BE5 A;  3N3Y A;  1WOP A;  4A3M C;  5M3F K;  3CQZ C;  1BJT A;  1TWF C;  3GTO A;  5M5Y K;  2JA5 K;  4KAW X;  4BXX C;  4A3D K;  2XCQ A;  2R7Z K;  2KWA A;  1G51 A;  4C3I C;  2A68 A;  4A3B K;  1JVI A;  3HOU K;  3S1Q C;  3V4G A;  1ZYR A;  1YX2 A;  5IYC C;  2NVT K;  4OIP A;  2NVX K;  2O5I A;  3K7A C;  4BY1 K;  2PPB A;  1ZVU A;  4GTE A;  5EGH A;  5D4D A;  3GTJ K;  3I4M C;  1VH2 A;  3A8I A;  1ZXO A;  1VGX A;  3AQP A;  4FM9 A;  4A3C K;  3S2H C;  3H0G K;  3S2H K;  3TFJ A;  4AYB L;  5HL8 A;  4AH6 A;  2YU9 A;  3PO3 C;  2JH3 A;  1DCH A;  1BDF A;  4KMH A;  4YFK A;  1WOO A;  3RZD K;  2JA7 A;  1Y1V A;  2O5J A;  3A8K A;  3HOX C;  2JA8 C;  1XZQ A;  5C4J C;  4A3J K;  3MML B;  4PAB A;  3GTP K;  1KQ4 A;  5FLM K;  1R9T K;  3CQZ A;  2E2J C;  5M5X K;  1TWF A;  2GSU A;  1SFO K;  1I3Q K;  3HOW K;  1VJE A;  3L4J A;  4AYB D;  5C4X K;  4GTF A;  5IYB C;  4G0W A;  4JK1 A;  1K83 K;  1USO A;  3RZO C;  4RMF A;  4A3I K;  4A3F C;  3HOV C;  4DDQ A;  1J6V A;  3S14 C;  3S14 K;  4GZY A;  3GDZ A;  1WCM C;  1IS1 A;  3PO2 K;  4BY7 K;  1WQH A;  3T02 A;  3N0C A;  1I50 K;  1XXC A;  4P5B A;  2Y3P A;  1WOS A;  1INN A;  4Q4Z A;  2PA8 L;  4KMD A;  1J6X A;  5CHP A;  4XLP A;  2R93 K;  5E68 A;  3S1N C;  1WQG A;  1TWG K;  4FZB A;  4A3E K;  3LPX A;  1TWA C;  3GTQ C;  1TWA K;  1WQF A;  3GEI A;  3S16 C;  3HOZ K;  4WJ3 M;  3GTK K;  1XZP A;  4C2M K;  3GTG K;  1VLO A;  4KN4 A;  2PA8 D;  3OPF A;  3TFH A;  1O25 A;  1AB4 A;  3S2D K;  3S1R C;  1JQW A;  5IP9 C;  3DXJ A;  3S1R K;  5IP9 K;  3GTL K;  4M1X A;  1WSR A;  1O28 A;  3BP3 A;  3FHZ A;  3AQO A;  2B63 K;  4LK0 A;  1SMY A;  2V6U A;  1EH1 A;  2PHC B;  4KAS A;  5IOT A;  1XZQ B;  1WCM A;  4X6A K;  2JA5 C;  4LOW A;  4A3D C;  3FOE A;  5JVO A;  2WB1 L;  4A93 K;  3GEH A;  3HXA A;  4QJV A;  1X31 C;  2R7Z C;  1O2B A;  4A3G K;  1PJ6 A;  2A6H A;  1B4B A;  4WJ4 A;  1ZQ1 C;  4A3B C;  3ADA C;  3HOU C;  4KDD A;  3EQL A;  2NVT C;  2NVX C;  4Y7N K;  4XCH A;  3LAJ A;  5JFE A;  1TWA A;  3GTQ A;  4BY1 C;  4G0U A;  2E2I C;  4O2D A;  2E2I K;  1B4A A;  1TWC K;  2V6T A;  3JST A;  3L4K A;  3IPJ A;  4J3N A;  3GTJ C;  4QIW L;  1I6H K;  3G4A A;  2JA6 K;  1J98 A;  3GTM K;  4A3C C;  3H0G C;  4Y52 K;  4A3K K;  1EK8 A;  2NVY K;  5IYD K;  4BKW A;  3RZD C;  2A69 A;  2CFA A;  4XSZ A;  3S17 K;  2ZUE A;  4LJZ A;  4LLG A;  2GSO A;  4A3J C;  4G7H A;  3GTP C;  2R92 K;  1XZP B;  2E2H K;  5FLM C;  1R9T C;  4QIW D;  3AD7 C;  1SFO C;  2JA5 A;  1I3Q C;  3N0B A;  2VUM K;  3HOW C;  5C4X C;  3HOY K;  3TTG A;  5TMC A;  1K83 C;  5EGE A;  2R7Z A;  4A3L K;  4A3I C;  2NVQ K;  4BBS K;  1IBA A;  3G4C A;  2NVX A;  3PO2 C;  4BY7 C;  1TWH K;  4ILD A;  1L0W A;  1YNN A;  1I50 C;  2E2I A;  1O26 A;  1ZBS A;  1XPP A;  2D6F C;  5IOR A;  3GTJ A;  3LAP A;  1YNJ A;  4QJV B;  2R93 C;  3FKI K;  1Y1W K;  4WIL A;  3H0G A;  1TWG C;  4A3E C;  1F93 A;  1O2F B;  3GTO K;  3HOZ C;  1IW7 A;  1EFW A;  2GSN A;  4C3J K;  3M4O C;  3GTK C;  3M4O K;  3NUH A;  2ZUF A;  4KC6 A;  4C2M C;  3CAG A;  1DD5 A;  3GTG C;  1PJ5 A;  4KM8 A;  3GTP A;  4BBR K;  1R9T A;  4LR2 A;  1SFO A;  1I3Q A;  1USM A;  3S2D C;  3WOD A;  1O27 A;  3GTL C;  5C3E K;  1K83 A;  1V5V A;  2RH6 A;  4OIQ A;  4GTA A;  1GE9 A;  2CFA B;  2B63 C;  2PMZ L;  3H3V L;  4KAR A;  4X6A C;  4MQ9 A;  1RU0 A;  1WIH A;  2P5M A;  1IQ0 A;  4A93 C;  2YU9 K;  1I50 A;  1YCL A;  3S0X A;  4YFX A;  3M3Y K;  4A3G C;  5C44 K;  1IE0 A;  5M5W K;  2JA7 K;  3TFI A;  1Y1V K;  2R93 A;  4GTD A; 
#chains in the Genus database with same CATH homology
 4C3H K;  4A3I K;  3S16 K;  4A3F C;  1HQM A;  2A69 A;  4XSZ A;  5IP7 C;  5IP7 K;  4Y7N C;  4KN7 A;  4A3M K;  3RZD C;  3HOV C;  3S14 K;  3S14 C;  3S17 K;  4MEY A;  4GZY A;  1WCM C;  4LJZ A;  4LK1 A;  3CQZ K;  4LLG A;  2PMZ D;  1TWF K;  4A3J C;  3PO2 K;  4BY7 K;  5TMF A;  4G7H A;  2R92 K;  3GTP C;  3H3V D;  1TWC C;  4BXX K;  4YG2 A;  2E2H K;  1I50 K;  5FLM C;  1R9T C;  4QIW D;  2WB1 D;  4Q4Z A;  1SFO C;  2PA8 L;  1I6H C;  4XSX A;  1I3Q C;  4C3I K;  4ZH4 A;  4XLP A;  2YU9 C;  2JA6 C;  2VUM K;  3HOW C;  3M3Y C;  5C4X C;  5FJ8 K;  2R93 K;  5C44 C;  3GTM C;  3HOY K;  5TMC A;  1K83 C;  4Y52 C;  3S1N C;  3S1Q K;  4A3K C;  2JA7 C;  1TWG K;  2NVY C;  5IYD C;  1Y1V C;  5IYC K;  4A3E K;  2CW0 A;  4G7O A;  1TWA C;  2A6E A;  1TWA K;  3GTQ C;  3S15 K;  3S15 C;  2BE5 A;  4A3L K;  4A3I C;  3S16 C;  3HOZ K;  2NVQ K;  4A3M C;  3K7A K;  3S17 C;  4BBS K;  4NOI A;  4Q5S A;  4KMU A;  3GTK K;  5M3F K;  3CQZ C;  4C2M K;  1TWF C;  4YFN A;  3PO2 C;  1TWH K;  3GTG K;  4BY7 C;  2R92 C;  5M5Y K;  2JA5 K;  1YNN A;  2E2H C;  3I4M K;  4KN4 A;  4BXX C;  4A3D K;  1I50 C;  2PA8 D;  3GTQ K;  1XPP A;  3HKZ L;  2R7Z K;  2VUM C;  1YNJ A;  4QJV B;  2A68 A;  4A3B K;  2R93 C;  3HOY C;  3FKI K;  1Y1W K;  3HOU K;  3PO3 K;  3S2D K;  3S1Q C;  3S1R C;  3S1R K;  5IP9 C;  3DXJ A;  1I6V A;  5IP9 K;  3GTL K;  1ZYR A;  1TWG C;  4A3E C;  5IYC C;  2NVT K;  4OIP A;  2NVX K;  4A3L C;  2O5I A;  3HOX K;  3GTO K;  3HOZ C;  2NVQ C;  1IW7 A;  3K7A C;  4LK0 A;  2B63 K;  5C4J K;  2JA8 K;  1SMY A;  4BY1 K;  4C3J K;  4BBS C;  3M4O C;  3GTK C;  3M4O K;  2PPB A;  1TWH C;  3GTG C;  4OIN A;  5D4D A;  4X6A K;  2E2J K;  2JA5 C;  3GTJ K;  3I4M C;  4A3D C;  2WB1 L;  3HKZ D;  4A93 K;  4OIR A;  2WAQ L;  4BBR K;  4QJV A;  2R7Z C;  4A3G K;  5IYB K;  3S2H C;  4A3C K;  2A6H A;  3H0G K;  2Y0S L;  4AYB L;  3S2H K;  4A3B C;  3FKI C;  1Y1W C;  3HOU C;  3PO3 C;  3S2D C;  3RZO K;  3I4N C;  3WOD A;  3I4N K;  3GTL C;  5C3E K;  1BDF A;  3EQL A;  4YFK A;  2NVT C;  4A3F K;  2NVX C;  3RZD K;  3HOV K;  4Y7N K;  4OIQ A;  2O5J A;  1WCM K;  3HOX C;  3GTO C;  2JA8 C;  2B63 C;  4XLN A;  5C4J C;  4A3J K;  4BY1 C;  3GTP K;  2E2I C;  2PMZ L;  5M3M K;  2E2I K;  1TWC K;  3H3V L;  5FLM K;  1R9T K;  4X6A C;  2E2J C;  5M5X K;  4OIO A;  4MQ9 A;  3GTJ C;  4MEX A;  2WAQ D;  4QIW L;  4A3G C;  1SFO K;  4G7Z A;  1I6H K;  4A93 C;  1I3Q K;  2JA6 K;  2YU9 K;  3HOW K;  4BBR C;  2Y0S D;  4AYB D;  5C4X K;  4YFX A;  3M3Y K;  3S1M K;  3S1M C;  5C44 K;  5IYB C;  3GTM K;  3H0G C;  4JK1 A;  1K83 K;  3S1N K;  4A3C C;  4Y52 K;  4A3K K;  5M5W K;  2JA7 K;  2NVY K;  5IYD K;  1Y1V K;  3RZO C;  5C3E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...