1SFOK

Rna polymerase ii strand separated elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1sfoK00
4LK0A 4YG2A 4A3MK 1TWCK 3S1MC 1I6HK 3RZDC 2Y0SD 3GTQK 4LLGA 2WAQD 3S2DK 4MQ9A 2VUMC 4C3JK 3S1RK 4A3JC 1Y1WC 1R9TC 2E2HK 5IP9K 2NVXC 2YU9K 1XPPA 5M5XK 4A3BC 5IP7K 3GTOC 4Y7NK 4Q5SA 5IYCC 4A3GC 3FKIC 1SFOK 2JA5C 1WCMC 2JA6C 3EQLA 3S15K 5M5WK 3DXJA 4ZH4A 4G7ZA 4OINA 2NVQC 3GTKC 3GTLC 4XLPA 3M3YK 1TWGC 2E2IK 3RZOC 2NVYC 4G7OA 4XLNA 2O5IA 2R92K 4QIWD 5FLMK 3HKZL 4KN7A 4A3MC 4QJVA 4QJVB 4A3IC 1I6HC 2PMZL 1I3QK 5C44C 2PPBA 3GTQC 3HOYK 1HQMA 3S2DC 5M3MK 1I6VA 4BY7C 4X6AK 4BBSK 4YFXA 3HOVK 3I4MK 4A3LK 4BY1K 2E2HC 5IP9C 4A3FK 4C3IK 2JA7K 4Y52K 2A69A 5C4XC 1SFOC 4KMUA 3S15C 5C4JK 3M3YC 5C3EK 5TMFA 5IYDK 2PA8L 5TMCA 3GTPC 5IYBC 3PO3C 2E2IC 2B63K 4OIOA 4A3DK 2CW0A 5M5YK 3PO2K 3HOUC 4A3CC 3GTMK 3HOXK 4Q4ZA 1I3QC 2R7ZC 2R93K 3HOYC 4BXXC 3M4OK 4G7HA 3HKZD 3I4NK 4BBRK 1TWCC 2JA8K 3I4MC 4BBSC 4A3LC 3GTGK 4BY1C 2PMZD 4A3KK 3S14K 3H3VL 2JA7C 5D4DA 1TWFK 3S17K 4C2MK 1TWAK 3H0GK 3K7AK 4A3EK 3S1RC 4XSZA 2E2JK 1IW7A 3S1MK 1Y1VK 3S2HK 2YU9C 2NVTK 2O5JA 4LK1A 5IP7C 2B63C 4Y7NC 4A3DC 4MEXA 3GTJK 3PO2C 3S16K 4YFKA 1TWHK 3S1QK 4A3JK 3HOXC 1Y1WK 2PA8D 4GZYA 1R9TK 3HOZK 4A3BK 2R92C 3GTOK 3M4OC 5IYCK 4LJZA 5FLMC 2JA5K 3I4NC 4OIRA 4A93K 1I50K 4YFNA 4AYBL 5FJ8K 3GTGC 4A3KC 2NVQK 1ZYRA 3S14C 2BE5A 4JK1A 3CQZK 1TWGK 3RZOK 3S17C 5M3FK 1TWAC 1K83K 3H0GC 1BDFA 3S1NK 2WB1L 2E2JC 4X6AC 3HOVC 4A3IK 1Y1VC 3S2HC 3H3VD 4A3FC 2NVTC 3HOWK 5C44K 2Y0SL 4Y52C 4A3CK 2WAQL 4OIQA 3GTJC 3S1QC 3S16C 4BY7K 1TWHC 2A6EA 5C4JC 5C3EC 5IYDC 3RZDK 1SMYA 3HOZC 2A6HA 5C4XK 1YNJA 1YNNA 4XSXA 2VUMK 3GTMC 4A93C 1I50C 4C3HK 4KN4A 3WODA 2NVXK 3GTPK 2R93C 3CQZC 5IYBK 3PO3K 4NOIA 4A3GK 1K83C 3FKIK 2JA6K 1WCMK 4BBRC 2A68A 4QIWL 4OIPA 2JA8C 3HOUK 4AYBD 3S1NC 3GTKK 3GTLK 3HOWC 1TWFC 2R7ZK 2NVYK 4BXXK 3K7AC 4MEYA 4A3EC 2WB1D
chains in the Genus database with same CATH superfamily
2ZUEA 4YG2A 1TWCK 3RZDC 3S2DK 3L4KA 2VUMC 3S1RK 3SZZA 1R9TC 2E2HK 3GSIA 5M5XK 2VUMA 3FKIC 2JA5C 4PAAA 1VH2A 1R9TA 2ZUFA 3S15K 4G0WA 3DXJA 2NVQC 3GTLC 3FKIA 2JA5A 1TWGC 1VLOA 2O5IA 3GDZA 4KMHA 5FLMK 1DCHA 4KN7A 4A3MC 3GTLA 4QJVA 1EI6A 1TWGA 4QJVB 4A3IC 5JVOA 1I6HC 3L4JA 1EQRA 5C44C 1PJ7A 1HQMA 5M3MK 4BY7C 4X6AK 4LR2A 4YFXA 4C3IK 2GAGC 4Y52K 5TMFA 2B63K 2XCQA 2FQOA 3HOXK 4Q4ZA 1I3QC 2R7ZC 3HOYC 1I3QA 4KM9A 4BBSC 2R7ZA 2NVYA 3AD9C 3GTGK 4A3LC 4A3KK 2JA7C 3S17K 4P9SA 3K7AK 1IW7A 2JA7A 3S2HK 4KASA 1EK8A 3TFHA 5IP7C 4J3NA 3GTJK 1O2BA 4XCHA 4YFKA 1O29A 4AH6A 2PA8D 1R9TK 4KB2A 3HOZK 3M4OC 1V5VA 2JA5K 1YX2A 4OIRA 2E2IA 4AYBL 5FJ8K 2NVQK 1ZYRA 2EBBA 5E68A 1G51A 3CQZK 1TWGK 1O27A 3HXAA 1BDFA 1L0WA 3S1NK 1VJEA 5CJ9A 5CHPA 3HOVC 1ZBSA 4A3IK 4A3FC 2NVTC 5C44K 4P5AA 1PJ6A 3S1QC 4BY7K 5C4JC 1ZVUA 1IS1A 4FM9A 3JSTA 3AH5A 1I50C 4C3HK 1WORA 4GTDA 4KN4A 2JA6K 1WCMK 3BP3A 3CAGA 4QIWL 1O25A 4BLAA 1WSRA 1USMA 1EH1A 3A8KA 4C2MC 2NVYK 2R7ZK 4A3EC 2FQTA 1ISEA 2Y0SD 1F9NA 4LLGA 3TFIA 4MQ9A 1YCLA 3BP8C 5TJ3A 5IP7K 3GTOC 1SFOK 3EQLA 3TFJA 3GTKC 4ZH4A 3G4CA 4G7ZA 4OINA 4G0VA 1WOPA 3GTOA 3AD7C 4XLPA 2E2IK 3GTKA 3HKZL 1BS2A 3NUHA 2XCOA 2PMZL 3GTQC 3AD8C 3OPFA 3T00A 3GTQA 3I4MK 3HOVK 4BY1K 5IP9C 3A8JA 4A3FK 5C4JK 1IL2A 3M3YC 1DD5A 1J6XA 3VA7A 5IYBC 4OIOA 1VGXA 3PO2K 5L46A 4WILA 4KB4A 4GTLA 5JFEA 1HI9A 3LAJA 3H3VL 4C2MK 4A3EK 4C3JC 1UV7A 2YU9C 2V6UA 4LK1A 4A3DC 4Y7NC 1XZPA 1XZPB 2YU9A 3GEHA 3S16K 1TWHK 4KM8A 4ILDA 4KC6A 3GTOK 3I4NC 1C0AA 3LPXA 3S14C 1IBAA 2BE5A 4JK1A 1TWAC 1K83K 3H0GC 5EGEA 2E2JC 1KQ4A 1Y1VC 1TWAA 3H0GA 4A3CK 1Y1VA 3IPJA 2A6EA 4FZBA 3RZDK 4LQYA 2CFAA 2XCRB 1JVIA 2VUMK 2PHCB 1F7UA 4A93C 2R93C 5IYBK 1XZQA 3FKIK 4BBRC 4OIPA 1WOSA 2R93A 1USOA 3GTLK 3GEEA 3HOWC 2WB1D 4KMAA 4A3MK 3S1MC 1I6HK 2WAQD 4C3JK 5HL8A 4A3JC 1BGWA 1XXCA 4GTCA 4O2DA 2NVXC 2YU9K 2D6FC 1O26A 3N0CA 4Y7NK 4Q5SA 5IYCC 4A3GC 2NVXA 5M5WK 1WOOA 3RZOC 1F93A 1ZQ1C 1I50A 4XLNA 1DCOA 1XXAA 1IE0A 1I3QK 3T02A 2PPBA 3HOYK 3S2DC 1O2AA 3LAPA 1I6VA 2JH3A 4BLBA 4BBSK 4A3LK 2E2HC 2JA7K 2A69A 1J6WA 5C4XC 3S0XA 2E2HA 1X31C 4KMUA 5EGHA 3S15C 4KATA 1F7VA 2PA8L 5TMCA 3PO3C 4PABA 1XXBA 1JQWA 4WJ4A 2R93K 4BXXC 3M4OK 4G7HA 4BBRK 1DCPA 5IOSA 3TTGA 5D4DA 3Q3QA 3S1MK 2NVTK 3ADAC 2B63C 4WJ3M 3S1QK 4A3JK 3HOXC 2B63A 3QX3A 2R92C 5IYCK 1I50K 3G4AA 3FOFA 4A3KC 3GTGC 2R92A 3RZOK 3S17C 3GTGA 1WIHA 3S2HC 1WQHA 2P8TA 2Y0SL 2Y3PA 4P5BA 2ZFZA 1PJ5A 1WSVA 3SZYA 4OIQA 3GTJC 5C3EC 5IYDC 1SMYA 3GTJA 3HOZC 1O28A 5C4XK 3GTMC 5IOQA 3CQZC 3PO3K 3GTMA 1RU0A 3S1NC 2A68A 2GSNA 2JA8C 4AYBD 3CQZA 3GTKK 1EFWA 4LOWA 1TWFC 3OEPA 3GIRA 4BXXK 2V6SA 3BUEA 4LK0A 1TWFA 2P5MA 5IORA 4BKWA 3GTQK 4KMDA 4DDQA 2RGRA 4C3HC 1Y1WC 4GFQA 1O2FB 5IP9K 1XPPA 1INNA 4A3BC 2CFAB 1B4BA 1Y1WA 2JA6C 1WCMC 3N3YA 3M3YK 5IOTA 4GT9A 2JA6A 1WCMA 4G7OA 1J98A 2NVYC 1XZQB 2R92K 4GTAA 4QIWD 3OREA 2V6TA 2GAHC 2KWAA 1J6VA 2RH6A 3AQPA 4GTFA 2GSOA 4GTBA 1IQ0A 1SFOC 4KDDA 5C3EK 3A8IA 3MMLB 5IYDK 1SFOA 3GTPC 1BJTA 1O24A 2E2IC 4A3DK 4C45A 2CW0A 3FHZA 5M5YK 3HOUC 3GTPA 3FOEA 3GTMK 4KAWX 3V4GA 3HKZD 3I4NK 1TWCC 2JA8K 3I4MC 4BY1C 2PMZD 3S14K 1WQGA 1TWFK 1TWCA 1TWAK 3H0GK 3S1RC 4XSZA 2E2JK 1Y1VK 2O5JA 4KARA 4MEXA 3PO2C 1GE9A 1JOEA 1Y1WK 4GZYA 4M1XA 4A3BK 4LJZA 5FLMC 4A93K 4YFNA 2GSUA 5M3FK 1B4AA 4X6AC 2WB1L 1WQFA 3H3VD 4C3IC 3HOWK 4Y52C 2WAQL 3AQOA 2W7VA 1ZXOA 3S16C 1TWHC 3T01A 4G0UA 1TWHA 2A6HA 1YNJA 1YNNA 4RMFA 4XSXA 3ERED 3WODA 2NVXK 3GTPK 4NOIA 4A3GK 1K83C 3GEIA 4GTEA 3N0BA 3HOUK 1AB4A 1K83A 1VRQC 4A3CC 3K7AC 4MEYA
chains in the Genus database with same CATH topology
4LK0A 4YG2A 4A3MK 1TWCK 3S1MC 1I6HK 3RZDC 2Y0SD 3GTQK 4LLGA 2WAQD 3S2DK 4MQ9A 2VUMC 4C3JK 3S1RK 4A3JC 1Y1WC 1R9TC 2E2HK 5IP9K 2NVXC 2YU9K 1XPPA 5M5XK 4A3BC 5IP7K 3GTOC 4Y7NK 4Q5SA 5IYCC 4A3GC 3FKIC 1SFOK 2JA5C 1WCMC 2JA6C 3EQLA 3S15K 5M5WK 3DXJA 4ZH4A 4G7ZA 4OINA 2NVQC 3GTKC 3GTLC 4XLPA 3M3YK 1TWGC 2E2IK 3RZOC 2NVYC 4G7OA 4XLNA 2O5IA 2R92K 4QIWD 5FLMK 3HKZL 4KN7A 4A3MC 4QJVA 4QJVB 4A3IC 1I6HC 2PMZL 1I3QK 5C44C 2PPBA 3GTQC 3HOYK 1HQMA 3S2DC 5M3MK 1I6VA 4BY7C 4X6AK 4BBSK 4YFXA 3HOVK 3I4MK 4A3LK 4BY1K 2E2HC 5IP9C 4A3FK 4C3IK 2JA7K 4Y52K 2A69A 5C4XC 1SFOC 4KMUA 3S15C 5C4JK 3M3YC 5C3EK 5TMFA 5IYDK 2PA8L 5TMCA 3GTPC 5IYBC 3PO3C 2E2IC 2B63K 4OIOA 4A3DK 2CW0A 5M5YK 3PO2K 3HOUC 4A3CC 3GTMK 3HOXK 4Q4ZA 1I3QC 2R7ZC 2R93K 3HOYC 4BXXC 3M4OK 4G7HA 3HKZD 3I4NK 4BBRK 1TWCC 2JA8K 3I4MC 4BBSC 4A3LC 3GTGK 4BY1C 2PMZD 4A3KK 3S14K 3H3VL 2JA7C 5D4DA 1TWFK 3S17K 4C2MK 1TWAK 3H0GK 3K7AK 4A3EK 3S1RC 4XSZA 2E2JK 1IW7A 3S1MK 1Y1VK 3S2HK 2YU9C 2NVTK 2O5JA 4LK1A 5IP7C 2B63C 4Y7NC 4A3DC 4MEXA 3GTJK 3PO2C 3S16K 4YFKA 1TWHK 3S1QK 4A3JK 3HOXC 1Y1WK 2PA8D 4GZYA 1R9TK 3HOZK 4A3BK 2R92C 3GTOK 3M4OC 5IYCK 4LJZA 5FLMC 2JA5K 3I4NC 4OIRA 4A93K 1I50K 4YFNA 4AYBL 5FJ8K 3GTGC 4A3KC 2NVQK 1ZYRA 3S14C 2BE5A 4JK1A 3CQZK 1TWGK 3RZOK 3S17C 5M3FK 1TWAC 1K83K 3H0GC 1BDFA 3S1NK 2WB1L 2E2JC 4X6AC 3HOVC 4A3IK 1Y1VC 3S2HC 3H3VD 4A3FC 2NVTC 3HOWK 5C44K 2Y0SL 4Y52C 4A3CK 2WAQL 4OIQA 3GTJC 3S1QC 3S16C 4BY7K 1TWHC 2A6EA 5C4JC 5C3EC 5IYDC 3RZDK 1SMYA 3HOZC 2A6HA 5C4XK 1YNJA 1YNNA 4XSXA 2VUMK 3GTMC 4A93C 1I50C 4C3HK 4KN4A 3WODA 2NVXK 3GTPK 2R93C 3CQZC 5IYBK 3PO3K 4NOIA 4A3GK 1K83C 3FKIK 2JA6K 1WCMK 4BBRC 2A68A 4QIWL 4OIPA 2JA8C 3HOUK 4AYBD 3S1NC 3GTKK 3GTLK 3HOWC 1TWFC 2R7ZK 2NVYK 4BXXK 3K7AC 4MEYA 4A3EC 2WB1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 A;  4YG2 A;  4A3M K;  1TWC K;  3S1M C;  1I6H K;  3RZD C;  2Y0S D;  3GTQ K;  4LLG A;  2WAQ D;  3S2D K;  4MQ9 A;  2VUM C;  4C3J K;  3S1R K;  4A3J C;  1Y1W C;  1R9T C;  2E2H K;  5IP9 K;  2NVX C;  2YU9 K;  1XPP A;  5M5X K;  4A3B C;  5IP7 K;  3GTO C;  4Y7N K;  4Q5S A;  5IYC C;  4A3G C;  3FKI C;  1SFO K;  2JA5 C;  1WCM C;  2JA6 C;  3EQL A;  3S15 K;  5M5W K;  3DXJ A;  4ZH4 A;  4G7Z A;  4OIN A;  2NVQ C;  3GTK C;  3GTL C;  4XLP A;  3M3Y K;  1TWG C;  2E2I K;  3RZO C;  2NVY C;  4G7O A;  4XLN A;  2O5I A;  2R92 K;  4QIW D;  5FLM K;  3HKZ L;  4KN7 A;  4A3M C;  4QJV A;  4QJV B;  4A3I C;  1I6H C;  2PMZ L;  1I3Q K;  5C44 C;  2PPB A;  3GTQ C;  3HOY K;  1HQM A;  3S2D C;  5M3M K;  1I6V A;  4BY7 C;  4X6A K;  4BBS K;  4YFX A;  3HOV K;  3I4M K;  4A3L K;  4BY1 K;  2E2H C;  5IP9 C;  4A3F K;  4C3I K;  2JA7 K;  4Y52 K;  2A69 A;  5C4X C;  1SFO C;  4KMU A;  3S15 C;  5C4J K;  3M3Y C;  5C3E K;  5TMF A;  5IYD K;  2PA8 L;  5TMC A;  3GTP C;  5IYB C;  3PO3 C;  2E2I C;  2B63 K;  4OIO A;  4A3D K;  2CW0 A;  5M5Y K;  3PO2 K;  3HOU C;  4A3C C;  3GTM K;  3HOX K;  4Q4Z A;  1I3Q C;  2R7Z C;  2R93 K;  3HOY C;  4BXX C;  3M4O K;  4G7H A;  3HKZ D;  3I4N K;  4BBR K;  1TWC C;  2JA8 K;  3I4M C;  4BBS C;  4A3L C;  3GTG K;  4BY1 C;  2PMZ D;  4A3K K;  3S14 K;  3H3V L;  2JA7 C;  5D4D A;  1TWF K;  3S17 K;  4C2M K;  1TWA K;  3H0G K;  3K7A K;  4A3E K;  3S1R C;  4XSZ A;  2E2J K;  1IW7 A;  3S1M K;  1Y1V K;  3S2H K;  2YU9 C;  2NVT K;  2O5J A;  4LK1 A;  5IP7 C;  2B63 C;  4Y7N C;  4A3D C;  4MEX A;  3GTJ K;  3PO2 C;  3S16 K;  4YFK A;  1TWH K;  3S1Q K;  4A3J K;  3HOX C;  1Y1W K;  2PA8 D;  4GZY A;  1R9T K;  3HOZ K;  4A3B K;  2R92 C;  3GTO K;  3M4O C;  5IYC K;  4LJZ A;  5FLM C;  2JA5 K;  3I4N C;  4OIR A;  4A93 K;  1I50 K;  4YFN A;  4AYB L;  5FJ8 K;  3GTG C;  4A3K C;  2NVQ K;  1ZYR A;  3S14 C;  2BE5 A;  4JK1 A;  3CQZ K;  1TWG K;  3RZO K;  3S17 C;  5M3F K;  1TWA C;  1K83 K;  3H0G C;  1BDF A;  3S1N K;  2WB1 L;  2E2J C;  4X6A C;  3HOV C;  4A3I K;  1Y1V C;  3S2H C;  3H3V D;  4A3F C;  2NVT C;  3HOW K;  5C44 K;  2Y0S L;  4Y52 C;  4A3C K;  2WAQ L;  4OIQ A;  3GTJ C;  3S1Q C;  3S16 C;  4BY7 K;  1TWH C;  2A6E A;  5C4J C;  5C3E C;  5IYD C;  3RZD K;  1SMY A;  3HOZ C;  2A6H A;  5C4X K;  1YNJ A;  1YNN A;  4XSX A;  2VUM K;  3GTM C;  4A93 C;  1I50 C;  4C3H K;  4KN4 A;  3WOD A;  2NVX K;  3GTP K;  2R93 C;  3CQZ C;  5IYB K;  3PO3 K;  4NOI A;  4A3G K;  1K83 C;  3FKI K;  2JA6 K;  1WCM K;  4BBR C;  2A68 A;  4QIW L;  4OIP A;  2JA8 C;  3HOU K;  4AYB D;  3S1N C;  3GTK K;  3GTL K;  3HOW C;  1TWF C;  2R7Z K;  2NVY K;  4BXX K;  3K7A C;  4MEY A;  4A3E C;  2WB1 D; 
#chains in the Genus database with same CATH topology
 2ZUE A;  4YG2 A;  1TWC K;  3RZD C;  3S2D K;  3L4K A;  2VUM C;  3S1R K;  3SZZ A;  1R9T C;  2E2H K;  3GSI A;  5M5X K;  2VUM A;  3FKI C;  2JA5 C;  4PAA A;  1VH2 A;  1R9T A;  2ZUF A;  3S15 K;  4G0W A;  3DXJ A;  2NVQ C;  3GTL C;  3FKI A;  2JA5 A;  1TWG C;  1VLO A;  2O5I A;  3GDZ A;  4KMH A;  5FLM K;  1DCH A;  4KN7 A;  4A3M C;  3GTL A;  4QJV A;  1EI6 A;  1TWG A;  4QJV B;  4A3I C;  5JVO A;  1I6H C;  3L4J A;  1EQR A;  5C44 C;  1PJ7 A;  1HQM A;  5M3M K;  4BY7 C;  4X6A K;  4LR2 A;  4YFX A;  4C3I K;  2GAG C;  4Y52 K;  5TMF A;  2B63 K;  2XCQ A;  2FQO A;  3HOX K;  4Q4Z A;  1I3Q C;  2R7Z C;  3HOY C;  1I3Q A;  4KM9 A;  4BBS C;  2R7Z A;  2NVY A;  3AD9 C;  3GTG K;  4A3L C;  4A3K K;  2JA7 C;  3S17 K;  4P9S A;  3K7A K;  1IW7 A;  2JA7 A;  3S2H K;  4KAS A;  1EK8 A;  3TFH A;  5IP7 C;  4J3N A;  3GTJ K;  1O2B A;  4XCH A;  4YFK A;  1O29 A;  4AH6 A;  2PA8 D;  1R9T K;  4KB2 A;  3HOZ K;  3M4O C;  1V5V A;  2JA5 K;  1YX2 A;  4OIR A;  2E2I A;  4AYB L;  5FJ8 K;  2NVQ K;  1ZYR A;  2EBB A;  5E68 A;  1G51 A;  3CQZ K;  1TWG K;  1O27 A;  3HXA A;  1BDF A;  1L0W A;  3S1N K;  1VJE A;  5CJ9 A;  5CHP A;  3HOV C;  1ZBS A;  4A3I K;  4A3F C;  2NVT C;  5C44 K;  4P5A A;  1PJ6 A;  3S1Q C;  4BY7 K;  5C4J C;  1ZVU A;  1IS1 A;  4FM9 A;  3JST A;  3AH5 A;  1I50 C;  4C3H K;  1WOR A;  4GTD A;  4KN4 A;  2JA6 K;  1WCM K;  3BP3 A;  3CAG A;  4QIW L;  1O25 A;  4BLA A;  1WSR A;  1USM A;  1EH1 A;  3A8K A;  4C2M C;  2NVY K;  2R7Z K;  4A3E C;  2FQT A;  1ISE A;  2Y0S D;  1F9N A;  4LLG A;  3TFI A;  4MQ9 A;  1YCL A;  3BP8 C;  5TJ3 A;  5IP7 K;  3GTO C;  1SFO K;  3EQL A;  3TFJ A;  3GTK C;  4ZH4 A;  3G4C A;  4G7Z A;  4OIN A;  4G0V A;  1WOP A;  3GTO A;  3AD7 C;  4XLP A;  2E2I K;  3GTK A;  3HKZ L;  1BS2 A;  3NUH A;  2XCO A;  2PMZ L;  3GTQ C;  3AD8 C;  3OPF A;  3T00 A;  3GTQ A;  3I4M K;  3HOV K;  4BY1 K;  5IP9 C;  3A8J A;  4A3F K;  5C4J K;  1IL2 A;  3M3Y C;  1DD5 A;  1J6X A;  3VA7 A;  5IYB C;  4OIO A;  1VGX A;  3PO2 K;  5L46 A;  4WIL A;  4KB4 A;  4GTL A;  5JFE A;  1HI9 A;  3LAJ A;  3H3V L;  4C2M K;  4A3E K;  4C3J C;  1UV7 A;  2YU9 C;  2V6U A;  4LK1 A;  4A3D C;  4Y7N C;  1XZP A;  1XZP B;  2YU9 A;  3GEH A;  3S16 K;  1TWH K;  4KM8 A;  4ILD A;  4KC6 A;  3GTO K;  3I4N C;  1C0A A;  3LPX A;  3S14 C;  1IBA A;  2BE5 A;  4JK1 A;  1TWA C;  1K83 K;  3H0G C;  5EGE A;  2E2J C;  1KQ4 A;  1Y1V C;  1TWA A;  3H0G A;  4A3C K;  1Y1V A;  3IPJ A;  2A6E A;  4FZB A;  3RZD K;  4LQY A;  2CFA A;  2XCR B;  1JVI A;  2VUM K;  2PHC B;  1F7U A;  4A93 C;  2R93 C;  5IYB K;  1XZQ A;  3FKI K;  4BBR C;  4OIP A;  1WOS A;  2R93 A;  1USO A;  3GTL K;  3GEE A;  3HOW C;  2WB1 D;  4KMA A;  4A3M K;  3S1M C;  1I6H K;  2WAQ D;  4C3J K;  5HL8 A;  4A3J C;  1BGW A;  1XXC A;  4GTC A;  4O2D A;  2NVX C;  2YU9 K;  2D6F C;  1O26 A;  3N0C A;  4Y7N K;  4Q5S A;  5IYC C;  4A3G C;  2NVX A;  5M5W K;  1WOO A;  3RZO C;  1F93 A;  1ZQ1 C;  1I50 A;  4XLN A;  1DCO A;  1XXA A;  1IE0 A;  1I3Q K;  3T02 A;  2PPB A;  3HOY K;  3S2D C;  1O2A A;  3LAP A;  1I6V A;  2JH3 A;  4BLB A;  4BBS K;  4A3L K;  2E2H C;  2JA7 K;  2A69 A;  1J6W A;  5C4X C;  3S0X A;  2E2H A;  1X31 C;  4KMU A;  5EGH A;  3S15 C;  4KAT A;  1F7V A;  2PA8 L;  5TMC A;  3PO3 C;  4PAB A;  1XXB A;  1JQW A;  4WJ4 A;  2R93 K;  4BXX C;  3M4O K;  4G7H A;  4BBR K;  1DCP A;  5IOS A;  3TTG A;  5D4D A;  3Q3Q A;  3S1M K;  2NVT K;  3ADA C;  2B63 C;  4WJ3 M;  3S1Q K;  4A3J K;  3HOX C;  2B63 A;  3QX3 A;  2R92 C;  5IYC K;  1I50 K;  3G4A A;  3FOF A;  4A3K C;  3GTG C;  2R92 A;  3RZO K;  3S17 C;  3GTG A;  1WIH A;  3S2H C;  1WQH A;  2P8T A;  2Y0S L;  2Y3P A;  4P5B A;  2ZFZ A;  1PJ5 A;  1WSV A;  3SZY A;  4OIQ A;  3GTJ C;  5C3E C;  5IYD C;  1SMY A;  3GTJ A;  3HOZ C;  1O28 A;  5C4X K;  3GTM C;  5IOQ A;  3CQZ C;  3PO3 K;  3GTM A;  1RU0 A;  3S1N C;  2A68 A;  2GSN A;  2JA8 C;  4AYB D;  3CQZ A;  3GTK K;  1EFW A;  4LOW A;  1TWF C;  3OEP A;  3GIR A;  4BXX K;  2V6S A;  3BUE A;  4LK0 A;  1TWF A;  2P5M A;  5IOR A;  4BKW A;  3GTQ K;  4KMD A;  4DDQ A;  2RGR A;  4C3H C;  1Y1W C;  4GFQ A;  1O2F B;  5IP9 K;  1XPP A;  1INN A;  4A3B C;  2CFA B;  1B4B A;  1Y1W A;  2JA6 C;  1WCM C;  3N3Y A;  3M3Y K;  5IOT A;  4GT9 A;  2JA6 A;  1WCM A;  4G7O A;  1J98 A;  2NVY C;  1XZQ B;  2R92 K;  4GTA A;  4QIW D;  3ORE A;  2V6T A;  2GAH C;  2KWA A;  1J6V A;  2RH6 A;  3AQP A;  4GTF A;  2GSO A;  4GTB A;  1IQ0 A;  1SFO C;  4KDD A;  5C3E K;  3A8I A;  3MML B;  5IYD K;  1SFO A;  3GTP C;  1BJT A;  1O24 A;  2E2I C;  4A3D K;  4C45 A;  2CW0 A;  3FHZ A;  5M5Y K;  3HOU C;  3GTP A;  3FOE A;  3GTM K;  4KAW X;  3V4G A;  3HKZ D;  3I4N K;  1TWC C;  2JA8 K;  3I4M C;  4BY1 C;  2PMZ D;  3S14 K;  1WQG A;  1TWF K;  1TWC A;  1TWA K;  3H0G K;  3S1R C;  4XSZ A;  2E2J K;  1Y1V K;  2O5J A;  4KAR A;  4MEX A;  3PO2 C;  1GE9 A;  1JOE A;  1Y1W K;  4GZY A;  4M1X A;  4A3B K;  4LJZ A;  5FLM C;  4A93 K;  4YFN A;  2GSU A;  5M3F K;  1B4A A;  4X6A C;  2WB1 L;  1WQF A;  3H3V D;  4C3I C;  3HOW K;  4Y52 C;  2WAQ L;  3AQO A;  2W7V A;  1ZXO A;  3S16 C;  1TWH C;  3T01 A;  4G0U A;  1TWH A;  2A6H A;  1YNJ A;  1YNN A;  4RMF A;  4XSX A;  3ERE D;  3WOD A;  2NVX K;  3GTP K;  4NOI A;  4A3G K;  1K83 C;  3GEI A;  4GTE A;  3N0B A;  3HOU K;  1AB4 A;  1K83 A;  1VRQ C;  4A3C C;  3K7A C;  4MEY A; 
#chains in the Genus database with same CATH homology
 4LK0 A;  4YG2 A;  4A3M K;  1TWC K;  3S1M C;  1I6H K;  3RZD C;  2Y0S D;  3GTQ K;  4LLG A;  2WAQ D;  3S2D K;  4MQ9 A;  2VUM C;  4C3J K;  3S1R K;  4A3J C;  1Y1W C;  1R9T C;  2E2H K;  5IP9 K;  2NVX C;  2YU9 K;  1XPP A;  5M5X K;  4A3B C;  5IP7 K;  3GTO C;  4Y7N K;  4Q5S A;  5IYC C;  4A3G C;  3FKI C;  1SFO K;  2JA5 C;  1WCM C;  2JA6 C;  3EQL A;  3S15 K;  5M5W K;  3DXJ A;  4ZH4 A;  4G7Z A;  4OIN A;  2NVQ C;  3GTK C;  3GTL C;  4XLP A;  3M3Y K;  1TWG C;  2E2I K;  3RZO C;  2NVY C;  4G7O A;  4XLN A;  2O5I A;  2R92 K;  4QIW D;  5FLM K;  3HKZ L;  4KN7 A;  4A3M C;  4QJV A;  4QJV B;  4A3I C;  1I6H C;  2PMZ L;  1I3Q K;  5C44 C;  2PPB A;  3GTQ C;  3HOY K;  1HQM A;  3S2D C;  5M3M K;  1I6V A;  4BY7 C;  4X6A K;  4BBS K;  4YFX A;  3HOV K;  3I4M K;  4A3L K;  4BY1 K;  2E2H C;  5IP9 C;  4A3F K;  4C3I K;  2JA7 K;  4Y52 K;  2A69 A;  5C4X C;  1SFO C;  4KMU A;  3S15 C;  5C4J K;  3M3Y C;  5C3E K;  5TMF A;  5IYD K;  2PA8 L;  5TMC A;  3GTP C;  5IYB C;  3PO3 C;  2E2I C;  2B63 K;  4OIO A;  4A3D K;  2CW0 A;  5M5Y K;  3PO2 K;  3HOU C;  4A3C C;  3GTM K;  3HOX K;  4Q4Z A;  1I3Q C;  2R7Z C;  2R93 K;  3HOY C;  4BXX C;  3M4O K;  4G7H A;  3HKZ D;  3I4N K;  4BBR K;  1TWC C;  2JA8 K;  3I4M C;  4BBS C;  4A3L C;  3GTG K;  4BY1 C;  2PMZ D;  4A3K K;  3S14 K;  3H3V L;  2JA7 C;  5D4D A;  1TWF K;  3S17 K;  4C2M K;  1TWA K;  3H0G K;  3K7A K;  4A3E K;  3S1R C;  4XSZ A;  2E2J K;  1IW7 A;  3S1M K;  1Y1V K;  3S2H K;  2YU9 C;  2NVT K;  2O5J A;  4LK1 A;  5IP7 C;  2B63 C;  4Y7N C;  4A3D C;  4MEX A;  3GTJ K;  3PO2 C;  3S16 K;  4YFK A;  1TWH K;  3S1Q K;  4A3J K;  3HOX C;  1Y1W K;  2PA8 D;  4GZY A;  1R9T K;  3HOZ K;  4A3B K;  2R92 C;  3GTO K;  3M4O C;  5IYC K;  4LJZ A;  5FLM C;  2JA5 K;  3I4N C;  4OIR A;  4A93 K;  1I50 K;  4YFN A;  4AYB L;  5FJ8 K;  3GTG C;  4A3K C;  2NVQ K;  1ZYR A;  3S14 C;  2BE5 A;  4JK1 A;  3CQZ K;  1TWG K;  3RZO K;  3S17 C;  5M3F K;  1TWA C;  1K83 K;  3H0G C;  1BDF A;  3S1N K;  2WB1 L;  2E2J C;  4X6A C;  3HOV C;  4A3I K;  1Y1V C;  3S2H C;  3H3V D;  4A3F C;  2NVT C;  3HOW K;  5C44 K;  2Y0S L;  4Y52 C;  4A3C K;  2WAQ L;  4OIQ A;  3GTJ C;  3S1Q C;  3S16 C;  4BY7 K;  1TWH C;  2A6E A;  5C4J C;  5C3E C;  5IYD C;  3RZD K;  1SMY A;  3HOZ C;  2A6H A;  5C4X K;  1YNJ A;  1YNN A;  4XSX A;  2VUM K;  3GTM C;  4A93 C;  1I50 C;  4C3H K;  4KN4 A;  3WOD A;  2NVX K;  3GTP K;  2R93 C;  3CQZ C;  5IYB K;  3PO3 K;  4NOI A;  4A3G K;  1K83 C;  3FKI K;  2JA6 K;  1WCM K;  4BBR C;  2A68 A;  4QIW L;  4OIP A;  2JA8 C;  3HOU K;  4AYB D;  3S1N C;  3GTK K;  3GTL K;  3HOW C;  1TWF C;  2R7Z K;  2NVY K;  4BXX K;  3K7A C;  4MEY A;  4A3E C;  2WB1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...