1SFOK

Rna polymerase ii strand separated elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA STRAND
publication title Structural Basis of Transcription: Separation of RNA from DNA by RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1sfoK00
2E2IC 3M3YC 3S16K 4KN4A 3I4NC 4A3MK 5IYCC 3S1NK 4BXXK 5C3EK 3GTJC 2R7ZC 3GTLC 3S15C 3CQZK 3GTGK 4G7OA 1TWAC 1TWFC 2R92C 2JA6C 4Y7NK 5C4JC 4OINA 3HOYC 3S17C 1K83C 3GTOK 5FLMK 2JA8K 1I3QK 2A6HA 3S2HK 2E2JC 1I6HC 4MEYA 2NVQC 2WAQD 3FKIK 3GTQC 4JK1A 2B63K 5C4XC 2NVYC 4KMUA 4G7ZA 2PPBA 3M4OC 4YG2A 4A3GK 4XLPA 3RZOC 3HOXK 1Y1VK 4AYBL 2WB1D 1I50K 2Y0SD 1ZYRA 4OIOA 1R9TC 2NVXK 3I4MK 4XSZA 2JA5K 4A3CC 4A3KK 4QIWD 1TWHC 2PA8D 5M3FK 1Y1WK 1SFOK 2VUMC 3PO3K 4Q5SA 3H3VL 2JA7C 5D4DA 5IYDC 4LLGA 2A6EA 3H3VD 1TWCC 4QJVB 4X6AC 4A3DK 4BY1C 2R93K 4OIRA 3S16C 5M5WK 3GTPK 5C44C 5IP7K 3K7AK 1IW7A 4A3MC 3S1NC 4ZH4A 1I6VA 4LK0A 3S2DC 4BXXC 3HOZK 3CQZC 3GTGC 4A3BK 4Y7NC 1YNJA 2NVTK 2WAQL 4QJVA 4OIPA 3GTOC 3S14K 3RZDK 4A93K 4XSXA 2JA8C 2E2HK 5IYBC 5FJ8K 4A3JK 3GTKK 2YU9K 1XPPA 2WB1L 2Y0SL 5M3MK 2R7ZK 3FKIC 4Y52K 4BBSC 4A3FK 2B63C 2O5JA 4C2MK 5TMCA 3GTMK 4QIWL 4A3LK 2PA8L 4A3GC 1Y1VC 5C4JK 3S1QK 1WCMK 1K83K 1TWGK 4MQ9A 4C3IK 4LK1A 3I4MC 3EQLA 4A3EK 4A3IC 2JA5C 2NVXC 4A3KC 1SFOC 2O5IA 1Y1WC 3HOWK 3PO3C 5IP9K 1YNNA 3H0GK 3S1MK 1BDFA 5C3EC 4KN7A 4A3DC 2R93C 3S1RK 2CW0A 5M5XK 4LJZA 5IP7C 3K7AC 3GTPC 3HOVK 4BY7K 4G7HA 3HOUK 4C3HK 5FLMC 3PO2K 1I3QC 4GZYA 4YFKA 2A69A 4BBRK 3HKZD 2E2IK 3M3YK 3S14C 4YFXA 3RZDC 3I4NK 3S2HC 4A93C 5IYCK 4MEXA 3GTJK 2E2HC 2PMZL 3GTLK 4A3JC 3GTKC 3S15K 4X6AK 1TWAK 1TWFK 2YU9C 2R92K 5C44K 2JA6K 2PMZD 4Q4ZA 3HOXC 1HQMA 1SMYA 3HOYK 4Y52C 3S17K 3S2DK 4A3FC 1I50C 3GTMC 4A3LC 3S1QC 1WCMC 4YFNA 1I6HK 1TWGC 2E2JK 2NVQK 5C4XK 2A68A 5IYBK 4A3EC 2NVYK 3GTQK 3M4OK 3HOWC 3RZOK 5IP9C 4OIQA 4BBSK 3H0GC 3S1MC 4C3JK 3HOZC 3WODA 1R9TK 2BE5A 5TMFA 3HKZL 3S1RC 4A3BC 4A3CK 1TWHK 2VUMK 3HOVC 4BY7C 2NVTC 4AYBD 4XLNA 2JA7K 4NOIA 5M5YK 4A3IK 3HOUC 3PO2C 5IYDK 3DXJA 1TWCK 4BBRC 4BY1K
chains in the Genus database with same CATH superfamily
3VA7A 3N0CA 4GTLA 2E2IC 1XZPB 2D6FC 5IYCC 3SZZA 4KM8A 1J6WA 5IOSA 3HOYC 1WOOA 1K83C 1I3QK 2YU9A 2E2JC 1O2BA 3T01A 3FKIK 5C4XC 2NVYC 3OEPA 4KMUA 2PPBA 4GTDA 2RGRA 1WCMA 1K83A 2XCQA 1IL2A 4C3HC 4OIOA 4A3KK 5M3FK 4KC6A 2V6UA 4Q5SA 2JA7C 3TFHA 5D4DA 1XXAA 4QJVB 1ZVUA 3S16C 4GTAA 1XZQB 5M5WK 3GTPK 5IP7K 3K7AK 1I6VA 3HOZK 3GTGC 1O26A 4Y7NC 1YNJA 3GTOC 1IBAA 4XSXA 3AH5A 4BLBA 4A3JK 3GTKK 2YU9K 1TWAA 2R92A 5M3MK 4Y52K 3TTGA 4A3GC 1Y1VC 3SZYA 1WCMK 1K83K 4C3IK 3EQLA 2JA5C 1SFOC 5E68A 4G0UA 3PO3C 3H0GK 4KARA 4G0VA 4A3DC 3AD7C 3S1RK 4GTCA 3TFIA 3BP3A 5CHPA 2Y3PA 4C3HK 3HOUK 2P8TA 4PAAA 4FM9A 1VRQC 4BBRK 3M3YK 4GTBA 3RZDC 2XCRB 1WOSA 4MEXA 3GTLK 3S15K 3CQZA 1TWAK 3AQPA 5HL8A 2R92K 1G51A 1O27A 2PMZD 2ZUEA 1C0AA 1HQMA 1SMYA 4A3FC 1I50C 5EGHA 4C45A 3N0BA 3GIRA 3BUEA 3S1QC 4KB2A 1PJ7A 1I6HK 1WSRA 2CFAB 2A68A 2ZUFA 2B63A 3M4OK 4GT9A 1F9NA 5IP9C 3LAPA 1ISEA 1I50A 5IOQA 2GSUA 2BE5A 2NVXA 4A3BC 3Q3QA 3HOVC 4BY7C 4AYBD 2FQTA 4BY1K 3L4JA 1WOPA 3I4NC 4A3MK 4WJ3M 3S1NK 3GTJC 3LPXA 2R7ZC 3CQZK 4G7OA 1TWFC 1O29A 2JA6C 1O25A 3IPJA 1J6XA 4P9SA 2JA8K 2E2HA 2A6HA 2WAQD 2R7ZA 1V5VA 4JK1A 2B63K 4XLPA 3RZOC 1EI6A 4AYBL 2XCOA 1I50K 2Y0SD 4C3JC 1R9TC 2NVXK 1J6VA 1EH1A 4QIWD 1TWHC 2VUMC 4LLGA 1VH2A 4GFQA 4G0WA 1O2FB 1IW7A 4BXXC 3S2DC 5IOTA 3ADAC 4A3BK 1RU0A 2WAQL 1JOEA 4OIPA 2E2IA 4A93K 2E2HK 5IYBC 5FJ8K 4P5BA 1XPPA 4XCHA 2PHCB 2Y0SL 2R7ZK 1PJ5A 4BBSC 4M1XA 4C2MK 1EK8A 4PABA 4QIWL 1X31C 1O2AA 1WIHA 4MQ9A 4LK1A 2GAGC 4GTFA 3I4MC 4A3EK 3GDZA 2NVYA 3GEIA 2O5IA 1Y1WC 1WSVA 3QX3A 4KN7A 2R93C 4RMFA 4G7HA 2JA7A 5FLMC 3PO2K 4FZBA 4GZYA 1Y1WA 3HKZD 2E2IK 3S14C 5IYCK 3GSIA 1IQ0A 3GTGA 3HOXC 4KATA 3HOYK 3S2DK 3GTOA 3GTMC 4A3LC 2ZFZA 4YFNA 1TWGC 2E2JK 1XXCA 1INNA 3T02A 5C4XK 5IYBK 2NVYK 3HOWC 1Y1VA 3A8IA 1YCLA 4BBSK 1GE9A 3S1MC 3JSTA 3GTMA 3WODA 1O28A 3HKZL 2JA5A 1SFOA 1TWGA 2JA7K 1AB4A 4NOIA 3DXJA 3G4CA 3S16K 4KN4A 3AD8C 3AQOA 4DDQA 5CJ9A 4BLAA 3GTGK 4Y7NK 5C4JC 2EBBA 3S17C 4ILDA 3GTOK 5FLMK 1WQHA 4KM9A 1EQRA 2NVQC 3GTQC 2V6SA 4A3GK 1DD5A 3HOXK 1Y1VK 3FOFA 3N3YA 3ERED 1ZYRA 2JA5K 4A3CC 3FHZA 1SFOK 5EGEA 2PA8D 3PO3K 3H3VL 5IYDC 4X6AC 1TWCC 4A3DK 5TJ3A 4OIRA 4ZH4A 3GEHA 4LK0A 1ZBSA 4QJVA 3L4KA 3RZDK 4WJ4A 1JQWA 3GTJA 4KAWX 1TWFA 1PJ6A 2JA6A 3A8KA 3OREA 1EFWA 4BKWA 3FKIC 4A3FK 2O5JA 2PA8L 5JFEA 3S0XA 2RH6A 5C4JK 3S1QK 4A3KC 5IP9K 1YNNA 5C3EC 4KMDA 4WILA 1R9TA 4LR2A 2CW0A 5M5XK 4LJZA 5IP7C 1TWHA 2V6TA 3K7AC 3GTPC 3HOVK 4BY7K 2VUMA 4YFKA 4GTEA 4YFXA 3I4NK 1ZQ1C 3S2HC 1BS2A 4X6AK 3GTJK 1XXBA 4P5AA 4A3JC 1BGWA 3GTKC 2YU9C 1TWFK 2JA6K 3NUHA 3GTPA 4Y52C 1VLOA 1F93A 3TFJA 1WCMC 3OPFA 4C3IC 3GTKA 1L0WA 3RZOK 1WQGA 4OIQA 3H0GC 4C3JK 1R9TK 5TMFA 3S1RC 2CFAA 1TWHK 2VUMK 2NVTC 3HOUC 4XLNA 1IS1A 5M5YK 1BJTA 4BBRC 5IORA 2R93A 3M3YC 3H0GA 4BXXK 5C3EK 3GTLC 3S15C 1TWAC 2R92C 3HXAA 4OINA 1J98A 1F7UA 1DCOA 3S2HK 1I6HC 4MEYA 4LQYA 3GTLA 4KDDA 4G7ZA 3M4OC 4YG2A 1DCPA 4KB4A 2WB1D 3I4MK 4XSZA 3AD9C 5JVOA 1B4BA 3T00A 1Y1WK 2A6EA 3H3VD 1IE0A 4BY1C 2R93K 5C44C 4A3MC 3S1NC 3CQZC 1B4AA 1XZPA 2NVTK 3S14K 2W7VA 2JA8C 1VGXA 3MMLB 2P5MA 1ZXOA 3G4AA 1TWCK 3FOEA 1USMA 2WB1L 2B63C 5TMCA 3GTMK 4A3LK 1DCHA 3GEEA 1TWGK 3V4GA 3A8JA 4J3NA 4A3IC 2NVXC 3GTQA 3BP8C 4KMHA 3HOWK 2KWAA 4AH6A 3S1MK 1BDFA 4KMAA 5L46A 1WORA 2GSNA 4KASA 4LOWA 1HI9A 1VJEA 4O2DA 1I3QC 1USOA 1KQ4A 1XZQA 1TWCA 2A69A 4A93C 1O24A 2E2HC 2PMZL 1UV7A 5C44K 4Q4ZA 3S17K 4C2MC 1I3QA 2NVQK 3FKIA 3GTQK 4A3EC 2JH3A 3LAJA 3HOZC 3CAGA 4A3CK 2FQOA 1F7VA 3PO2C 4A3IK 1YX2A 2GSOA 5IYDK 1JVIA 2GAHC 1WQFA
chains in the Genus database with same CATH topology
2E2IC 3M3YC 3S16K 4KN4A 3I4NC 4A3MK 5IYCC 3S1NK 4BXXK 5C3EK 3GTJC 2R7ZC 3GTLC 3S15C 3CQZK 3GTGK 4G7OA 1TWAC 1TWFC 2R92C 2JA6C 4Y7NK 5C4JC 4OINA 3HOYC 3S17C 1K83C 3GTOK 5FLMK 2JA8K 1I3QK 2A6HA 3S2HK 2E2JC 1I6HC 4MEYA 2NVQC 2WAQD 3FKIK 3GTQC 4JK1A 2B63K 5C4XC 2NVYC 4KMUA 4G7ZA 2PPBA 3M4OC 4YG2A 4A3GK 4XLPA 3RZOC 3HOXK 1Y1VK 4AYBL 2WB1D 1I50K 2Y0SD 1ZYRA 4OIOA 1R9TC 2NVXK 3I4MK 4XSZA 2JA5K 4A3CC 4A3KK 4QIWD 1TWHC 2PA8D 5M3FK 1Y1WK 1SFOK 2VUMC 3PO3K 4Q5SA 3H3VL 2JA7C 5D4DA 5IYDC 4LLGA 2A6EA 3H3VD 1TWCC 4QJVB 4X6AC 4A3DK 4BY1C 2R93K 4OIRA 3S16C 5M5WK 3GTPK 5C44C 5IP7K 3K7AK 1IW7A 4A3MC 3S1NC 4ZH4A 1I6VA 4LK0A 3S2DC 4BXXC 3HOZK 3CQZC 3GTGC 4A3BK 4Y7NC 1YNJA 2NVTK 2WAQL 4QJVA 4OIPA 3GTOC 3S14K 3RZDK 4A93K 4XSXA 2JA8C 2E2HK 5IYBC 5FJ8K 4A3JK 3GTKK 2YU9K 1XPPA 2WB1L 2Y0SL 5M3MK 2R7ZK 3FKIC 4Y52K 4BBSC 4A3FK 2B63C 2O5JA 4C2MK 5TMCA 3GTMK 4QIWL 4A3LK 2PA8L 4A3GC 1Y1VC 5C4JK 3S1QK 1WCMK 1K83K 1TWGK 4MQ9A 4C3IK 4LK1A 3I4MC 3EQLA 4A3EK 4A3IC 2JA5C 2NVXC 4A3KC 1SFOC 2O5IA 1Y1WC 3HOWK 3PO3C 5IP9K 1YNNA 3H0GK 3S1MK 1BDFA 5C3EC 4KN7A 4A3DC 2R93C 3S1RK 2CW0A 5M5XK 4LJZA 5IP7C 3K7AC 3GTPC 3HOVK 4BY7K 4G7HA 3HOUK 4C3HK 5FLMC 3PO2K 1I3QC 4GZYA 4YFKA 2A69A 4BBRK 3HKZD 2E2IK 3M3YK 3S14C 4YFXA 3RZDC 3I4NK 3S2HC 4A93C 5IYCK 4MEXA 3GTJK 2E2HC 2PMZL 3GTLK 4A3JC 3GTKC 3S15K 4X6AK 1TWAK 1TWFK 2YU9C 2R92K 5C44K 2JA6K 2PMZD 4Q4ZA 3HOXC 1HQMA 1SMYA 3HOYK 4Y52C 3S17K 3S2DK 4A3FC 1I50C 3GTMC 4A3LC 3S1QC 1WCMC 4YFNA 1I6HK 1TWGC 2E2JK 2NVQK 5C4XK 2A68A 5IYBK 4A3EC 2NVYK 3GTQK 3M4OK 3HOWC 3RZOK 5IP9C 4OIQA 4BBSK 3H0GC 3S1MC 4C3JK 3HOZC 3WODA 1R9TK 2BE5A 5TMFA 3HKZL 3S1RC 4A3BC 4A3CK 1TWHK 2VUMK 3HOVC 4BY7C 2NVTC 4AYBD 4XLNA 2JA7K 4NOIA 5M5YK 4A3IK 3HOUC 3PO2C 5IYDK 3DXJA 1TWCK 4BBRC 4BY1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I C;  3M3Y C;  3S16 K;  4KN4 A;  3I4N C;  4A3M K;  5IYC C;  3S1N K;  4BXX K;  5C3E K;  3GTJ C;  2R7Z C;  3GTL C;  3S15 C;  3CQZ K;  3GTG K;  4G7O A;  1TWA C;  1TWF C;  2R92 C;  2JA6 C;  4Y7N K;  5C4J C;  4OIN A;  3HOY C;  3S17 C;  1K83 C;  3GTO K;  5FLM K;  2JA8 K;  1I3Q K;  2A6H A;  3S2H K;  2E2J C;  1I6H C;  4MEY A;  2NVQ C;  2WAQ D;  3FKI K;  3GTQ C;  4JK1 A;  2B63 K;  5C4X C;  2NVY C;  4KMU A;  4G7Z A;  2PPB A;  3M4O C;  4YG2 A;  4A3G K;  4XLP A;  3RZO C;  3HOX K;  1Y1V K;  4AYB L;  2WB1 D;  1I50 K;  2Y0S D;  1ZYR A;  4OIO A;  1R9T C;  2NVX K;  3I4M K;  4XSZ A;  2JA5 K;  4A3C C;  4A3K K;  4QIW D;  1TWH C;  2PA8 D;  5M3F K;  1Y1W K;  1SFO K;  2VUM C;  3PO3 K;  4Q5S A;  3H3V L;  2JA7 C;  5D4D A;  5IYD C;  4LLG A;  2A6E A;  3H3V D;  1TWC C;  4QJV B;  4X6A C;  4A3D K;  4BY1 C;  2R93 K;  4OIR A;  3S16 C;  5M5W K;  3GTP K;  5C44 C;  5IP7 K;  3K7A K;  1IW7 A;  4A3M C;  3S1N C;  4ZH4 A;  1I6V A;  4LK0 A;  3S2D C;  4BXX C;  3HOZ K;  3CQZ C;  3GTG C;  4A3B K;  4Y7N C;  1YNJ A;  2NVT K;  2WAQ L;  4QJV A;  4OIP A;  3GTO C;  3S14 K;  3RZD K;  4A93 K;  4XSX A;  2JA8 C;  2E2H K;  5IYB C;  5FJ8 K;  4A3J K;  3GTK K;  2YU9 K;  1XPP A;  2WB1 L;  2Y0S L;  5M3M K;  2R7Z K;  3FKI C;  4Y52 K;  4BBS C;  4A3F K;  2B63 C;  2O5J A;  4C2M K;  5TMC A;  3GTM K;  4QIW L;  4A3L K;  2PA8 L;  4A3G C;  1Y1V C;  5C4J K;  3S1Q K;  1WCM K;  1K83 K;  1TWG K;  4MQ9 A;  4C3I K;  4LK1 A;  3I4M C;  3EQL A;  4A3E K;  4A3I C;  2JA5 C;  2NVX C;  4A3K C;  1SFO C;  2O5I A;  1Y1W C;  3HOW K;  3PO3 C;  5IP9 K;  1YNN A;  3H0G K;  3S1M K;  1BDF A;  5C3E C;  4KN7 A;  4A3D C;  2R93 C;  3S1R K;  2CW0 A;  5M5X K;  4LJZ A;  5IP7 C;  3K7A C;  3GTP C;  3HOV K;  4BY7 K;  4G7H A;  3HOU K;  4C3H K;  5FLM C;  3PO2 K;  1I3Q C;  4GZY A;  4YFK A;  2A69 A;  4BBR K;  3HKZ D;  2E2I K;  3M3Y K;  3S14 C;  4YFX A;  3RZD C;  3I4N K;  3S2H C;  4A93 C;  5IYC K;  4MEX A;  3GTJ K;  2E2H C;  2PMZ L;  3GTL K;  4A3J C;  3GTK C;  3S15 K;  4X6A K;  1TWA K;  1TWF K;  2YU9 C;  2R92 K;  5C44 K;  2JA6 K;  2PMZ D;  4Q4Z A;  3HOX C;  1HQM A;  1SMY A;  3HOY K;  4Y52 C;  3S17 K;  3S2D K;  4A3F C;  1I50 C;  3GTM C;  4A3L C;  3S1Q C;  1WCM C;  4YFN A;  1I6H K;  1TWG C;  2E2J K;  2NVQ K;  5C4X K;  2A68 A;  5IYB K;  4A3E C;  2NVY K;  3GTQ K;  3M4O K;  3HOW C;  3RZO K;  5IP9 C;  4OIQ A;  4BBS K;  3H0G C;  3S1M C;  4C3J K;  3HOZ C;  3WOD A;  1R9T K;  2BE5 A;  5TMF A;  3HKZ L;  3S1R C;  4A3B C;  4A3C K;  1TWH K;  2VUM K;  3HOV C;  4BY7 C;  2NVT C;  4AYB D;  4XLN A;  2JA7 K;  4NOI A;  5M5Y K;  4A3I K;  3HOU C;  3PO2 C;  5IYD K;  3DXJ A;  1TWC K;  4BBR C;  4BY1 K; 
#chains in the Genus database with same CATH topology
 3VA7 A;  3N0C A;  4GTL A;  2E2I C;  1XZP B;  2D6F C;  5IYC C;  3SZZ A;  4KM8 A;  1J6W A;  5IOS A;  3HOY C;  1WOO A;  1K83 C;  1I3Q K;  2YU9 A;  2E2J C;  1O2B A;  3T01 A;  3FKI K;  5C4X C;  2NVY C;  3OEP A;  4KMU A;  2PPB A;  4GTD A;  2RGR A;  1WCM A;  1K83 A;  2XCQ A;  1IL2 A;  4C3H C;  4OIO A;  4A3K K;  5M3F K;  4KC6 A;  2V6U A;  4Q5S A;  2JA7 C;  3TFH A;  5D4D A;  1XXA A;  4QJV B;  1ZVU A;  3S16 C;  4GTA A;  1XZQ B;  5M5W K;  3GTP K;  5IP7 K;  3K7A K;  1I6V A;  3HOZ K;  3GTG C;  1O26 A;  4Y7N C;  1YNJ A;  3GTO C;  1IBA A;  4XSX A;  3AH5 A;  4BLB A;  4A3J K;  3GTK K;  2YU9 K;  1TWA A;  2R92 A;  5M3M K;  4Y52 K;  3TTG A;  4A3G C;  1Y1V C;  3SZY A;  1WCM K;  1K83 K;  4C3I K;  3EQL A;  2JA5 C;  1SFO C;  5E68 A;  4G0U A;  3PO3 C;  3H0G K;  4KAR A;  4G0V A;  4A3D C;  3AD7 C;  3S1R K;  4GTC A;  3TFI A;  3BP3 A;  5CHP A;  2Y3P A;  4C3H K;  3HOU K;  2P8T A;  4PAA A;  4FM9 A;  1VRQ C;  4BBR K;  3M3Y K;  4GTB A;  3RZD C;  2XCR B;  1WOS A;  4MEX A;  3GTL K;  3S15 K;  3CQZ A;  1TWA K;  3AQP A;  5HL8 A;  2R92 K;  1G51 A;  1O27 A;  2PMZ D;  2ZUE A;  1C0A A;  1HQM A;  1SMY A;  4A3F C;  1I50 C;  5EGH A;  4C45 A;  3N0B A;  3GIR A;  3BUE A;  3S1Q C;  4KB2 A;  1PJ7 A;  1I6H K;  1WSR A;  2CFA B;  2A68 A;  2ZUF A;  2B63 A;  3M4O K;  4GT9 A;  1F9N A;  5IP9 C;  3LAP A;  1ISE A;  1I50 A;  5IOQ A;  2GSU A;  2BE5 A;  2NVX A;  4A3B C;  3Q3Q A;  3HOV C;  4BY7 C;  4AYB D;  2FQT A;  4BY1 K;  3L4J A;  1WOP A;  3I4N C;  4A3M K;  4WJ3 M;  3S1N K;  3GTJ C;  3LPX A;  2R7Z C;  3CQZ K;  4G7O A;  1TWF C;  1O29 A;  2JA6 C;  1O25 A;  3IPJ A;  1J6X A;  4P9S A;  2JA8 K;  2E2H A;  2A6H A;  2WAQ D;  2R7Z A;  1V5V A;  4JK1 A;  2B63 K;  4XLP A;  3RZO C;  1EI6 A;  4AYB L;  2XCO A;  1I50 K;  2Y0S D;  4C3J C;  1R9T C;  2NVX K;  1J6V A;  1EH1 A;  4QIW D;  1TWH C;  2VUM C;  4LLG A;  1VH2 A;  4GFQ A;  4G0W A;  1O2F B;  1IW7 A;  4BXX C;  3S2D C;  5IOT A;  3ADA C;  4A3B K;  1RU0 A;  2WAQ L;  1JOE A;  4OIP A;  2E2I A;  4A93 K;  2E2H K;  5IYB C;  5FJ8 K;  4P5B A;  1XPP A;  4XCH A;  2PHC B;  2Y0S L;  2R7Z K;  1PJ5 A;  4BBS C;  4M1X A;  4C2M K;  1EK8 A;  4PAB A;  4QIW L;  1X31 C;  1O2A A;  1WIH A;  4MQ9 A;  4LK1 A;  2GAG C;  4GTF A;  3I4M C;  4A3E K;  3GDZ A;  2NVY A;  3GEI A;  2O5I A;  1Y1W C;  1WSV A;  3QX3 A;  4KN7 A;  2R93 C;  4RMF A;  4G7H A;  2JA7 A;  5FLM C;  3PO2 K;  4FZB A;  4GZY A;  1Y1W A;  3HKZ D;  2E2I K;  3S14 C;  5IYC K;  3GSI A;  1IQ0 A;  3GTG A;  3HOX C;  4KAT A;  3HOY K;  3S2D K;  3GTO A;  3GTM C;  4A3L C;  2ZFZ A;  4YFN A;  1TWG C;  2E2J K;  1XXC A;  1INN A;  3T02 A;  5C4X K;  5IYB K;  2NVY K;  3HOW C;  1Y1V A;  3A8I A;  1YCL A;  4BBS K;  1GE9 A;  3S1M C;  3JST A;  3GTM A;  3WOD A;  1O28 A;  3HKZ L;  2JA5 A;  1SFO A;  1TWG A;  2JA7 K;  1AB4 A;  4NOI A;  3DXJ A;  3G4C A;  3S16 K;  4KN4 A;  3AD8 C;  3AQO A;  4DDQ A;  5CJ9 A;  4BLA A;  3GTG K;  4Y7N K;  5C4J C;  2EBB A;  3S17 C;  4ILD A;  3GTO K;  5FLM K;  1WQH A;  4KM9 A;  1EQR A;  2NVQ C;  3GTQ C;  2V6S A;  4A3G K;  1DD5 A;  3HOX K;  1Y1V K;  3FOF A;  3N3Y A;  3ERE D;  1ZYR A;  2JA5 K;  4A3C C;  3FHZ A;  1SFO K;  5EGE A;  2PA8 D;  3PO3 K;  3H3V L;  5IYD C;  4X6A C;  1TWC C;  4A3D K;  5TJ3 A;  4OIR A;  4ZH4 A;  3GEH A;  4LK0 A;  1ZBS A;  4QJV A;  3L4K A;  3RZD K;  4WJ4 A;  1JQW A;  3GTJ A;  4KAW X;  1TWF A;  1PJ6 A;  2JA6 A;  3A8K A;  3ORE A;  1EFW A;  4BKW A;  3FKI C;  4A3F K;  2O5J A;  2PA8 L;  5JFE A;  3S0X A;  2RH6 A;  5C4J K;  3S1Q K;  4A3K C;  5IP9 K;  1YNN A;  5C3E C;  4KMD A;  4WIL A;  1R9T A;  4LR2 A;  2CW0 A;  5M5X K;  4LJZ A;  5IP7 C;  1TWH A;  2V6T A;  3K7A C;  3GTP C;  3HOV K;  4BY7 K;  2VUM A;  4YFK A;  4GTE A;  4YFX A;  3I4N K;  1ZQ1 C;  3S2H C;  1BS2 A;  4X6A K;  3GTJ K;  1XXB A;  4P5A A;  4A3J C;  1BGW A;  3GTK C;  2YU9 C;  1TWF K;  2JA6 K;  3NUH A;  3GTP A;  4Y52 C;  1VLO A;  1F93 A;  3TFJ A;  1WCM C;  3OPF A;  4C3I C;  3GTK A;  1L0W A;  3RZO K;  1WQG A;  4OIQ A;  3H0G C;  4C3J K;  1R9T K;  5TMF A;  3S1R C;  2CFA A;  1TWH K;  2VUM K;  2NVT C;  3HOU C;  4XLN A;  1IS1 A;  5M5Y K;  1BJT A;  4BBR C;  5IOR A;  2R93 A;  3M3Y C;  3H0G A;  4BXX K;  5C3E K;  3GTL C;  3S15 C;  1TWA C;  2R92 C;  3HXA A;  4OIN A;  1J98 A;  1F7U A;  1DCO A;  3S2H K;  1I6H C;  4MEY A;  4LQY A;  3GTL A;  4KDD A;  4G7Z A;  3M4O C;  4YG2 A;  1DCP A;  4KB4 A;  2WB1 D;  3I4M K;  4XSZ A;  3AD9 C;  5JVO A;  1B4B A;  3T00 A;  1Y1W K;  2A6E A;  3H3V D;  1IE0 A;  4BY1 C;  2R93 K;  5C44 C;  4A3M C;  3S1N C;  3CQZ C;  1B4A A;  1XZP A;  2NVT K;  3S14 K;  2W7V A;  2JA8 C;  1VGX A;  3MML B;  2P5M A;  1ZXO A;  3G4A A;  1TWC K;  3FOE A;  1USM A;  2WB1 L;  2B63 C;  5TMC A;  3GTM K;  4A3L K;  1DCH A;  3GEE A;  1TWG K;  3V4G A;  3A8J A;  4J3N A;  4A3I C;  2NVX C;  3GTQ A;  3BP8 C;  4KMH A;  3HOW K;  2KWA A;  4AH6 A;  3S1M K;  1BDF A;  4KMA A;  5L46 A;  1WOR A;  2GSN A;  4KAS A;  4LOW A;  1HI9 A;  1VJE A;  4O2D A;  1I3Q C;  1USO A;  1KQ4 A;  1XZQ A;  1TWC A;  2A69 A;  4A93 C;  1O24 A;  2E2H C;  2PMZ L;  1UV7 A;  5C44 K;  4Q4Z A;  3S17 K;  4C2M C;  1I3Q A;  2NVQ K;  3FKI A;  3GTQ K;  4A3E C;  2JH3 A;  3LAJ A;  3HOZ C;  3CAG A;  4A3C K;  2FQO A;  1F7V A;  3PO2 C;  4A3I K;  1YX2 A;  2GSO A;  5IYD K;  1JVI A;  2GAH C;  1WQF A; 
#chains in the Genus database with same CATH homology
 2E2I C;  3M3Y C;  3S16 K;  4KN4 A;  3I4N C;  4A3M K;  5IYC C;  3S1N K;  4BXX K;  5C3E K;  3GTJ C;  2R7Z C;  3GTL C;  3S15 C;  3CQZ K;  3GTG K;  4G7O A;  1TWA C;  1TWF C;  2R92 C;  2JA6 C;  4Y7N K;  5C4J C;  4OIN A;  3HOY C;  3S17 C;  1K83 C;  3GTO K;  5FLM K;  2JA8 K;  1I3Q K;  2A6H A;  3S2H K;  2E2J C;  1I6H C;  4MEY A;  2NVQ C;  2WAQ D;  3FKI K;  3GTQ C;  4JK1 A;  2B63 K;  5C4X C;  2NVY C;  4KMU A;  4G7Z A;  2PPB A;  3M4O C;  4YG2 A;  4A3G K;  4XLP A;  3RZO C;  3HOX K;  1Y1V K;  4AYB L;  2WB1 D;  1I50 K;  2Y0S D;  1ZYR A;  4OIO A;  1R9T C;  2NVX K;  3I4M K;  4XSZ A;  2JA5 K;  4A3C C;  4A3K K;  4QIW D;  1TWH C;  2PA8 D;  5M3F K;  1Y1W K;  1SFO K;  2VUM C;  3PO3 K;  4Q5S A;  3H3V L;  2JA7 C;  5D4D A;  5IYD C;  4LLG A;  2A6E A;  3H3V D;  1TWC C;  4QJV B;  4X6A C;  4A3D K;  4BY1 C;  2R93 K;  4OIR A;  3S16 C;  5M5W K;  3GTP K;  5C44 C;  5IP7 K;  3K7A K;  1IW7 A;  4A3M C;  3S1N C;  4ZH4 A;  1I6V A;  4LK0 A;  3S2D C;  4BXX C;  3HOZ K;  3CQZ C;  3GTG C;  4A3B K;  4Y7N C;  1YNJ A;  2NVT K;  2WAQ L;  4QJV A;  4OIP A;  3GTO C;  3S14 K;  3RZD K;  4A93 K;  4XSX A;  2JA8 C;  2E2H K;  5IYB C;  5FJ8 K;  4A3J K;  3GTK K;  2YU9 K;  1XPP A;  2WB1 L;  2Y0S L;  5M3M K;  2R7Z K;  3FKI C;  4Y52 K;  4BBS C;  4A3F K;  2B63 C;  2O5J A;  4C2M K;  5TMC A;  3GTM K;  4QIW L;  4A3L K;  2PA8 L;  4A3G C;  1Y1V C;  5C4J K;  3S1Q K;  1WCM K;  1K83 K;  1TWG K;  4MQ9 A;  4C3I K;  4LK1 A;  3I4M C;  3EQL A;  4A3E K;  4A3I C;  2JA5 C;  2NVX C;  4A3K C;  1SFO C;  2O5I A;  1Y1W C;  3HOW K;  3PO3 C;  5IP9 K;  1YNN A;  3H0G K;  3S1M K;  1BDF A;  5C3E C;  4KN7 A;  4A3D C;  2R93 C;  3S1R K;  2CW0 A;  5M5X K;  4LJZ A;  5IP7 C;  3K7A C;  3GTP C;  3HOV K;  4BY7 K;  4G7H A;  3HOU K;  4C3H K;  5FLM C;  3PO2 K;  1I3Q C;  4GZY A;  4YFK A;  2A69 A;  4BBR K;  3HKZ D;  2E2I K;  3M3Y K;  3S14 C;  4YFX A;  3RZD C;  3I4N K;  3S2H C;  4A93 C;  5IYC K;  4MEX A;  3GTJ K;  2E2H C;  2PMZ L;  3GTL K;  4A3J C;  3GTK C;  3S15 K;  4X6A K;  1TWA K;  1TWF K;  2YU9 C;  2R92 K;  5C44 K;  2JA6 K;  2PMZ D;  4Q4Z A;  3HOX C;  1HQM A;  1SMY A;  3HOY K;  4Y52 C;  3S17 K;  3S2D K;  4A3F C;  1I50 C;  3GTM C;  4A3L C;  3S1Q C;  1WCM C;  4YFN A;  1I6H K;  1TWG C;  2E2J K;  2NVQ K;  5C4X K;  2A68 A;  5IYB K;  4A3E C;  2NVY K;  3GTQ K;  3M4O K;  3HOW C;  3RZO K;  5IP9 C;  4OIQ A;  4BBS K;  3H0G C;  3S1M C;  4C3J K;  3HOZ C;  3WOD A;  1R9T K;  2BE5 A;  5TMF A;  3HKZ L;  3S1R C;  4A3B C;  4A3C K;  1TWH K;  2VUM K;  3HOV C;  4BY7 C;  2NVT C;  4AYB D;  4XLN A;  2JA7 K;  4NOI A;  5M5Y K;  4A3I K;  3HOU C;  3PO2 C;  5IYD K;  3DXJ A;  1TWC K;  4BBR C;  4BY1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...