1SFOK

Rna polymerase ii strand separated elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1sfoK00
5M3MK 5C4XK 4A93K 4BBSC 2WB1L 1TWAK 3GTGC 5M3FK 3S17C 5IP7C 4LK1A 4Y7NC 4C3IK 3S2HK 4LK0A 1TWGC 1I3QK 3GTPC 3HOWK 4BY1K 3HOUK 2NVYK 4A3EK 2R92K 2JA7K 3S16C 3GTPK 3GTMK 3M4OK 4KN7A 4QJVA 1SFOK 3S14C 4A3GK 2JA8K 2O5IA 1Y1WK 3S16K 5IYBC 2A6HA 3S1RK 4A3MK 5C4JK 4NOIA 3S15K 1I50C 3HOVC 1WCMC 4Q4ZA 3RZDC 4A3FK 4Y52C 5D4DA 4A3KC 3GTOC 1I6VA 1TWFK 2YU9C 4A3DK 2R93C 4KMUA 5TMFA 3S1NC 2O5JA 3GTJC 4XLPA 4BBSK 2NVQC 3GTGK 3S1NK 4A3DC 3GTLC 4YFNA 3GTJK 3CQZC 3RZOC 4A3CC 4MEYA 4QIWL 3S17K 5IP7K 4Y7NK 5FLMC 3CQZK 1IW7A 4C3JK 4YFKA 2JA6C 1TWGK 3DXJA 4AYBD 5IYDC 4BXXC 4JK1A 2A68A 4OIPA 3S1MC 4XSZA 4Q5SA 3S14K 5IP9C 5C3EC 3S1MK 4MQ9A 4A3LC 5IYBK 4LLGA 5TMCA 4BY7C 4QIWD 1TWCC 2PA8D 3I4NC 2E2HC 1YNJA 4MEXA 3H0GC 2E2JC 1I50K 2WAQD 3HOVK 1WCMK 3RZDK 3S2DC 2A69A 2E2IC 3FKIC 3GTQC 4AYBL 4Y52K 3PO2C 2PMZD 2R7ZC 1TWHC 4A3IC 2E2IK 3HOXC 4A3KK 1Y1VC 3GTOK 5FJ8K 2YU9K 4GZYA 1BDFA 3PO2K 2R93K 4XLNA 1TWHK 4A3IK 3I4MC 1K83C 5IYCC 4XSXA 2NVQK 3GTKC 3HOZC 2PA8L 3HKZD 4C3HK 3GTLK 3H3VD 1K83K 2NVXC 3M3YC 3RZOK 4A3CK 3K7AC 2BE5A 2WAQL 5C44C 1SMYA 2A6EA 5FLMK 2JA6K 3K7AK 4G7HA 5IYDK 1XPPA 2PMZL 4BXXK 1R9TC 4OIRA 4A93C 4G7OA 4OINA 5IP9K 5C3EK 4A3LK 4BY7K 1TWCK 3EQLA 3HKZL 3H3VL 3I4NK 4YFXA 2E2JK 1HQMA 3H0GK 2E2HK 1ZYRA 3S2HC 2B63C 3HOWC 1I3QC 3HOYC 4G7ZA 4BY1C 1YNNA 2NVYC 4YG2A 4A3EC 3HOUC 3S2DK 2R92C 3FKIK 2B63K 2JA7C 3GTQK 2Y0SD 4QJVB 3GTMC 3HOYK 2R7ZK 3M4OC 4A3GC 4ZH4A 3HOXK 1Y1VK 1SFOC 2JA8C 4OIOA 1Y1WC 3S1QC 1I6HC 4X6AC 4A3JC 3S1RC 4A3MC 3WODA 2WB1D 4LJZA 2VUMC 3I4MK 3PO3C 4OIQA 3S1QK 1I6HK 4X6AK 5IYCK 4A3JK 5C4JC 3GTKK 3PO3K 3HOZK 2VUMK 5M5XK 3M3YK 3S15C 2NVXK 4BBRC 5M5WK 2NVTC 5C44K 2CW0A 4A3FC 4BBRK 4A3BC 2NVTK 2JA5C 4C2MK 2Y0SL 5C4XC 4A3BK 1TWFC 5M5YK 2PPBA 4KN4A 2JA5K 1R9TK 1TWAC
chains in the Genus database with same CATH superfamily
5EGEA 2ZUFA 2V6UA 3IPJA 1WQHA 2P5MA 5IOSA 2RH6A 4LK1A 4BLBA 4Y7NC 2GSUA 4KM8A 4LK0A 1WOOA 3HXAA 1O2FB 3S2HK 4KATA 4G0UA 4GTAA 4GTFA 3FOEA 3GTPK 4LOWA 2R92A 3GTMA 1SFOA 3T02A 2A6HA 4A3MK 3LAPA 4NOIA 5IOTA 1WORA 4ILDA 3S15K 1J6VA 4A3KC 2YU9C 2FQOA 3AD7C 1GE9A 4A3DC 4YFNA 2ZUEA 3S0XA 4MEYA 2GSOA 4QIWL 2JH3A 4A3CC 1WSRA 1WSVA 1TWGK 4BXXC 2A68A 3S1MC 4Q5SA 1O27A 4A3LC 5CJ9A 2PA8D 4BKWA 3GSIA 2E2HC 4PABA 1J6XA 3HOVK 1DCOA 3RZDK 1WCMA 1PJ6A 3N0BA 1ZQ1C 4Y52K 4AYBL 2PMZD 1TWHC 2E2IK 3OEPA 4KM9A 3GTOA 4XLNA 1WOPA 4A3IK 2R93A 1B4BA 1BJTA 1TWHA 3GDZA 5IYCC 3H3VD 2NVXC 3GTLA 3RZOK 3K7AC 1BS2A 5C44C 2A6EA 1ZBSA 1UV7A 2NVXA 3CAGA 3AQOA 4PAAA 2XCRB 1XPPA 1V5VA 1WOSA 1F9NA 1HI9A 4A93C 1VRQC 3HKZL 3EQLA 1YX2A 2B63C 3HOWC 1I3QC 3A8IA 3OREA 4G7ZA 1YNNA 2NVYC 4A3EC 4BY1C 3S2DK 2Y0SD 1WQFA 3FKIA 2R7ZK 3GTQA 2B63A 3HOXK 2NVYA 1Y1WC 3S1QC 1Y1VA 3V4GA 1XZPB 4A3JC 3PO3C 4LR2A 4KARA 5C4JC 1YCLA 3HOZK 5M5XK 3GTKA 3TFHA 3TTGA 4A3FC 3QX3A 4GTEA 2NVTK 1TWFC 1O2BA 4KN4A 3GEHA 3Q3QA 5C4XK 4BBSC 2WB1L 1TWFA 3GTGC 5M3FK 1XXCA 5IP7C 3GTGA 2D6FC 4GTBA 3HOUK 1IE0A 2R92K 3GTMK 4KC6A 2JA7A 1IBAA 4A3GK 4KN7A 1DD5A 4QJVA 1SFOK 3S14C 2JA8K 2O5IA 1B4AA 3GIRA 5IYBC 4P5AA 5EGHA 1PJ7A 1I50C 1O2AA 4GFQA 1AB4A 1USOA 4KMUA 1USMA 3S1NC 2XCQA 5HL8A 2NVQC 1INNA 2CFAA 4BLAA 5L46A 1XXBA 3CQZC 3S17K 2GAGC 5FLMC 4YFKA 4C3JK 2JA6C 3CQZA 4JK1A 4OIPA 1G51A 5IP9C 3S1MK 2V6TA 4BY7C 3TFJA 1TWCC 3I4NC 3H0GC 1WCMK 1XZQA 3PO2C 4P5BA 3GTOK 3L4JA 1BDFA 2R93K 1TWHK 2YU9A 1JVIA 4KMAA 1EQRA 1VGXA 2PHCB 4P9SA 4C3HK 3GTLK 3M3YC 2BE5A 2WAQL 3K7AK 5IYDK 2XCOA 1R9TC 4FZBA 5C3EK 1WIHA 2GAHC 1J6WA 1PJ5A 2E2JK 1HQMA 2E2HA 3S2HC 3AH5A 3FKIK 2B63K 1O28A 3GTQK 1Y1VK 4OIOA 4A3MC 1VH2A 3I4MK 4LJZA 3SZZA 2VUMC 3A8KA 3S1QK 1DCPA 1VJEA 4A3JK 3GTKK 3PO3K 3S15C 2GSNA 2VUMA 1EK8A 4BBRC 4J3NA 4C2MC 2JA5C 4G0WA 1J98A 1F7UA 1TWAC 5M3MK 2JA5A 4KB4A 4GTCA 1TWAA 4C3IK 1KQ4A 1TWGC 4DDQA 1F93A 1I3QA 2JA7K 3S16C 1TWGA 3M4OK 3AQPA 3S1RK 1Y1WA 3HOVC 3RZDC 4GTLA 1IQ0A 4Y52C 3AD9C 1EI6A 4A3DK 5TMFA 3GTJC 1DCHA 3S1NK 2EBBA 3G4AA 3GTJA 3RZOC 1WQGA 3AD8C 4Y7NK 3CQZK 1IW7A 1O29A 3DXJA 2FQTA 4AYBD 3T01A 4WJ3M 4MQ9A 3A8JA 4LLGA 3LPXA 5TMCA 1O24A 1YNJA 4MEXA 1I50A 3BP8C 4KB2A 3S2DC 2R7ZC 3HOXC 4A3KK 1IS1A 2YU9K 3PO2K 5TJ3A 4KAWX 3ADAC 3FOFA 1K83C 3HOZC 2PA8L 3HKZD 4WILA 3N3YA 4A3CK 1K83A 1SMYA 1X31C 1L0WA 3JSTA 2JA6A 2PMZL 4BXXK 4M1XA 4OIRA 4G7OA 4OINA 4GT9A 4A3LK 3TFIA 3VA7A 3H3VL 2E2HK 1TWCA 4XCHA 4C45A 3H0GA 3HOYC 3HOUC 2R92C 3NUHA 4QJVB 3GTMC 4A3GC 1SFOC 1I6HC 4X6AC 2JA8C 1O26A 4WJ4A 2WB1D 5IYCK 2VUMK 2NVXK 5M5WK 1O25A 5C44K 2CW0A 4GTDA 1IL2A 4BBRK 4A3BC 2P8TA 1C0AA 3LAJA 4C2MK 2Y0SL 4RMFA 2JA5K 3GEEA 1R9TA 4A93K 2CFAB 4KASA 1TWAK 3N0CA 3S17C 5JVOA 3GEIA 3SZYA 4C3JC 3HOWK 1I3QK 3GTPC 4BY1K 2NVYK 4A3EK 3GTPA 1Y1WK 3S16K 1ISEA 1XZPA 3L4KA 2V6SA 5C4JK 1XZQB 1WCMC 4Q4ZA 3OPFA 1VLOA 1ZXOA 4A3FK 5D4DA 3BP3A 3GTOC 1I6VA 1TWFK 2R93C 2O5JA 4XLPA 4BBSK 2RGRA 3GTGK 4C3HC 3GTLC 3GTJK 4G0VA 1JOEA 5IP7K 1ZVUA 5IYDC 3G4CA 4XSZA 3S14K 5C3EC 5IYBK 1BGWA 4KDDA 4KMDA 4QIWD 1JQWA 2E2JC 1EFWA 1I50K 2WAQD 2A69A 2E2IC 3FKIC 3GTQC 2ZFZA 2KWAA 4A3IC 4GZYA 1Y1VC 5FJ8K 2E2IA 1F7VA 5IORA 3I4MC 5JFEA 5CHPA 2NVQK 4XSXA 3GTKC 1K83K 2Y3PA 5FLMK 2JA6K 5IOQA 4G7HA 3BUEA 4AH6A 1EH1A 5IP9K 4O2DA 4BY7K 1TWCK 3I4NK 5E68A 4YFXA 3H0GK 1ZYRA 4C3IC 4YG2A 2JA7C 3HOYK 3M4OC 4ZH4A 2R7ZA 2W7VA 3S1RC 1RU0A 3WODA 1XXAA 1I6HK 4X6AK 4OIQA 3T00A 3ERED 3M3YK 4LQYA 2NVTC 3MMLB 4KMHA 4FM9A 5C4XC 4A3BK 3FHZA 5M5YK 2PPBA 1R9TK
chains in the Genus database with same CATH topology
5M3MK 5C4XK 4A93K 4BBSC 2WB1L 1TWAK 3GTGC 5M3FK 3S17C 5IP7C 4LK1A 4Y7NC 4C3IK 3S2HK 4LK0A 1TWGC 1I3QK 3GTPC 3HOWK 4BY1K 3HOUK 2NVYK 4A3EK 2R92K 2JA7K 3S16C 3GTPK 3GTMK 3M4OK 4KN7A 4QJVA 1SFOK 3S14C 4A3GK 2JA8K 2O5IA 1Y1WK 3S16K 5IYBC 2A6HA 3S1RK 4A3MK 5C4JK 4NOIA 3S15K 1I50C 3HOVC 1WCMC 4Q4ZA 3RZDC 4A3FK 4Y52C 5D4DA 4A3KC 3GTOC 1I6VA 1TWFK 2YU9C 4A3DK 2R93C 4KMUA 5TMFA 3S1NC 2O5JA 3GTJC 4XLPA 4BBSK 2NVQC 3GTGK 3S1NK 4A3DC 3GTLC 4YFNA 3GTJK 3CQZC 3RZOC 4A3CC 4MEYA 4QIWL 3S17K 5IP7K 4Y7NK 5FLMC 3CQZK 1IW7A 4C3JK 4YFKA 2JA6C 1TWGK 3DXJA 4AYBD 5IYDC 4BXXC 4JK1A 2A68A 4OIPA 3S1MC 4XSZA 4Q5SA 3S14K 5IP9C 5C3EC 3S1MK 4MQ9A 4A3LC 5IYBK 4LLGA 5TMCA 4BY7C 4QIWD 1TWCC 2PA8D 3I4NC 2E2HC 1YNJA 4MEXA 3H0GC 2E2JC 1I50K 2WAQD 3HOVK 1WCMK 3RZDK 3S2DC 2A69A 2E2IC 3FKIC 3GTQC 4AYBL 4Y52K 3PO2C 2PMZD 2R7ZC 1TWHC 4A3IC 2E2IK 3HOXC 4A3KK 1Y1VC 3GTOK 5FJ8K 2YU9K 4GZYA 1BDFA 3PO2K 2R93K 4XLNA 1TWHK 4A3IK 3I4MC 1K83C 5IYCC 4XSXA 2NVQK 3GTKC 3HOZC 2PA8L 3HKZD 4C3HK 3GTLK 3H3VD 1K83K 2NVXC 3M3YC 3RZOK 4A3CK 3K7AC 2BE5A 2WAQL 5C44C 1SMYA 2A6EA 5FLMK 2JA6K 3K7AK 4G7HA 5IYDK 1XPPA 2PMZL 4BXXK 1R9TC 4OIRA 4A93C 4G7OA 4OINA 5IP9K 5C3EK 4A3LK 4BY7K 1TWCK 3EQLA 3HKZL 3H3VL 3I4NK 4YFXA 2E2JK 1HQMA 3H0GK 2E2HK 1ZYRA 3S2HC 2B63C 3HOWC 1I3QC 3HOYC 4G7ZA 4BY1C 1YNNA 2NVYC 4YG2A 4A3EC 3HOUC 3S2DK 2R92C 3FKIK 2B63K 2JA7C 3GTQK 2Y0SD 4QJVB 3GTMC 3HOYK 2R7ZK 3M4OC 4A3GC 4ZH4A 3HOXK 1Y1VK 1SFOC 2JA8C 4OIOA 1Y1WC 3S1QC 1I6HC 4X6AC 4A3JC 3S1RC 4A3MC 3WODA 2WB1D 4LJZA 2VUMC 3I4MK 3PO3C 4OIQA 3S1QK 1I6HK 4X6AK 5IYCK 4A3JK 5C4JC 3GTKK 3PO3K 3HOZK 2VUMK 5M5XK 3M3YK 3S15C 2NVXK 4BBRC 5M5WK 2NVTC 5C44K 2CW0A 4A3FC 4BBRK 4A3BC 2NVTK 2JA5C 4C2MK 2Y0SL 5C4XC 4A3BK 1TWFC 5M5YK 2PPBA 4KN4A 2JA5K 1R9TK 1TWAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M K;  5C4X K;  4A93 K;  4BBS C;  2WB1 L;  1TWA K;  3GTG C;  5M3F K;  3S17 C;  5IP7 C;  4LK1 A;  4Y7N C;  4C3I K;  3S2H K;  4LK0 A;  1TWG C;  1I3Q K;  3GTP C;  3HOW K;  4BY1 K;  3HOU K;  2NVY K;  4A3E K;  2R92 K;  2JA7 K;  3S16 C;  3GTP K;  3GTM K;  3M4O K;  4KN7 A;  4QJV A;  1SFO K;  3S14 C;  4A3G K;  2JA8 K;  2O5I A;  1Y1W K;  3S16 K;  5IYB C;  2A6H A;  3S1R K;  4A3M K;  5C4J K;  4NOI A;  3S15 K;  1I50 C;  3HOV C;  1WCM C;  4Q4Z A;  3RZD C;  4A3F K;  4Y52 C;  5D4D A;  4A3K C;  3GTO C;  1I6V A;  1TWF K;  2YU9 C;  4A3D K;  2R93 C;  4KMU A;  5TMF A;  3S1N C;  2O5J A;  3GTJ C;  4XLP A;  4BBS K;  2NVQ C;  3GTG K;  3S1N K;  4A3D C;  3GTL C;  4YFN A;  3GTJ K;  3CQZ C;  3RZO C;  4A3C C;  4MEY A;  4QIW L;  3S17 K;  5IP7 K;  4Y7N K;  5FLM C;  3CQZ K;  1IW7 A;  4C3J K;  4YFK A;  2JA6 C;  1TWG K;  3DXJ A;  4AYB D;  5IYD C;  4BXX C;  4JK1 A;  2A68 A;  4OIP A;  3S1M C;  4XSZ A;  4Q5S A;  3S14 K;  5IP9 C;  5C3E C;  3S1M K;  4MQ9 A;  4A3L C;  5IYB K;  4LLG A;  5TMC A;  4BY7 C;  4QIW D;  1TWC C;  2PA8 D;  3I4N C;  2E2H C;  1YNJ A;  4MEX A;  3H0G C;  2E2J C;  1I50 K;  2WAQ D;  3HOV K;  1WCM K;  3RZD K;  3S2D C;  2A69 A;  2E2I C;  3FKI C;  3GTQ C;  4AYB L;  4Y52 K;  3PO2 C;  2PMZ D;  2R7Z C;  1TWH C;  4A3I C;  2E2I K;  3HOX C;  4A3K K;  1Y1V C;  3GTO K;  5FJ8 K;  2YU9 K;  4GZY A;  1BDF A;  3PO2 K;  2R93 K;  4XLN A;  1TWH K;  4A3I K;  3I4M C;  1K83 C;  5IYC C;  4XSX A;  2NVQ K;  3GTK C;  3HOZ C;  2PA8 L;  3HKZ D;  4C3H K;  3GTL K;  3H3V D;  1K83 K;  2NVX C;  3M3Y C;  3RZO K;  4A3C K;  3K7A C;  2BE5 A;  2WAQ L;  5C44 C;  1SMY A;  2A6E A;  5FLM K;  2JA6 K;  3K7A K;  4G7H A;  5IYD K;  1XPP A;  2PMZ L;  4BXX K;  1R9T C;  4OIR A;  4A93 C;  4G7O A;  4OIN A;  5IP9 K;  5C3E K;  4A3L K;  4BY7 K;  1TWC K;  3EQL A;  3HKZ L;  3H3V L;  3I4N K;  4YFX A;  2E2J K;  1HQM A;  3H0G K;  2E2H K;  1ZYR A;  3S2H C;  2B63 C;  3HOW C;  1I3Q C;  3HOY C;  4G7Z A;  4BY1 C;  1YNN A;  2NVY C;  4YG2 A;  4A3E C;  3HOU C;  3S2D K;  2R92 C;  3FKI K;  2B63 K;  2JA7 C;  3GTQ K;  2Y0S D;  4QJV B;  3GTM C;  3HOY K;  2R7Z K;  3M4O C;  4A3G C;  4ZH4 A;  3HOX K;  1Y1V K;  1SFO C;  2JA8 C;  4OIO A;  1Y1W C;  3S1Q C;  1I6H C;  4X6A C;  4A3J C;  3S1R C;  4A3M C;  3WOD A;  2WB1 D;  4LJZ A;  2VUM C;  3I4M K;  3PO3 C;  4OIQ A;  3S1Q K;  1I6H K;  4X6A K;  5IYC K;  4A3J K;  5C4J C;  3GTK K;  3PO3 K;  3HOZ K;  2VUM K;  5M5X K;  3M3Y K;  3S15 C;  2NVX K;  4BBR C;  5M5W K;  2NVT C;  5C44 K;  2CW0 A;  4A3F C;  4BBR K;  4A3B C;  2NVT K;  2JA5 C;  4C2M K;  2Y0S L;  5C4X C;  4A3B K;  1TWF C;  5M5Y K;  2PPB A;  4KN4 A;  2JA5 K;  1R9T K;  1TWA C; 
#chains in the Genus database with same CATH topology
 5EGE A;  2ZUF A;  2V6U A;  3IPJ A;  1WQH A;  2P5M A;  5IOS A;  2RH6 A;  4LK1 A;  4BLB A;  4Y7N C;  2GSU A;  4KM8 A;  4LK0 A;  1WOO A;  3HXA A;  1O2F B;  3S2H K;  4KAT A;  4G0U A;  4GTA A;  4GTF A;  3FOE A;  3GTP K;  4LOW A;  2R92 A;  3GTM A;  1SFO A;  3T02 A;  2A6H A;  4A3M K;  3LAP A;  4NOI A;  5IOT A;  1WOR A;  4ILD A;  3S15 K;  1J6V A;  4A3K C;  2YU9 C;  2FQO A;  3AD7 C;  1GE9 A;  4A3D C;  4YFN A;  2ZUE A;  3S0X A;  4MEY A;  2GSO A;  4QIW L;  2JH3 A;  4A3C C;  1WSR A;  1WSV A;  1TWG K;  4BXX C;  2A68 A;  3S1M C;  4Q5S A;  1O27 A;  4A3L C;  5CJ9 A;  2PA8 D;  4BKW A;  3GSI A;  2E2H C;  4PAB A;  1J6X A;  3HOV K;  1DCO A;  3RZD K;  1WCM A;  1PJ6 A;  3N0B A;  1ZQ1 C;  4Y52 K;  4AYB L;  2PMZ D;  1TWH C;  2E2I K;  3OEP A;  4KM9 A;  3GTO A;  4XLN A;  1WOP A;  4A3I K;  2R93 A;  1B4B A;  1BJT A;  1TWH A;  3GDZ A;  5IYC C;  3H3V D;  2NVX C;  3GTL A;  3RZO K;  3K7A C;  1BS2 A;  5C44 C;  2A6E A;  1ZBS A;  1UV7 A;  2NVX A;  3CAG A;  3AQO A;  4PAA A;  2XCR B;  1XPP A;  1V5V A;  1WOS A;  1F9N A;  1HI9 A;  4A93 C;  1VRQ C;  3HKZ L;  3EQL A;  1YX2 A;  2B63 C;  3HOW C;  1I3Q C;  3A8I A;  3ORE A;  4G7Z A;  1YNN A;  2NVY C;  4A3E C;  4BY1 C;  3S2D K;  2Y0S D;  1WQF A;  3FKI A;  2R7Z K;  3GTQ A;  2B63 A;  3HOX K;  2NVY A;  1Y1W C;  3S1Q C;  1Y1V A;  3V4G A;  1XZP B;  4A3J C;  3PO3 C;  4LR2 A;  4KAR A;  5C4J C;  1YCL A;  3HOZ K;  5M5X K;  3GTK A;  3TFH A;  3TTG A;  4A3F C;  3QX3 A;  4GTE A;  2NVT K;  1TWF C;  1O2B A;  4KN4 A;  3GEH A;  3Q3Q A;  5C4X K;  4BBS C;  2WB1 L;  1TWF A;  3GTG C;  5M3F K;  1XXC A;  5IP7 C;  3GTG A;  2D6F C;  4GTB A;  3HOU K;  1IE0 A;  2R92 K;  3GTM K;  4KC6 A;  2JA7 A;  1IBA A;  4A3G K;  4KN7 A;  1DD5 A;  4QJV A;  1SFO K;  3S14 C;  2JA8 K;  2O5I A;  1B4A A;  3GIR A;  5IYB C;  4P5A A;  5EGH A;  1PJ7 A;  1I50 C;  1O2A A;  4GFQ A;  1AB4 A;  1USO A;  4KMU A;  1USM A;  3S1N C;  2XCQ A;  5HL8 A;  2NVQ C;  1INN A;  2CFA A;  4BLA A;  5L46 A;  1XXB A;  3CQZ C;  3S17 K;  2GAG C;  5FLM C;  4YFK A;  4C3J K;  2JA6 C;  3CQZ A;  4JK1 A;  4OIP A;  1G51 A;  5IP9 C;  3S1M K;  2V6T A;  4BY7 C;  3TFJ A;  1TWC C;  3I4N C;  3H0G C;  1WCM K;  1XZQ A;  3PO2 C;  4P5B A;  3GTO K;  3L4J A;  1BDF A;  2R93 K;  1TWH K;  2YU9 A;  1JVI A;  4KMA A;  1EQR A;  1VGX A;  2PHC B;  4P9S A;  4C3H K;  3GTL K;  3M3Y C;  2BE5 A;  2WAQ L;  3K7A K;  5IYD K;  2XCO A;  1R9T C;  4FZB A;  5C3E K;  1WIH A;  2GAH C;  1J6W A;  1PJ5 A;  2E2J K;  1HQM A;  2E2H A;  3S2H C;  3AH5 A;  3FKI K;  2B63 K;  1O28 A;  3GTQ K;  1Y1V K;  4OIO A;  4A3M C;  1VH2 A;  3I4M K;  4LJZ A;  3SZZ A;  2VUM C;  3A8K A;  3S1Q K;  1DCP A;  1VJE A;  4A3J K;  3GTK K;  3PO3 K;  3S15 C;  2GSN A;  2VUM A;  1EK8 A;  4BBR C;  4J3N A;  4C2M C;  2JA5 C;  4G0W A;  1J98 A;  1F7U A;  1TWA C;  5M3M K;  2JA5 A;  4KB4 A;  4GTC A;  1TWA A;  4C3I K;  1KQ4 A;  1TWG C;  4DDQ A;  1F93 A;  1I3Q A;  2JA7 K;  3S16 C;  1TWG A;  3M4O K;  3AQP A;  3S1R K;  1Y1W A;  3HOV C;  3RZD C;  4GTL A;  1IQ0 A;  4Y52 C;  3AD9 C;  1EI6 A;  4A3D K;  5TMF A;  3GTJ C;  1DCH A;  3S1N K;  2EBB A;  3G4A A;  3GTJ A;  3RZO C;  1WQG A;  3AD8 C;  4Y7N K;  3CQZ K;  1IW7 A;  1O29 A;  3DXJ A;  2FQT A;  4AYB D;  3T01 A;  4WJ3 M;  4MQ9 A;  3A8J A;  4LLG A;  3LPX A;  5TMC A;  1O24 A;  1YNJ A;  4MEX A;  1I50 A;  3BP8 C;  4KB2 A;  3S2D C;  2R7Z C;  3HOX C;  4A3K K;  1IS1 A;  2YU9 K;  3PO2 K;  5TJ3 A;  4KAW X;  3ADA C;  3FOF A;  1K83 C;  3HOZ C;  2PA8 L;  3HKZ D;  4WIL A;  3N3Y A;  4A3C K;  1K83 A;  1SMY A;  1X31 C;  1L0W A;  3JST A;  2JA6 A;  2PMZ L;  4BXX K;  4M1X A;  4OIR A;  4G7O A;  4OIN A;  4GT9 A;  4A3L K;  3TFI A;  3VA7 A;  3H3V L;  2E2H K;  1TWC A;  4XCH A;  4C45 A;  3H0G A;  3HOY C;  3HOU C;  2R92 C;  3NUH A;  4QJV B;  3GTM C;  4A3G C;  1SFO C;  1I6H C;  4X6A C;  2JA8 C;  1O26 A;  4WJ4 A;  2WB1 D;  5IYC K;  2VUM K;  2NVX K;  5M5W K;  1O25 A;  5C44 K;  2CW0 A;  4GTD A;  1IL2 A;  4BBR K;  4A3B C;  2P8T A;  1C0A A;  3LAJ A;  4C2M K;  2Y0S L;  4RMF A;  2JA5 K;  3GEE A;  1R9T A;  4A93 K;  2CFA B;  4KAS A;  1TWA K;  3N0C A;  3S17 C;  5JVO A;  3GEI A;  3SZY A;  4C3J C;  3HOW K;  1I3Q K;  3GTP C;  4BY1 K;  2NVY K;  4A3E K;  3GTP A;  1Y1W K;  3S16 K;  1ISE A;  1XZP A;  3L4K A;  2V6S A;  5C4J K;  1XZQ B;  1WCM C;  4Q4Z A;  3OPF A;  1VLO A;  1ZXO A;  4A3F K;  5D4D A;  3BP3 A;  3GTO C;  1I6V A;  1TWF K;  2R93 C;  2O5J A;  4XLP A;  4BBS K;  2RGR A;  3GTG K;  4C3H C;  3GTL C;  3GTJ K;  4G0V A;  1JOE A;  5IP7 K;  1ZVU A;  5IYD C;  3G4C A;  4XSZ A;  3S14 K;  5C3E C;  5IYB K;  1BGW A;  4KDD A;  4KMD A;  4QIW D;  1JQW A;  2E2J C;  1EFW A;  1I50 K;  2WAQ D;  2A69 A;  2E2I C;  3FKI C;  3GTQ C;  2ZFZ A;  2KWA A;  4A3I C;  4GZY A;  1Y1V C;  5FJ8 K;  2E2I A;  1F7V A;  5IOR A;  3I4M C;  5JFE A;  5CHP A;  2NVQ K;  4XSX A;  3GTK C;  1K83 K;  2Y3P A;  5FLM K;  2JA6 K;  5IOQ A;  4G7H A;  3BUE A;  4AH6 A;  1EH1 A;  5IP9 K;  4O2D A;  4BY7 K;  1TWC K;  3I4N K;  5E68 A;  4YFX A;  3H0G K;  1ZYR A;  4C3I C;  4YG2 A;  2JA7 C;  3HOY K;  3M4O C;  4ZH4 A;  2R7Z A;  2W7V A;  3S1R C;  1RU0 A;  3WOD A;  1XXA A;  1I6H K;  4X6A K;  4OIQ A;  3T00 A;  3ERE D;  3M3Y K;  4LQY A;  2NVT C;  3MML B;  4KMH A;  4FM9 A;  5C4X C;  4A3B K;  3FHZ A;  5M5Y K;  2PPB A;  1R9T K; 
#chains in the Genus database with same CATH homology
 5M3M K;  5C4X K;  4A93 K;  4BBS C;  2WB1 L;  1TWA K;  3GTG C;  5M3F K;  3S17 C;  5IP7 C;  4LK1 A;  4Y7N C;  4C3I K;  3S2H K;  4LK0 A;  1TWG C;  1I3Q K;  3GTP C;  3HOW K;  4BY1 K;  3HOU K;  2NVY K;  4A3E K;  2R92 K;  2JA7 K;  3S16 C;  3GTP K;  3GTM K;  3M4O K;  4KN7 A;  4QJV A;  1SFO K;  3S14 C;  4A3G K;  2JA8 K;  2O5I A;  1Y1W K;  3S16 K;  5IYB C;  2A6H A;  3S1R K;  4A3M K;  5C4J K;  4NOI A;  3S15 K;  1I50 C;  3HOV C;  1WCM C;  4Q4Z A;  3RZD C;  4A3F K;  4Y52 C;  5D4D A;  4A3K C;  3GTO C;  1I6V A;  1TWF K;  2YU9 C;  4A3D K;  2R93 C;  4KMU A;  5TMF A;  3S1N C;  2O5J A;  3GTJ C;  4XLP A;  4BBS K;  2NVQ C;  3GTG K;  3S1N K;  4A3D C;  3GTL C;  4YFN A;  3GTJ K;  3CQZ C;  3RZO C;  4A3C C;  4MEY A;  4QIW L;  3S17 K;  5IP7 K;  4Y7N K;  5FLM C;  3CQZ K;  1IW7 A;  4C3J K;  4YFK A;  2JA6 C;  1TWG K;  3DXJ A;  4AYB D;  5IYD C;  4BXX C;  4JK1 A;  2A68 A;  4OIP A;  3S1M C;  4XSZ A;  4Q5S A;  3S14 K;  5IP9 C;  5C3E C;  3S1M K;  4MQ9 A;  4A3L C;  5IYB K;  4LLG A;  5TMC A;  4BY7 C;  4QIW D;  1TWC C;  2PA8 D;  3I4N C;  2E2H C;  1YNJ A;  4MEX A;  3H0G C;  2E2J C;  1I50 K;  2WAQ D;  3HOV K;  1WCM K;  3RZD K;  3S2D C;  2A69 A;  2E2I C;  3FKI C;  3GTQ C;  4AYB L;  4Y52 K;  3PO2 C;  2PMZ D;  2R7Z C;  1TWH C;  4A3I C;  2E2I K;  3HOX C;  4A3K K;  1Y1V C;  3GTO K;  5FJ8 K;  2YU9 K;  4GZY A;  1BDF A;  3PO2 K;  2R93 K;  4XLN A;  1TWH K;  4A3I K;  3I4M C;  1K83 C;  5IYC C;  4XSX A;  2NVQ K;  3GTK C;  3HOZ C;  2PA8 L;  3HKZ D;  4C3H K;  3GTL K;  3H3V D;  1K83 K;  2NVX C;  3M3Y C;  3RZO K;  4A3C K;  3K7A C;  2BE5 A;  2WAQ L;  5C44 C;  1SMY A;  2A6E A;  5FLM K;  2JA6 K;  3K7A K;  4G7H A;  5IYD K;  1XPP A;  2PMZ L;  4BXX K;  1R9T C;  4OIR A;  4A93 C;  4G7O A;  4OIN A;  5IP9 K;  5C3E K;  4A3L K;  4BY7 K;  1TWC K;  3EQL A;  3HKZ L;  3H3V L;  3I4N K;  4YFX A;  2E2J K;  1HQM A;  3H0G K;  2E2H K;  1ZYR A;  3S2H C;  2B63 C;  3HOW C;  1I3Q C;  3HOY C;  4G7Z A;  4BY1 C;  1YNN A;  2NVY C;  4YG2 A;  4A3E C;  3HOU C;  3S2D K;  2R92 C;  3FKI K;  2B63 K;  2JA7 C;  3GTQ K;  2Y0S D;  4QJV B;  3GTM C;  3HOY K;  2R7Z K;  3M4O C;  4A3G C;  4ZH4 A;  3HOX K;  1Y1V K;  1SFO C;  2JA8 C;  4OIO A;  1Y1W C;  3S1Q C;  1I6H C;  4X6A C;  4A3J C;  3S1R C;  4A3M C;  3WOD A;  2WB1 D;  4LJZ A;  2VUM C;  3I4M K;  3PO3 C;  4OIQ A;  3S1Q K;  1I6H K;  4X6A K;  5IYC K;  4A3J K;  5C4J C;  3GTK K;  3PO3 K;  3HOZ K;  2VUM K;  5M5X K;  3M3Y K;  3S15 C;  2NVX K;  4BBR C;  5M5W K;  2NVT C;  5C44 K;  2CW0 A;  4A3F C;  4BBR K;  4A3B C;  2NVT K;  2JA5 C;  4C2M K;  2Y0S L;  5C4X C;  4A3B K;  1TWF C;  5M5Y K;  2PPB A;  4KN4 A;  2JA5 K;  1R9T K;  1TWA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...