1SFOK

Rna polymerase ii strand separated elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA STRAND
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1sfoK00
3S14K 5C4XC 3S1RK 3GTMC 1SFOK 4AYBL 3M3YK 3HKZL 4JK1A 3S14C 3M3YC 5IYCK 2E2IC 2WB1D 4G7HA 2R7ZK 4G7OA 3S1RC 4A3JK 3M4OC 1SFOC 5C3EC 2NVTK 2JA6C 1HQMA 5C4XK 1TWHC 4A3MC 4Y52C 2A6EA 5TMCA 3S1MK 4BY1K 4A3EC 3GTPK 3H3VD 3GTJC 3HOWC 2PMZL 4LLGA 3GTPC 1SMYA 3HOWK 4LK0A 3GTGC 3S1MC 2Y0SL 4A3MK 4Y52K 1IW7A 4C3JK 3S2DK 3GTJK 3S15C 4BY1C 4MEXA 3PO3C 2JA7K 3M4OK 4OIOA 1TWAC 2YU9C 2CW0A 4XSZA 1I3QK 4C2MK 2E2IK 4QJVA 4BBSC 2JA5K 3HOZK 2Y0SD 4XSXA 2JA5C 4A3CC 3S17C 2BE5A 1I3QC 2WB1L 4YG2A 4YFKA 4OIQA 2A6HA 2NVYK 2VUMC 4GZYA 4A3IK 5C44C 4C3HK 4AYBD 4KN7A 2R92C 1I6HC 2B63C 4A3GC 5TMFA 3S2DC 4A3FC 2WAQD 3FKIK 4BBRK 3GTGK 3GTLK 5IYDK 2WAQL 3HOXC 1TWCK 2A69A 4A3DC 2E2HK 2R93C 4MEYA 3GTKC 1Y1VK 3S2HK 4C3IK 4XLNA 2E2JC 5M3MK 1TWGK 3PO2K 5M5WK 4NOIA 4BXXK 4ZH4A 3GTQK 3S2HC 1Y1WC 4MQ9A 3HOVC 2R7ZC 3HOUK 5IP9C 1R9TK 5IP7K 2PA8L 4QIWD 4Q5SA 3K7AK 4A3LC 4A3BK 3GTMK 2NVQK 1TWFK 5FLMK 3RZDC 1WCMK 3CQZC 3S1NK 4A3KC 4Y7NK 1WCMC 3CQZK 3HOYK 1TWFC 3RZDK 1K83C 3S1QK 2PPBA 4A3BC 3GTOC 3HOYC 4YFXA 4BY7K 5C4JK 4BY7C 4KN4A 2PMZD 5IP7C 5FLMC 4Y7NC 2A68A 3S17K 4A3KK 3K7AC 4A3LK 3GTQC 4X6AC 2NVQC 3I4NK 2JA8C 2O5JA 5IP9K 1I50K 1R9TC 3H0GK 3HKZD 1YNJA 4A93K 1TWAK 3RZOC 2PA8D 4QIWL 2NVXC 2JA7C 3PO3K 3HOVK 3EQLA 4A93C 2NVXK 3RZOK 4QJVB 3I4NC 3H0GC 4X6AK 4G7ZA 1I50C 1XPPA 3WODA 3GTKK 4Q4ZA 2R92K 4A3EK 1K83K 4YFNA 4XLPA 5C44K 5M3FK 2NVYC 3FKIC 4BBRC 1I6HK 4A3FK 2JA6K 2NVTC 4A3GK 4BBSK 2VUMK 1I6VA 4OIPA 2YU9K 4A3CK 4OINA 3HOUC 3S1NC 1ZYRA 4BXXC 3S15K 3HOZC 3I4MK 2E2JK 1TWGC 3PO2C 2O5IA 1Y1WK 1TWCC 3HOXK 3GTLC 4A3DK 5D4DA 2JA8K 3S16K 5M5YK 5IYBC 1YNNA 4LJZA 5M5XK 5IYDC 1Y1VC 5IYBK 1BDFA 5FJ8K 4LK1A 2E2HC 3S16C 1TWHK 3DXJA 2R93K 5C4JC 2B63K 4KMUA 3GTOK 4A3JC 3H3VL 3S1QC 5IYCC 4A3IC 4OIRA 3I4MC 5C3EK
chains in the Genus database with same CATH superfamily
2ZUFA 3S1RK 4AYBL 5IYCK 3M4OC 2V6UA 1DCHA 1UV7A 5TJ3A 4Y52C 4KMAA 1XZPB 4BY1K 4A3EC 5JFEA 4KB4A 1BS2A 5CJ9A 1L0WA 4LLGA 3N0CA 3S1MC 1DCPA 1VGXA 3H0GA 3T02A 1WOSA 2ZUEA 1PJ5A 3PO3C 1PJ6A 2P8TA 3HOZK 2Y0SD 1J98A 4P9SA 1ZQ1C 2BE5A 4YFKA 2VUMC 4GZYA 4C3HK 3GIRA 2R92C 1I6HC 2B63C 1GE9A 2RH6A 3S0XA 4BBRK 5IYDK 2WAQL 2A69A 1JQWA 4KM8A 4BLBA 3N0BA 2GSOA 3G4CA 4ZH4A 3AQOA 1Y1WC 4MQ9A 1IL2A 3HOUK 1R9TK 2PA8L 3K7AK 4A3LC 1TWFK 3CQZC 4A3KC 1WCMC 4FZBA 3RZDK 4BY7K 4A3BC 3HOYC 4YFXA 4KN4A 1TWFA 1XZQA 5FLMC 2A68A 5HL8A 2NVQC 3I4NK 3RZOC 1B4AA 2KWAA 3EQLA 2NVXK 3H0GC 4G7ZA 1DCOA 3GTKK 1WORA 5IOTA 4G0VA 1EI6A 2NVYC 1X31C 4BBRC 3L4JA 3AD7C 4BBSK 1F7UA 3S1NC 1C0AA 3I4MK 2O5IA 1WOPA 1Y1WK 2R93A 1TWCC 2FQTA 5D4DA 2JA8K 3S16K 1JVIA 4KATA 2E2IA 2R93K 3S16C 3FHZA 1EFWA 1VLOA 1WCMA 4WJ3M 1Y1WA 5L46A 4OIRA 1O24A 1O2FB 1V5VA 3S14K 1J6XA 4KASA 1SFOK 4JK1A 3T01A 3M3YC 2E2IC 4A3JK 1HQMA 5C4XK 1TWHC 1VJEA 3LAPA 3CAGA 3AH5A 4G0UA 3GTPC 3HOWK 3GTGC 4A3MK 1TWAA 2GSNA 3S15C 4MEXA 2NVXA 4OIOA 2CW0A 2NVYA 4XSZA 2JA5C 3NUHA 4YG2A 1BJTA 3GTGA 4A3IK 1EH1A 4RMFA 3S2DC 3GTLK 4M1XA 3HOXC 4A3DC 1WQGA 2R93C 4XLNA 1J6VA 4PAAA 4NOIA 3GTQK 3S2HC 4GTFA 1DD5A 1BGWA 5FLMK 3S1NK 2GSUA 3HOYK 1ZBSA 3GTOC 2PMZD 5IP7C 3GTPA 4Y7NC 3K7AC 4A3LK 4KMDA 1VRQC 1R9TC 3HKZD 1ISEA 1EK8A 2Y3PA 3GEEA 4P5AA 2PA8D 2NVXC 4A93C 3PO3K 4LR2A 4C3JC 5EGHA 3AD9C 1XPPA 4Q4ZA 4A3EK 3HXAA 5C44K 3FKIC 1I6HK 1VH2A 4A3FK 3BP8C 4C3HC 4A3GK 1I3QA 2VUMK 2D6FC 1PJ7A 4PABA 2YU9K 3HOUC 1O28A 1ZYRA 1B4BA 4BXXC 3A8KA 3I4MC 3S15K 1J6WA 3A8IA 2XCQA 3OREA 4WILA 3GSIA 3FOEA 3SZYA 1USMA 1O29A 4A3DK 5IYBC 1YNNA 5M5XK 5CHPA 1Y1VC 2ZFZA 4LK1A 1TWHK 3SZZA 2XCOA 4A3JC 3GTOK 4KM9A 4A3IC 2E2IK 2W7VA 3GTMC 1IS1A 4C45A 4FM9A 3M3YK 3GTOA 3HKZL 4GFQA 1XZQB 2WB1D 4G7HA 2R7ZK 3S1RC 5C3EC 4ILDA 2RGRA 2NVTK 2JA6C 1JOEA 2P5MA 3S1MK 3GTPK 3H3VD 3HOWC 4O2DA 2PMZL 1SMYA 3TFIA 2Y0SL 1IW7A 3S2DK 4GTBA 4BY1C 3FOFA 3TFHA 2JA7K 1WQHA 1TWAC 2YU9C 1I3QK 1YX2A 4KC6A 4QJVA 4C2MK 1WSVA 3ERED 2JA5K 1O2BA 4XSXA 4A3CC 4LQYA 1YCLA 4OIQA 1I3QC 1WQFA 4C2MC 2NVYK 5C44C 1TWCA 3A8JA 1ZXOA 3TFJA 4MEYA 4C3IK 1EQRA 2CFAA 2E2JC 1WSRA 5M3MK 4P5BA 3GTMA 2E2HA 3HOVC 2R7ZC 5IP9C 3V4GA 5IP7K 4QIWD 4Q5SA 4BKWA 4A3BK 3GTMK 3RZDC 1XZPA 1TWHA 1TWFC 1K83C 4LOWA 2PPBA 1WOOA 4KMHA 3S17K 3GTQC 4X6AC 5IOQA 3Q3QA 1I50K 3H0GK 1HI9A 1YNJA 1TWAK 3GTJA 4A93K 2JA7C 3HOVK 3RZOK 4QJVB 1IQ0A 1K83A 4X6AK 2JA5A 3WODA 1F93A 1AB4A 2EBBA 2R92K 1IBAA 1K83K 5M3FK 3BP3A 4KDDA 2JA6K 2NVTC 3FKIA 3OPFA 4DDQA 1O25A 1I6VA 4OINA 2CFAB 4AH6A 2E2JK 3LAJA 3GDZA 2B63A 3GTLC 5M5YK 4LJZA 5IYDC 5IYBK 5FJ8K 1BDFA 2E2HC 4KB2A 5E68A 2B63K 3AQPA 5IYCC 3GTQA 5C4XC 3ADAC 1R9TA 5IORA 3S14C 4G7OA 4GTEA 1SFOC 3CQZA 4A3MC 2A6EA 5TMCA 1XXBA 3GTJC 4G0WA 2JA7A 4LK0A 4Y52K 4C3JK 3GTJK 1INNA 5JVOA 2JA6A 3M4OK 4WJ4A 3QX3A 3T00A 4BBSC 2YU9A 3N3YA 3GTKA 3S17C 1ZVUA 3BUEA 2WB1L 2PHCB 2R92A 2A6HA 3GEHA 4AYBD 4KN7A 2FQOA 3IPJA 4A3GC 5TMFA 4A3FC 2WAQD 3FKIK 3GTGK 1KQ4A 1TWGA 3JSTA 1G51A 1TWCK 2V6TA 4GT9A 4GTCA 2E2HK 3GTKC 1Y1VK 3S2HK 1RU0A 1TWGK 3PO2K 5M5WK 3G4AA 3GTLA 4GTAA 4BXXK 4J3NA 2R7ZA 1XXAA 2NVQK 1WCMK 3OEPA 4Y7NK 3CQZK 3S1QK 3VA7A 3TTGA 1I50A 5C4JK 4BY7C 1O2AA 2GAGC 4A3KK 1SFOA 2JH3A 2JA8C 2O5JA 3AD8C 5IP9K 4KAWX 5EGEA 4QIWL 4GTDA 2GAHC 3I4NC 1F9NA 1I50C 3GEIA 3LPXA 4YFNA 4XLPA 4XCHA 4GTLA 2XCRB 4OIPA 1O27A 4A3CK 2V6SA 3HOZC 1USOA 2VUMA 1TWGC 3PO2C 4KARA 4BLAA 1F7VA 3HOXK 3L4KA 5IOSA 4C3IC 3DXJA 1XXCA 3MMLB 1Y1VA 5C4JC 4KMUA 3H3VL 1O26A 3S1QC 1WIHA 1IE0A 5C3EK
chains in the Genus database with same CATH topology
3S14K 5C4XC 3S1RK 3GTMC 1SFOK 4AYBL 3M3YK 3HKZL 4JK1A 3S14C 3M3YC 5IYCK 2E2IC 2WB1D 4G7HA 2R7ZK 4G7OA 3S1RC 4A3JK 3M4OC 1SFOC 5C3EC 2NVTK 2JA6C 1HQMA 5C4XK 1TWHC 4A3MC 4Y52C 2A6EA 5TMCA 3S1MK 4BY1K 4A3EC 3GTPK 3H3VD 3GTJC 3HOWC 2PMZL 4LLGA 3GTPC 1SMYA 3HOWK 4LK0A 3GTGC 3S1MC 2Y0SL 4A3MK 4Y52K 1IW7A 4C3JK 3S2DK 3GTJK 3S15C 4BY1C 4MEXA 3PO3C 2JA7K 3M4OK 4OIOA 1TWAC 2YU9C 2CW0A 4XSZA 1I3QK 4C2MK 2E2IK 4QJVA 4BBSC 2JA5K 3HOZK 2Y0SD 4XSXA 2JA5C 4A3CC 3S17C 2BE5A 1I3QC 2WB1L 4YG2A 4YFKA 4OIQA 2A6HA 2NVYK 2VUMC 4GZYA 4A3IK 5C44C 4C3HK 4AYBD 4KN7A 2R92C 1I6HC 2B63C 4A3GC 5TMFA 3S2DC 4A3FC 2WAQD 3FKIK 4BBRK 3GTGK 3GTLK 5IYDK 2WAQL 3HOXC 1TWCK 2A69A 4A3DC 2E2HK 2R93C 4MEYA 3GTKC 1Y1VK 3S2HK 4C3IK 4XLNA 2E2JC 5M3MK 1TWGK 3PO2K 5M5WK 4NOIA 4BXXK 4ZH4A 3GTQK 3S2HC 1Y1WC 4MQ9A 3HOVC 2R7ZC 3HOUK 5IP9C 1R9TK 5IP7K 2PA8L 4QIWD 4Q5SA 3K7AK 4A3LC 4A3BK 3GTMK 2NVQK 1TWFK 5FLMK 3RZDC 1WCMK 3CQZC 3S1NK 4A3KC 4Y7NK 1WCMC 3CQZK 3HOYK 1TWFC 3RZDK 1K83C 3S1QK 2PPBA 4A3BC 3GTOC 3HOYC 4YFXA 4BY7K 5C4JK 4BY7C 4KN4A 2PMZD 5IP7C 5FLMC 4Y7NC 2A68A 3S17K 4A3KK 3K7AC 4A3LK 3GTQC 4X6AC 2NVQC 3I4NK 2JA8C 2O5JA 5IP9K 1I50K 1R9TC 3H0GK 3HKZD 1YNJA 4A93K 1TWAK 3RZOC 2PA8D 4QIWL 2NVXC 2JA7C 3PO3K 3HOVK 3EQLA 4A93C 2NVXK 3RZOK 4QJVB 3I4NC 3H0GC 4X6AK 4G7ZA 1I50C 1XPPA 3WODA 3GTKK 4Q4ZA 2R92K 4A3EK 1K83K 4YFNA 4XLPA 5C44K 5M3FK 2NVYC 3FKIC 4BBRC 1I6HK 4A3FK 2JA6K 2NVTC 4A3GK 4BBSK 2VUMK 1I6VA 4OIPA 2YU9K 4A3CK 4OINA 3HOUC 3S1NC 1ZYRA 4BXXC 3S15K 3HOZC 3I4MK 2E2JK 1TWGC 3PO2C 2O5IA 1Y1WK 1TWCC 3HOXK 3GTLC 4A3DK 5D4DA 2JA8K 3S16K 5M5YK 5IYBC 1YNNA 4LJZA 5M5XK 5IYDC 1Y1VC 5IYBK 1BDFA 5FJ8K 4LK1A 2E2HC 3S16C 1TWHK 3DXJA 2R93K 5C4JC 2B63K 4KMUA 3GTOK 4A3JC 3H3VL 3S1QC 5IYCC 4A3IC 4OIRA 3I4MC 5C3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 K;  5C4X C;  3S1R K;  3GTM C;  1SFO K;  4AYB L;  3M3Y K;  3HKZ L;  4JK1 A;  3S14 C;  3M3Y C;  5IYC K;  2E2I C;  2WB1 D;  4G7H A;  2R7Z K;  4G7O A;  3S1R C;  4A3J K;  3M4O C;  1SFO C;  5C3E C;  2NVT K;  2JA6 C;  1HQM A;  5C4X K;  1TWH C;  4A3M C;  4Y52 C;  2A6E A;  5TMC A;  3S1M K;  4BY1 K;  4A3E C;  3GTP K;  3H3V D;  3GTJ C;  3HOW C;  2PMZ L;  4LLG A;  3GTP C;  1SMY A;  3HOW K;  4LK0 A;  3GTG C;  3S1M C;  2Y0S L;  4A3M K;  4Y52 K;  1IW7 A;  4C3J K;  3S2D K;  3GTJ K;  3S15 C;  4BY1 C;  4MEX A;  3PO3 C;  2JA7 K;  3M4O K;  4OIO A;  1TWA C;  2YU9 C;  2CW0 A;  4XSZ A;  1I3Q K;  4C2M K;  2E2I K;  4QJV A;  4BBS C;  2JA5 K;  3HOZ K;  2Y0S D;  4XSX A;  2JA5 C;  4A3C C;  3S17 C;  2BE5 A;  1I3Q C;  2WB1 L;  4YG2 A;  4YFK A;  4OIQ A;  2A6H A;  2NVY K;  2VUM C;  4GZY A;  4A3I K;  5C44 C;  4C3H K;  4AYB D;  4KN7 A;  2R92 C;  1I6H C;  2B63 C;  4A3G C;  5TMF A;  3S2D C;  4A3F C;  2WAQ D;  3FKI K;  4BBR K;  3GTG K;  3GTL K;  5IYD K;  2WAQ L;  3HOX C;  1TWC K;  2A69 A;  4A3D C;  2E2H K;  2R93 C;  4MEY A;  3GTK C;  1Y1V K;  3S2H K;  4C3I K;  4XLN A;  2E2J C;  5M3M K;  1TWG K;  3PO2 K;  5M5W K;  4NOI A;  4BXX K;  4ZH4 A;  3GTQ K;  3S2H C;  1Y1W C;  4MQ9 A;  3HOV C;  2R7Z C;  3HOU K;  5IP9 C;  1R9T K;  5IP7 K;  2PA8 L;  4QIW D;  4Q5S A;  3K7A K;  4A3L C;  4A3B K;  3GTM K;  2NVQ K;  1TWF K;  5FLM K;  3RZD C;  1WCM K;  3CQZ C;  3S1N K;  4A3K C;  4Y7N K;  1WCM C;  3CQZ K;  3HOY K;  1TWF C;  3RZD K;  1K83 C;  3S1Q K;  2PPB A;  4A3B C;  3GTO C;  3HOY C;  4YFX A;  4BY7 K;  5C4J K;  4BY7 C;  4KN4 A;  2PMZ D;  5IP7 C;  5FLM C;  4Y7N C;  2A68 A;  3S17 K;  4A3K K;  3K7A C;  4A3L K;  3GTQ C;  4X6A C;  2NVQ C;  3I4N K;  2JA8 C;  2O5J A;  5IP9 K;  1I50 K;  1R9T C;  3H0G K;  3HKZ D;  1YNJ A;  4A93 K;  1TWA K;  3RZO C;  2PA8 D;  4QIW L;  2NVX C;  2JA7 C;  3PO3 K;  3HOV K;  3EQL A;  4A93 C;  2NVX K;  3RZO K;  4QJV B;  3I4N C;  3H0G C;  4X6A K;  4G7Z A;  1I50 C;  1XPP A;  3WOD A;  3GTK K;  4Q4Z A;  2R92 K;  4A3E K;  1K83 K;  4YFN A;  4XLP A;  5C44 K;  5M3F K;  2NVY C;  3FKI C;  4BBR C;  1I6H K;  4A3F K;  2JA6 K;  2NVT C;  4A3G K;  4BBS K;  2VUM K;  1I6V A;  4OIP A;  2YU9 K;  4A3C K;  4OIN A;  3HOU C;  3S1N C;  1ZYR A;  4BXX C;  3S15 K;  3HOZ C;  3I4M K;  2E2J K;  1TWG C;  3PO2 C;  2O5I A;  1Y1W K;  1TWC C;  3HOX K;  3GTL C;  4A3D K;  5D4D A;  2JA8 K;  3S16 K;  5M5Y K;  5IYB C;  1YNN A;  4LJZ A;  5M5X K;  5IYD C;  1Y1V C;  5IYB K;  1BDF A;  5FJ8 K;  4LK1 A;  2E2H C;  3S16 C;  1TWH K;  3DXJ A;  2R93 K;  5C4J C;  2B63 K;  4KMU A;  3GTO K;  4A3J C;  3H3V L;  3S1Q C;  5IYC C;  4A3I C;  4OIR A;  3I4M C;  5C3E K; 
#chains in the Genus database with same CATH topology
 2ZUF A;  3S1R K;  4AYB L;  5IYC K;  3M4O C;  2V6U A;  1DCH A;  1UV7 A;  5TJ3 A;  4Y52 C;  4KMA A;  1XZP B;  4BY1 K;  4A3E C;  5JFE A;  4KB4 A;  1BS2 A;  5CJ9 A;  1L0W A;  4LLG A;  3N0C A;  3S1M C;  1DCP A;  1VGX A;  3H0G A;  3T02 A;  1WOS A;  2ZUE A;  1PJ5 A;  3PO3 C;  1PJ6 A;  2P8T A;  3HOZ K;  2Y0S D;  1J98 A;  4P9S A;  1ZQ1 C;  2BE5 A;  4YFK A;  2VUM C;  4GZY A;  4C3H K;  3GIR A;  2R92 C;  1I6H C;  2B63 C;  1GE9 A;  2RH6 A;  3S0X A;  4BBR K;  5IYD K;  2WAQ L;  2A69 A;  1JQW A;  4KM8 A;  4BLB A;  3N0B A;  2GSO A;  3G4C A;  4ZH4 A;  3AQO A;  1Y1W C;  4MQ9 A;  1IL2 A;  3HOU K;  1R9T K;  2PA8 L;  3K7A K;  4A3L C;  1TWF K;  3CQZ C;  4A3K C;  1WCM C;  4FZB A;  3RZD K;  4BY7 K;  4A3B C;  3HOY C;  4YFX A;  4KN4 A;  1TWF A;  1XZQ A;  5FLM C;  2A68 A;  5HL8 A;  2NVQ C;  3I4N K;  3RZO C;  1B4A A;  2KWA A;  3EQL A;  2NVX K;  3H0G C;  4G7Z A;  1DCO A;  3GTK K;  1WOR A;  5IOT A;  4G0V A;  1EI6 A;  2NVY C;  1X31 C;  4BBR C;  3L4J A;  3AD7 C;  4BBS K;  1F7U A;  3S1N C;  1C0A A;  3I4M K;  2O5I A;  1WOP A;  1Y1W K;  2R93 A;  1TWC C;  2FQT A;  5D4D A;  2JA8 K;  3S16 K;  1JVI A;  4KAT A;  2E2I A;  2R93 K;  3S16 C;  3FHZ A;  1EFW A;  1VLO A;  1WCM A;  4WJ3 M;  1Y1W A;  5L46 A;  4OIR A;  1O24 A;  1O2F B;  1V5V A;  3S14 K;  1J6X A;  4KAS A;  1SFO K;  4JK1 A;  3T01 A;  3M3Y C;  2E2I C;  4A3J K;  1HQM A;  5C4X K;  1TWH C;  1VJE A;  3LAP A;  3CAG A;  3AH5 A;  4G0U A;  3GTP C;  3HOW K;  3GTG C;  4A3M K;  1TWA A;  2GSN A;  3S15 C;  4MEX A;  2NVX A;  4OIO A;  2CW0 A;  2NVY A;  4XSZ A;  2JA5 C;  3NUH A;  4YG2 A;  1BJT A;  3GTG A;  4A3I K;  1EH1 A;  4RMF A;  3S2D C;  3GTL K;  4M1X A;  3HOX C;  4A3D C;  1WQG A;  2R93 C;  4XLN A;  1J6V A;  4PAA A;  4NOI A;  3GTQ K;  3S2H C;  4GTF A;  1DD5 A;  1BGW A;  5FLM K;  3S1N K;  2GSU A;  3HOY K;  1ZBS A;  3GTO C;  2PMZ D;  5IP7 C;  3GTP A;  4Y7N C;  3K7A C;  4A3L K;  4KMD A;  1VRQ C;  1R9T C;  3HKZ D;  1ISE A;  1EK8 A;  2Y3P A;  3GEE A;  4P5A A;  2PA8 D;  2NVX C;  4A93 C;  3PO3 K;  4LR2 A;  4C3J C;  5EGH A;  3AD9 C;  1XPP A;  4Q4Z A;  4A3E K;  3HXA A;  5C44 K;  3FKI C;  1I6H K;  1VH2 A;  4A3F K;  3BP8 C;  4C3H C;  4A3G K;  1I3Q A;  2VUM K;  2D6F C;  1PJ7 A;  4PAB A;  2YU9 K;  3HOU C;  1O28 A;  1ZYR A;  1B4B A;  4BXX C;  3A8K A;  3I4M C;  3S15 K;  1J6W A;  3A8I A;  2XCQ A;  3ORE A;  4WIL A;  3GSI A;  3FOE A;  3SZY A;  1USM A;  1O29 A;  4A3D K;  5IYB C;  1YNN A;  5M5X K;  5CHP A;  1Y1V C;  2ZFZ A;  4LK1 A;  1TWH K;  3SZZ A;  2XCO A;  4A3J C;  3GTO K;  4KM9 A;  4A3I C;  2E2I K;  2W7V A;  3GTM C;  1IS1 A;  4C45 A;  4FM9 A;  3M3Y K;  3GTO A;  3HKZ L;  4GFQ A;  1XZQ B;  2WB1 D;  4G7H A;  2R7Z K;  3S1R C;  5C3E C;  4ILD A;  2RGR A;  2NVT K;  2JA6 C;  1JOE A;  2P5M A;  3S1M K;  3GTP K;  3H3V D;  3HOW C;  4O2D A;  2PMZ L;  1SMY A;  3TFI A;  2Y0S L;  1IW7 A;  3S2D K;  4GTB A;  4BY1 C;  3FOF A;  3TFH A;  2JA7 K;  1WQH A;  1TWA C;  2YU9 C;  1I3Q K;  1YX2 A;  4KC6 A;  4QJV A;  4C2M K;  1WSV A;  3ERE D;  2JA5 K;  1O2B A;  4XSX A;  4A3C C;  4LQY A;  1YCL A;  4OIQ A;  1I3Q C;  1WQF A;  4C2M C;  2NVY K;  5C44 C;  1TWC A;  3A8J A;  1ZXO A;  3TFJ A;  4MEY A;  4C3I K;  1EQR A;  2CFA A;  2E2J C;  1WSR A;  5M3M K;  4P5B A;  3GTM A;  2E2H A;  3HOV C;  2R7Z C;  5IP9 C;  3V4G A;  5IP7 K;  4QIW D;  4Q5S A;  4BKW A;  4A3B K;  3GTM K;  3RZD C;  1XZP A;  1TWH A;  1TWF C;  1K83 C;  4LOW A;  2PPB A;  1WOO A;  4KMH A;  3S17 K;  3GTQ C;  4X6A C;  5IOQ A;  3Q3Q A;  1I50 K;  3H0G K;  1HI9 A;  1YNJ A;  1TWA K;  3GTJ A;  4A93 K;  2JA7 C;  3HOV K;  3RZO K;  4QJV B;  1IQ0 A;  1K83 A;  4X6A K;  2JA5 A;  3WOD A;  1F93 A;  1AB4 A;  2EBB A;  2R92 K;  1IBA A;  1K83 K;  5M3F K;  3BP3 A;  4KDD A;  2JA6 K;  2NVT C;  3FKI A;  3OPF A;  4DDQ A;  1O25 A;  1I6V A;  4OIN A;  2CFA B;  4AH6 A;  2E2J K;  3LAJ A;  3GDZ A;  2B63 A;  3GTL C;  5M5Y K;  4LJZ A;  5IYD C;  5IYB K;  5FJ8 K;  1BDF A;  2E2H C;  4KB2 A;  5E68 A;  2B63 K;  3AQP A;  5IYC C;  3GTQ A;  5C4X C;  3ADA C;  1R9T A;  5IOR A;  3S14 C;  4G7O A;  4GTE A;  1SFO C;  3CQZ A;  4A3M C;  2A6E A;  5TMC A;  1XXB A;  3GTJ C;  4G0W A;  2JA7 A;  4LK0 A;  4Y52 K;  4C3J K;  3GTJ K;  1INN A;  5JVO A;  2JA6 A;  3M4O K;  4WJ4 A;  3QX3 A;  3T00 A;  4BBS C;  2YU9 A;  3N3Y A;  3GTK A;  3S17 C;  1ZVU A;  3BUE A;  2WB1 L;  2PHC B;  2R92 A;  2A6H A;  3GEH A;  4AYB D;  4KN7 A;  2FQO A;  3IPJ A;  4A3G C;  5TMF A;  4A3F C;  2WAQ D;  3FKI K;  3GTG K;  1KQ4 A;  1TWG A;  3JST A;  1G51 A;  1TWC K;  2V6T A;  4GT9 A;  4GTC A;  2E2H K;  3GTK C;  1Y1V K;  3S2H K;  1RU0 A;  1TWG K;  3PO2 K;  5M5W K;  3G4A A;  3GTL A;  4GTA A;  4BXX K;  4J3N A;  2R7Z A;  1XXA A;  2NVQ K;  1WCM K;  3OEP A;  4Y7N K;  3CQZ K;  3S1Q K;  3VA7 A;  3TTG A;  1I50 A;  5C4J K;  4BY7 C;  1O2A A;  2GAG C;  4A3K K;  1SFO A;  2JH3 A;  2JA8 C;  2O5J A;  3AD8 C;  5IP9 K;  4KAW X;  5EGE A;  4QIW L;  4GTD A;  2GAH C;  3I4N C;  1F9N A;  1I50 C;  3GEI A;  3LPX A;  4YFN A;  4XLP A;  4XCH A;  4GTL A;  2XCR B;  4OIP A;  1O27 A;  4A3C K;  2V6S A;  3HOZ C;  1USO A;  2VUM A;  1TWG C;  3PO2 C;  4KAR A;  4BLA A;  1F7V A;  3HOX K;  3L4K A;  5IOS A;  4C3I C;  3DXJ A;  1XXC A;  3MML B;  1Y1V A;  5C4J C;  4KMU A;  3H3V L;  1O26 A;  3S1Q C;  1WIH A;  1IE0 A;  5C3E K; 
#chains in the Genus database with same CATH homology
 3S14 K;  5C4X C;  3S1R K;  3GTM C;  1SFO K;  4AYB L;  3M3Y K;  3HKZ L;  4JK1 A;  3S14 C;  3M3Y C;  5IYC K;  2E2I C;  2WB1 D;  4G7H A;  2R7Z K;  4G7O A;  3S1R C;  4A3J K;  3M4O C;  1SFO C;  5C3E C;  2NVT K;  2JA6 C;  1HQM A;  5C4X K;  1TWH C;  4A3M C;  4Y52 C;  2A6E A;  5TMC A;  3S1M K;  4BY1 K;  4A3E C;  3GTP K;  3H3V D;  3GTJ C;  3HOW C;  2PMZ L;  4LLG A;  3GTP C;  1SMY A;  3HOW K;  4LK0 A;  3GTG C;  3S1M C;  2Y0S L;  4A3M K;  4Y52 K;  1IW7 A;  4C3J K;  3S2D K;  3GTJ K;  3S15 C;  4BY1 C;  4MEX A;  3PO3 C;  2JA7 K;  3M4O K;  4OIO A;  1TWA C;  2YU9 C;  2CW0 A;  4XSZ A;  1I3Q K;  4C2M K;  2E2I K;  4QJV A;  4BBS C;  2JA5 K;  3HOZ K;  2Y0S D;  4XSX A;  2JA5 C;  4A3C C;  3S17 C;  2BE5 A;  1I3Q C;  2WB1 L;  4YG2 A;  4YFK A;  4OIQ A;  2A6H A;  2NVY K;  2VUM C;  4GZY A;  4A3I K;  5C44 C;  4C3H K;  4AYB D;  4KN7 A;  2R92 C;  1I6H C;  2B63 C;  4A3G C;  5TMF A;  3S2D C;  4A3F C;  2WAQ D;  3FKI K;  4BBR K;  3GTG K;  3GTL K;  5IYD K;  2WAQ L;  3HOX C;  1TWC K;  2A69 A;  4A3D C;  2E2H K;  2R93 C;  4MEY A;  3GTK C;  1Y1V K;  3S2H K;  4C3I K;  4XLN A;  2E2J C;  5M3M K;  1TWG K;  3PO2 K;  5M5W K;  4NOI A;  4BXX K;  4ZH4 A;  3GTQ K;  3S2H C;  1Y1W C;  4MQ9 A;  3HOV C;  2R7Z C;  3HOU K;  5IP9 C;  1R9T K;  5IP7 K;  2PA8 L;  4QIW D;  4Q5S A;  3K7A K;  4A3L C;  4A3B K;  3GTM K;  2NVQ K;  1TWF K;  5FLM K;  3RZD C;  1WCM K;  3CQZ C;  3S1N K;  4A3K C;  4Y7N K;  1WCM C;  3CQZ K;  3HOY K;  1TWF C;  3RZD K;  1K83 C;  3S1Q K;  2PPB A;  4A3B C;  3GTO C;  3HOY C;  4YFX A;  4BY7 K;  5C4J K;  4BY7 C;  4KN4 A;  2PMZ D;  5IP7 C;  5FLM C;  4Y7N C;  2A68 A;  3S17 K;  4A3K K;  3K7A C;  4A3L K;  3GTQ C;  4X6A C;  2NVQ C;  3I4N K;  2JA8 C;  2O5J A;  5IP9 K;  1I50 K;  1R9T C;  3H0G K;  3HKZ D;  1YNJ A;  4A93 K;  1TWA K;  3RZO C;  2PA8 D;  4QIW L;  2NVX C;  2JA7 C;  3PO3 K;  3HOV K;  3EQL A;  4A93 C;  2NVX K;  3RZO K;  4QJV B;  3I4N C;  3H0G C;  4X6A K;  4G7Z A;  1I50 C;  1XPP A;  3WOD A;  3GTK K;  4Q4Z A;  2R92 K;  4A3E K;  1K83 K;  4YFN A;  4XLP A;  5C44 K;  5M3F K;  2NVY C;  3FKI C;  4BBR C;  1I6H K;  4A3F K;  2JA6 K;  2NVT C;  4A3G K;  4BBS K;  2VUM K;  1I6V A;  4OIP A;  2YU9 K;  4A3C K;  4OIN A;  3HOU C;  3S1N C;  1ZYR A;  4BXX C;  3S15 K;  3HOZ C;  3I4M K;  2E2J K;  1TWG C;  3PO2 C;  2O5I A;  1Y1W K;  1TWC C;  3HOX K;  3GTL C;  4A3D K;  5D4D A;  2JA8 K;  3S16 K;  5M5Y K;  5IYB C;  1YNN A;  4LJZ A;  5M5X K;  5IYD C;  1Y1V C;  5IYB K;  1BDF A;  5FJ8 K;  4LK1 A;  2E2H C;  3S16 C;  1TWH K;  3DXJ A;  2R93 K;  5C4J C;  2B63 K;  4KMU A;  3GTO K;  4A3J C;  3H3V L;  3S1Q C;  5IYC C;  4A3I C;  4OIR A;  3I4M C;  5C3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...