3PO3K

Arrested rna polymerase ii reactivation intermediate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3po3K00
4BY7C 2R7ZC 3GTQK 2E2HC 2R7ZK 4QJVA 4GZYA 4BY7K 2E2HK 4A3BC 1YNNA 1I50C 4XLNA 3RZDC 4A3LK 4A3BK 1I50K 3RZDK 4OIRA 3S17C 2WB1D 4KMUA 3GTLC 1ZYRA 3S15C 1R9TC 3GTLK 3HOWC 3S15K 3HOXK 1R9TK 4A3CC 3H0GK 3HKZD 5IP7C 5IP7K 1TWGK 3K7AK 4OIQA 1Y1VC 4YG2A 1Y1VK 2E2IC 4QJVB 4Q5SA 4XSZA 5IYDC 4YFKA 2O5JA 5IYDK 1I3QC 4KN4A 4Y52C 4Q4ZA 4X6AK 4Y52K 4LK1A 4QIWD 4A3KC 3GTOC 1XPPA 4LK0A 4NOIA 4A3KK 3HOYC 3M3YC 2NVQC 3S1RC 3M3YK 3S16K 2NVQK 3S1RK 2Y0SL 1TWAC 2JA7C 2VUMC 2VUMK 2CW0A 1TWAK 4A3FC 2JA7K 4G7OA 1HQMA 4A3FK 2WAQL 3GTPC 3S2HC 3GTPK 2A68A 3S2HK 4OINA 3H3VL 4KN7A 1I6VA 4A3EC 3S17K 4OIPA 3S1QC 3FKIC 4A3EK 3CQZC 3EQLA 5TMFA 3FKIK 5D4DA 3HOWK 3CQZK 3S1QK 1TWHC 4MQ9A 1SFOC 4A3CK 3S14C 1SFOK 2BE5A 2JA8C 2JA8K 1YNJA 2PMZL 4ZH4A 4YFXA 3HOZC 2PA8D 5IYCC 4BXXC 3GTJC 2E2IK 3HOZK 4BXXK 4BY1C 3GTJK 5M5YK 4BY1K 5C4XC 1I3QK 4C3IK 5M5XK 3GTOK 3HOYK 2NVXC 3HOUC 3WODA 4OIOA 3HOUK 5C44C 2WB1L 4A93C 5C44K 4C3JK 1BDFA 1WCMC 3I4MC 2WAQD 3I4MK 3PO3C 1WCMK 2R93C 3GTKC 3HKZL 1I6HC 3GTKK 2R93K 4LJZA 3I4NC 1I6HK 4A3JC 3I4NK 2NVTC 3H3VD 2A6EA 4A3JK 2NVTK 3S2DC 3S16C 3PO2C 4C3HK 5TMCA 2JA6C 4A3IC 3PO2K 1TWHK 2JA6K 1TWFC 4A3IK 3S14K 4LLGA 1TWFK 5IP9C 5FJ8K 5C3EC 3GTMC 5IP9K 5C3EK 2YU9C 3GTMK 1SMYA 1TWCC 2YU9K 5IYCK 5IYBC 1TWCK 4AYBL 2R92C 3HOVC 5M3FK 3HOVK 5C4XK 3GTQC 4XLPA 2JA5C 4Y7NC 5M3MK 4G7ZA 2JA5K 4A3DC 4BBRC 4Y7NK 4A3DK 4BBRK 3RZOC 2NVXK 4A3LC 3RZOK 2Y0SD 1Y1WC 4G7HA 1Y1WK 3GTGC 2PPBA 4C2MK 4A93K 4A3GC 3GTGK 3HOXC 4XSXA 3PO3K 3H0GC 5C4JC 3M4OC 4A3GK 4A3MC 5C4JK 3M4OK 4A3MK 1TWGC 3K7AC 2O5IA 4BBSC 4MEXA 2B63C 2A6HA 4BBSK 5M5WK 2B63K 2PA8L 3S2DK 4YFNA 3DXJA 2E2JC 3S1MC 4X6AC 1K83C 4MEYA 2E2JK 4QIWL 5FLMC 3S1MK 1K83K 4JK1A 2PMZD 5FLMK 3S1NC 2NVYC 4AYBD 5IYBK 2R92K 2NVYK 3S1NK 1IW7A 2A69A
chains in the Genus database with same CATH superfamily
4BY7C 3TTGA 1I50A 3GTQK 1AB4A 4QJVA 2E2HK 1I50C 3RZDC 3GTLA 2JH3A 3GTLC 1PJ5A 3HOWC 1WQGA 3HOXK 1EI6A 3H0GK 5IP7K 1TWGK 4OIQA 1Y1VK 4KC6A 4QJVB 4Q5SA 4G0VA 4KMAA 1J6WA 3GTOA 1PJ7A 4A3KC 3GTOC 4WJ4A 3G4CA 4NOIA 3M3YK 3S16K 2JA7A 5JVOA 2JA7C 4BLAA 4A3FK 1O28A 3GTPK 1WOSA 2ZUEA 1JQWA 3FKIA 3MMLB 1IE0A 4KN7A 1TWHA 4OIPA 3FKIC 3GDZA 1DCPA 3EQLA 1TWFA 1TWHC 3S14C 2BE5A 2JA8K 3BP8C 3HOZC 4BY1C 1ZQ1C 5M5YK 4KM8A 2V6SA 1O24A 3HOYK 3HOUC 3WODA 1VRQC 1WSRA 2WB1L 1ZXOA 2WAQD 3I4MK 3PO3C 1WCMK 4GTFA 1ZBSA 5E68A 1I6HC 2R93K 4LJZA 3I4NK 1C0AA 4A3JK 3OREA 4C3HC 3AD7C 4ILDA 3PO2C 1ISEA 2JA6K 3GIRA 2YU9A 5IP9K 2R92A 5C3EK 2YU9C 3GTMK 1TWCK 2R92C 3GTQA 2JA5A 2GSNA 3HOVK 5C4XK 3GTQC 4XLPA 2JA5C 1USMA 5M3MK 4GTAA 3V4GA 3RZOC 1O2BA 1VLOA 1B4AA 3H0GA 2KWAA 3GTGK 3HOXC 1TWGA 3H0GC 3M4OC 5C4JK 1Y1VA 4A3MK 1TWGC 4BBSK 2B63K 1EH1A 3OEPA 1J6XA 2RH6A 5TJ3A 3GSIA 5FLMC 1K83K 4AYBD 5IYBK 3LAJA 5EGEA 1X31C 3N0BA 1WSVA 2R7ZC 1GE9A 4A3BC 1JOEA 4XLNA 4A3LK 4LQYA 1HI9A 1R9TA 4OIRA 3FOEA 2WB1D 5IOTA 1INNA 3S15C 1R9TC 1IBAA 4LR2A 1F93A 3A8IA 4PAAA 4YG2A 1BJTA 1RU0A 5IYDK 4KN4A 4Y52C 1G51A 2VUMA 3HOYC 1TWAA 2NVQC 3S1RC 2VUMC 1WCMA 1TWAC 2CW0A 1EK8A 2WAQL 2A68A 3S2HK 3SZYA 4A3EC 1SFOA 3S1QK 4KM9A 3CQZK 1SFOC 3BUEA 3T02A 5CHPA 3TFIA 4YFXA 2E2IK 4BXXK 4KASA 3GTJK 3LAPA 5C4XC 1I3QK 4C3IK 1EQRA 3NUHA 5M5XK 4G0WA 5C44C 3AH5A 1EFWA 4C3JK 3GTKA 4FZBA 3GTKC 1XXCA 2XCQA 3N3YA 3L4JA 4WILA 2NVTC 2A6EA 4GTBA 1TWFC 4A3IK 4LLGA 1O25A 1F7VA 3S0XA 1SMYA 5IYCK 2P8TA 5IYBC 4AYBL 4XCHA 4AH6A 1DCHA 1Y1WA 4BBRC 4Y7NK 4A3DK 4A3LC 2NVXK 3N0CA 1Y1WC 4G7HA 4KAWX 4A93K 4A3GC 1BGWA 1YX2A 4MEXA 4BKWA 5M5WK 3DXJA 2E2JC 3S1MC 4KARA 2NVYA 3ADAC 3TFHA 4JK1A 4LOWA 3VA7A 3S1NC 2NVYC 2E2HA 1IW7A 2A69A 3FHZA 4BY7K 2E2HC 2XCRB 1YNNA 2Y3PA 1I50K 4M1XA 3RZDK 3CQZA 1IL2A 4KMHA 3GTLK 5IP7C 3G4AA 1XXAA 2E2IA 1XZPA 3GTJA 1Y1VC 1DCOA 1I3QA 2E2IC 3AD8C 4KB2A 4XSZA 4P5AA 4GFQA 2GSOA 1WORA 1I3QC 4C3IC 4Q4ZA 4X6AK 4QIWD 3M3YC 2V6TA 3S16C 4LK0A 4A3KK 2FQTA 4G7OA 1F7UA 4A3FC 2JA7K 3GTPA 5EGHA 1HQMA 1XZPB 3Q3QA 3BP3A 3GTPC 3S17K 5TMFA 3FKIK 5D4DA 1O2FB 4MQ9A 4A3CK 2JA8C 4P9SA 1YNJA 2PMZL 5IYCC 3HOZK 4RMFA 1F9NA 4BY1K 2NVXA 4PABA 1IS1A 1O26A 1PJ6A 1WQHA 2NVXC 3HOUK 2P5MA 4A93C 2R93A 3I4MC 1BDFA 1WCMC 4G0UA 2R93C 3HKZL 1XZQA 1VH2A 3FOFA 5IOSA 3I4NC 1I6HK 4A3JC 3H3VD 5L46A 2JA6A 4GTDA 4C3HK 2JA6C 3PO2K 3GTMA 5JFEA 1TWCA 5IP9C 5C3EC 3GTMC 1VJEA 3AQPA 1TWCC 2YU9K 4KB4A 1XZQB 3HOVC 5M3FK 1VGXA 3GEEA 1WQFA 3HXAA 4BLBA 2JA5K 4KMDA 3IPJA 3GTGA 5HL8A 3RZOK 3AQOA 1KQ4A 3GTGC 2PPBA 4C2MK 5C4JC 4A3MC 3M4OK 2B63A 2O5IA 4BBSC 1BS2A 2B63C 2A6HA 3JSTA 3CAGA 5IORA 2PA8L 4GTLA 3S2DK 1V5VA 1K83A 4X6AC 1K83C 4QIWL 2PMZD 5FLMK 1B4BA 4FM9A 2V6UA 3GEIA 4P5BA 2W7VA 3GEHA 2R7ZK 3OPFA 1XXBA 4GZYA 4A3BK 2EBBA 3LPXA 1WIHA 3S17C 4KMUA 1UV7A 1ZYRA 3S15K 1R9TK 1J6VA 3HKZD 4A3CC 3A8JA 3K7AK 2GAHC 1O29A 5IYDC 4YFKA 2O5JA 4Y52K 4O2DA 4LK1A 1DD5A 1XPPA 1WOOA 2NVQK 3S1RK 2Y0SL 2VUMK 1TWAK 3S2HC 5IOQA 4OINA 3H3VL 1I6VA 2FQOA 3S1QC 4GT9A 1L0WA 3CQZC 4A3EK 3HOWK 1SFOK 1WOPA 4ZH4A 4BXXC 2PA8D 3T01A 3GTJC 3SZZA 3GTOK 1USOA 2XCOA 4OIOA 3TFJA 4KATA 4C3JC 5CJ9A 4C2MC 5C44K 1O27A 2GAGC 1ZVUA 3GTKK 3T00A 4KDDA 1O2AA 2NVTK 3S2DC 1IQ0A 5TMCA 4A3IC 1TWHK 3ERED 3S14K 1TWFK 4WJ3M 5FJ8K 2GSUA 3AD9C 2R7ZA 4Y7NC 4G7ZA 4A3DC 1YCLA 2PHCB 4BBRK 1JVIA 2Y0SD 1Y1WK 2CFAA 4XSXA 3PO3K 4A3GK 4GTEA 3K7AC 2ZFZA 4C45A 1J98A 4DDQA 2ZUFA 4J3NA 2RGRA 4YFNA 4GTCA 3A8KA 2E2JK 4MEYA 3QX3A 3S1MK 2CFAB 3S1NK 2D6FC 2NVYK 2R92K 3L4KA
chains in the Genus database with same CATH topology
4BY7C 2R7ZC 3GTQK 2E2HC 2R7ZK 4QJVA 4GZYA 4BY7K 2E2HK 4A3BC 1YNNA 1I50C 4XLNA 3RZDC 4A3LK 4A3BK 1I50K 3RZDK 4OIRA 3S17C 2WB1D 4KMUA 3GTLC 1ZYRA 3S15C 1R9TC 3GTLK 3HOWC 3S15K 3HOXK 1R9TK 4A3CC 3H0GK 3HKZD 5IP7C 5IP7K 1TWGK 3K7AK 4OIQA 1Y1VC 4YG2A 1Y1VK 2E2IC 4QJVB 4Q5SA 4XSZA 5IYDC 4YFKA 2O5JA 5IYDK 1I3QC 4KN4A 4Y52C 4Q4ZA 4X6AK 4Y52K 4LK1A 4QIWD 4A3KC 3GTOC 1XPPA 4LK0A 4NOIA 4A3KK 3HOYC 3M3YC 2NVQC 3S1RC 3M3YK 3S16K 2NVQK 3S1RK 2Y0SL 1TWAC 2JA7C 2VUMC 2VUMK 2CW0A 1TWAK 4A3FC 2JA7K 4G7OA 1HQMA 4A3FK 2WAQL 3GTPC 3S2HC 3GTPK 2A68A 3S2HK 4OINA 3H3VL 4KN7A 1I6VA 4A3EC 3S17K 4OIPA 3S1QC 3FKIC 4A3EK 3CQZC 3EQLA 5TMFA 3FKIK 5D4DA 3HOWK 3CQZK 3S1QK 1TWHC 4MQ9A 1SFOC 4A3CK 3S14C 1SFOK 2BE5A 2JA8C 2JA8K 1YNJA 2PMZL 4ZH4A 4YFXA 3HOZC 2PA8D 5IYCC 4BXXC 3GTJC 2E2IK 3HOZK 4BXXK 4BY1C 3GTJK 5M5YK 4BY1K 5C4XC 1I3QK 4C3IK 5M5XK 3GTOK 3HOYK 2NVXC 3HOUC 3WODA 4OIOA 3HOUK 5C44C 2WB1L 4A93C 5C44K 4C3JK 1BDFA 1WCMC 3I4MC 2WAQD 3I4MK 3PO3C 1WCMK 2R93C 3GTKC 3HKZL 1I6HC 3GTKK 2R93K 4LJZA 3I4NC 1I6HK 4A3JC 3I4NK 2NVTC 3H3VD 2A6EA 4A3JK 2NVTK 3S2DC 3S16C 3PO2C 4C3HK 5TMCA 2JA6C 4A3IC 3PO2K 1TWHK 2JA6K 1TWFC 4A3IK 3S14K 4LLGA 1TWFK 5IP9C 5FJ8K 5C3EC 3GTMC 5IP9K 5C3EK 2YU9C 3GTMK 1SMYA 1TWCC 2YU9K 5IYCK 5IYBC 1TWCK 4AYBL 2R92C 3HOVC 5M3FK 3HOVK 5C4XK 3GTQC 4XLPA 2JA5C 4Y7NC 5M3MK 4G7ZA 2JA5K 4A3DC 4BBRC 4Y7NK 4A3DK 4BBRK 3RZOC 2NVXK 4A3LC 3RZOK 2Y0SD 1Y1WC 4G7HA 1Y1WK 3GTGC 2PPBA 4C2MK 4A93K 4A3GC 3GTGK 3HOXC 4XSXA 3PO3K 3H0GC 5C4JC 3M4OC 4A3GK 4A3MC 5C4JK 3M4OK 4A3MK 1TWGC 3K7AC 2O5IA 4BBSC 4MEXA 2B63C 2A6HA 4BBSK 5M5WK 2B63K 2PA8L 3S2DK 4YFNA 3DXJA 2E2JC 3S1MC 4X6AC 1K83C 4MEYA 2E2JK 4QIWL 5FLMC 3S1MK 1K83K 4JK1A 2PMZD 5FLMK 3S1NC 2NVYC 4AYBD 5IYBK 2R92K 2NVYK 3S1NK 1IW7A 2A69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 C;  2R7Z C;  3GTQ K;  2E2H C;  2R7Z K;  4QJV A;  4GZY A;  4BY7 K;  2E2H K;  4A3B C;  1YNN A;  1I50 C;  4XLN A;  3RZD C;  4A3L K;  4A3B K;  1I50 K;  3RZD K;  4OIR A;  3S17 C;  2WB1 D;  4KMU A;  3GTL C;  1ZYR A;  3S15 C;  1R9T C;  3GTL K;  3HOW C;  3S15 K;  3HOX K;  1R9T K;  4A3C C;  3H0G K;  3HKZ D;  5IP7 C;  5IP7 K;  1TWG K;  3K7A K;  4OIQ A;  1Y1V C;  4YG2 A;  1Y1V K;  2E2I C;  4QJV B;  4Q5S A;  4XSZ A;  5IYD C;  4YFK A;  2O5J A;  5IYD K;  1I3Q C;  4KN4 A;  4Y52 C;  4Q4Z A;  4X6A K;  4Y52 K;  4LK1 A;  4QIW D;  4A3K C;  3GTO C;  1XPP A;  4LK0 A;  4NOI A;  4A3K K;  3HOY C;  3M3Y C;  2NVQ C;  3S1R C;  3M3Y K;  3S16 K;  2NVQ K;  3S1R K;  2Y0S L;  1TWA C;  2JA7 C;  2VUM C;  2VUM K;  2CW0 A;  1TWA K;  4A3F C;  2JA7 K;  4G7O A;  1HQM A;  4A3F K;  2WAQ L;  3GTP C;  3S2H C;  3GTP K;  2A68 A;  3S2H K;  4OIN A;  3H3V L;  4KN7 A;  1I6V A;  4A3E C;  3S17 K;  4OIP A;  3S1Q C;  3FKI C;  4A3E K;  3CQZ C;  3EQL A;  5TMF A;  3FKI K;  5D4D A;  3HOW K;  3CQZ K;  3S1Q K;  1TWH C;  4MQ9 A;  1SFO C;  4A3C K;  3S14 C;  1SFO K;  2BE5 A;  2JA8 C;  2JA8 K;  1YNJ A;  2PMZ L;  4ZH4 A;  4YFX A;  3HOZ C;  2PA8 D;  5IYC C;  4BXX C;  3GTJ C;  2E2I K;  3HOZ K;  4BXX K;  4BY1 C;  3GTJ K;  5M5Y K;  4BY1 K;  5C4X C;  1I3Q K;  4C3I K;  5M5X K;  3GTO K;  3HOY K;  2NVX C;  3HOU C;  3WOD A;  4OIO A;  3HOU K;  5C44 C;  2WB1 L;  4A93 C;  5C44 K;  4C3J K;  1BDF A;  1WCM C;  3I4M C;  2WAQ D;  3I4M K;  3PO3 C;  1WCM K;  2R93 C;  3GTK C;  3HKZ L;  1I6H C;  3GTK K;  2R93 K;  4LJZ A;  3I4N C;  1I6H K;  4A3J C;  3I4N K;  2NVT C;  3H3V D;  2A6E A;  4A3J K;  2NVT K;  3S2D C;  3S16 C;  3PO2 C;  4C3H K;  5TMC A;  2JA6 C;  4A3I C;  3PO2 K;  1TWH K;  2JA6 K;  1TWF C;  4A3I K;  3S14 K;  4LLG A;  1TWF K;  5IP9 C;  5FJ8 K;  5C3E C;  3GTM C;  5IP9 K;  5C3E K;  2YU9 C;  3GTM K;  1SMY A;  1TWC C;  2YU9 K;  5IYC K;  5IYB C;  1TWC K;  4AYB L;  2R92 C;  3HOV C;  5M3F K;  3HOV K;  5C4X K;  3GTQ C;  4XLP A;  2JA5 C;  4Y7N C;  5M3M K;  4G7Z A;  2JA5 K;  4A3D C;  4BBR C;  4Y7N K;  4A3D K;  4BBR K;  3RZO C;  2NVX K;  4A3L C;  3RZO K;  2Y0S D;  1Y1W C;  4G7H A;  1Y1W K;  3GTG C;  2PPB A;  4C2M K;  4A93 K;  4A3G C;  3GTG K;  3HOX C;  4XSX A;  3PO3 K;  3H0G C;  5C4J C;  3M4O C;  4A3G K;  4A3M C;  5C4J K;  3M4O K;  4A3M K;  1TWG C;  3K7A C;  2O5I A;  4BBS C;  4MEX A;  2B63 C;  2A6H A;  4BBS K;  5M5W K;  2B63 K;  2PA8 L;  3S2D K;  4YFN A;  3DXJ A;  2E2J C;  3S1M C;  4X6A C;  1K83 C;  4MEY A;  2E2J K;  4QIW L;  5FLM C;  3S1M K;  1K83 K;  4JK1 A;  2PMZ D;  5FLM K;  3S1N C;  2NVY C;  4AYB D;  5IYB K;  2R92 K;  2NVY K;  3S1N K;  1IW7 A;  2A69 A; 
#chains in the Genus database with same CATH topology
 4BY7 C;  3TTG A;  1I50 A;  3GTQ K;  1AB4 A;  4QJV A;  2E2H K;  1I50 C;  3RZD C;  3GTL A;  2JH3 A;  3GTL C;  1PJ5 A;  3HOW C;  1WQG A;  3HOX K;  1EI6 A;  3H0G K;  5IP7 K;  1TWG K;  4OIQ A;  1Y1V K;  4KC6 A;  4QJV B;  4Q5S A;  4G0V A;  4KMA A;  1J6W A;  3GTO A;  1PJ7 A;  4A3K C;  3GTO C;  4WJ4 A;  3G4C A;  4NOI A;  3M3Y K;  3S16 K;  2JA7 A;  5JVO A;  2JA7 C;  4BLA A;  4A3F K;  1O28 A;  3GTP K;  1WOS A;  2ZUE A;  1JQW A;  3FKI A;  3MML B;  1IE0 A;  4KN7 A;  1TWH A;  4OIP A;  3FKI C;  3GDZ A;  1DCP A;  3EQL A;  1TWF A;  1TWH C;  3S14 C;  2BE5 A;  2JA8 K;  3BP8 C;  3HOZ C;  4BY1 C;  1ZQ1 C;  5M5Y K;  4KM8 A;  2V6S A;  1O24 A;  3HOY K;  3HOU C;  3WOD A;  1VRQ C;  1WSR A;  2WB1 L;  1ZXO A;  2WAQ D;  3I4M K;  3PO3 C;  1WCM K;  4GTF A;  1ZBS A;  5E68 A;  1I6H C;  2R93 K;  4LJZ A;  3I4N K;  1C0A A;  4A3J K;  3ORE A;  4C3H C;  3AD7 C;  4ILD A;  3PO2 C;  1ISE A;  2JA6 K;  3GIR A;  2YU9 A;  5IP9 K;  2R92 A;  5C3E K;  2YU9 C;  3GTM K;  1TWC K;  2R92 C;  3GTQ A;  2JA5 A;  2GSN A;  3HOV K;  5C4X K;  3GTQ C;  4XLP A;  2JA5 C;  1USM A;  5M3M K;  4GTA A;  3V4G A;  3RZO C;  1O2B A;  1VLO A;  1B4A A;  3H0G A;  2KWA A;  3GTG K;  3HOX C;  1TWG A;  3H0G C;  3M4O C;  5C4J K;  1Y1V A;  4A3M K;  1TWG C;  4BBS K;  2B63 K;  1EH1 A;  3OEP A;  1J6X A;  2RH6 A;  5TJ3 A;  3GSI A;  5FLM C;  1K83 K;  4AYB D;  5IYB K;  3LAJ A;  5EGE A;  1X31 C;  3N0B A;  1WSV A;  2R7Z C;  1GE9 A;  4A3B C;  1JOE A;  4XLN A;  4A3L K;  4LQY A;  1HI9 A;  1R9T A;  4OIR A;  3FOE A;  2WB1 D;  5IOT A;  1INN A;  3S15 C;  1R9T C;  1IBA A;  4LR2 A;  1F93 A;  3A8I A;  4PAA A;  4YG2 A;  1BJT A;  1RU0 A;  5IYD K;  4KN4 A;  4Y52 C;  1G51 A;  2VUM A;  3HOY C;  1TWA A;  2NVQ C;  3S1R C;  2VUM C;  1WCM A;  1TWA C;  2CW0 A;  1EK8 A;  2WAQ L;  2A68 A;  3S2H K;  3SZY A;  4A3E C;  1SFO A;  3S1Q K;  4KM9 A;  3CQZ K;  1SFO C;  3BUE A;  3T02 A;  5CHP A;  3TFI A;  4YFX A;  2E2I K;  4BXX K;  4KAS A;  3GTJ K;  3LAP A;  5C4X C;  1I3Q K;  4C3I K;  1EQR A;  3NUH A;  5M5X K;  4G0W A;  5C44 C;  3AH5 A;  1EFW A;  4C3J K;  3GTK A;  4FZB A;  3GTK C;  1XXC A;  2XCQ A;  3N3Y A;  3L4J A;  4WIL A;  2NVT C;  2A6E A;  4GTB A;  1TWF C;  4A3I K;  4LLG A;  1O25 A;  1F7V A;  3S0X A;  1SMY A;  5IYC K;  2P8T A;  5IYB C;  4AYB L;  4XCH A;  4AH6 A;  1DCH A;  1Y1W A;  4BBR C;  4Y7N K;  4A3D K;  4A3L C;  2NVX K;  3N0C A;  1Y1W C;  4G7H A;  4KAW X;  4A93 K;  4A3G C;  1BGW A;  1YX2 A;  4MEX A;  4BKW A;  5M5W K;  3DXJ A;  2E2J C;  3S1M C;  4KAR A;  2NVY A;  3ADA C;  3TFH A;  4JK1 A;  4LOW A;  3VA7 A;  3S1N C;  2NVY C;  2E2H A;  1IW7 A;  2A69 A;  3FHZ A;  4BY7 K;  2E2H C;  2XCR B;  1YNN A;  2Y3P A;  1I50 K;  4M1X A;  3RZD K;  3CQZ A;  1IL2 A;  4KMH A;  3GTL K;  5IP7 C;  3G4A A;  1XXA A;  2E2I A;  1XZP A;  3GTJ A;  1Y1V C;  1DCO A;  1I3Q A;  2E2I C;  3AD8 C;  4KB2 A;  4XSZ A;  4P5A A;  4GFQ A;  2GSO A;  1WOR A;  1I3Q C;  4C3I C;  4Q4Z A;  4X6A K;  4QIW D;  3M3Y C;  2V6T A;  3S16 C;  4LK0 A;  4A3K K;  2FQT A;  4G7O A;  1F7U A;  4A3F C;  2JA7 K;  3GTP A;  5EGH A;  1HQM A;  1XZP B;  3Q3Q A;  3BP3 A;  3GTP C;  3S17 K;  5TMF A;  3FKI K;  5D4D A;  1O2F B;  4MQ9 A;  4A3C K;  2JA8 C;  4P9S A;  1YNJ A;  2PMZ L;  5IYC C;  3HOZ K;  4RMF A;  1F9N A;  4BY1 K;  2NVX A;  4PAB A;  1IS1 A;  1O26 A;  1PJ6 A;  1WQH A;  2NVX C;  3HOU K;  2P5M A;  4A93 C;  2R93 A;  3I4M C;  1BDF A;  1WCM C;  4G0U A;  2R93 C;  3HKZ L;  1XZQ A;  1VH2 A;  3FOF A;  5IOS A;  3I4N C;  1I6H K;  4A3J C;  3H3V D;  5L46 A;  2JA6 A;  4GTD A;  4C3H K;  2JA6 C;  3PO2 K;  3GTM A;  5JFE A;  1TWC A;  5IP9 C;  5C3E C;  3GTM C;  1VJE A;  3AQP A;  1TWC C;  2YU9 K;  4KB4 A;  1XZQ B;  3HOV C;  5M3F K;  1VGX A;  3GEE A;  1WQF A;  3HXA A;  4BLB A;  2JA5 K;  4KMD A;  3IPJ A;  3GTG A;  5HL8 A;  3RZO K;  3AQO A;  1KQ4 A;  3GTG C;  2PPB A;  4C2M K;  5C4J C;  4A3M C;  3M4O K;  2B63 A;  2O5I A;  4BBS C;  1BS2 A;  2B63 C;  2A6H A;  3JST A;  3CAG A;  5IOR A;  2PA8 L;  4GTL A;  3S2D K;  1V5V A;  1K83 A;  4X6A C;  1K83 C;  4QIW L;  2PMZ D;  5FLM K;  1B4B A;  4FM9 A;  2V6U A;  3GEI A;  4P5B A;  2W7V A;  3GEH A;  2R7Z K;  3OPF A;  1XXB A;  4GZY A;  4A3B K;  2EBB A;  3LPX A;  1WIH A;  3S17 C;  4KMU A;  1UV7 A;  1ZYR A;  3S15 K;  1R9T K;  1J6V A;  3HKZ D;  4A3C C;  3A8J A;  3K7A K;  2GAH C;  1O29 A;  5IYD C;  4YFK A;  2O5J A;  4Y52 K;  4O2D A;  4LK1 A;  1DD5 A;  1XPP A;  1WOO A;  2NVQ K;  3S1R K;  2Y0S L;  2VUM K;  1TWA K;  3S2H C;  5IOQ A;  4OIN A;  3H3V L;  1I6V A;  2FQO A;  3S1Q C;  4GT9 A;  1L0W A;  3CQZ C;  4A3E K;  3HOW K;  1SFO K;  1WOP A;  4ZH4 A;  4BXX C;  2PA8 D;  3T01 A;  3GTJ C;  3SZZ A;  3GTO K;  1USO A;  2XCO A;  4OIO A;  3TFJ A;  4KAT A;  4C3J C;  5CJ9 A;  4C2M C;  5C44 K;  1O27 A;  2GAG C;  1ZVU A;  3GTK K;  3T00 A;  4KDD A;  1O2A A;  2NVT K;  3S2D C;  1IQ0 A;  5TMC A;  4A3I C;  1TWH K;  3ERE D;  3S14 K;  1TWF K;  4WJ3 M;  5FJ8 K;  2GSU A;  3AD9 C;  2R7Z A;  4Y7N C;  4G7Z A;  4A3D C;  1YCL A;  2PHC B;  4BBR K;  1JVI A;  2Y0S D;  1Y1W K;  2CFA A;  4XSX A;  3PO3 K;  4A3G K;  4GTE A;  3K7A C;  2ZFZ A;  4C45 A;  1J98 A;  4DDQ A;  2ZUF A;  4J3N A;  2RGR A;  4YFN A;  4GTC A;  3A8K A;  2E2J K;  4MEY A;  3QX3 A;  3S1M K;  2CFA B;  3S1N K;  2D6F C;  2NVY K;  2R92 K;  3L4K A; 
#chains in the Genus database with same CATH homology
 4BY7 C;  2R7Z C;  3GTQ K;  2E2H C;  2R7Z K;  4QJV A;  4GZY A;  4BY7 K;  2E2H K;  4A3B C;  1YNN A;  1I50 C;  4XLN A;  3RZD C;  4A3L K;  4A3B K;  1I50 K;  3RZD K;  4OIR A;  3S17 C;  2WB1 D;  4KMU A;  3GTL C;  1ZYR A;  3S15 C;  1R9T C;  3GTL K;  3HOW C;  3S15 K;  3HOX K;  1R9T K;  4A3C C;  3H0G K;  3HKZ D;  5IP7 C;  5IP7 K;  1TWG K;  3K7A K;  4OIQ A;  1Y1V C;  4YG2 A;  1Y1V K;  2E2I C;  4QJV B;  4Q5S A;  4XSZ A;  5IYD C;  4YFK A;  2O5J A;  5IYD K;  1I3Q C;  4KN4 A;  4Y52 C;  4Q4Z A;  4X6A K;  4Y52 K;  4LK1 A;  4QIW D;  4A3K C;  3GTO C;  1XPP A;  4LK0 A;  4NOI A;  4A3K K;  3HOY C;  3M3Y C;  2NVQ C;  3S1R C;  3M3Y K;  3S16 K;  2NVQ K;  3S1R K;  2Y0S L;  1TWA C;  2JA7 C;  2VUM C;  2VUM K;  2CW0 A;  1TWA K;  4A3F C;  2JA7 K;  4G7O A;  1HQM A;  4A3F K;  2WAQ L;  3GTP C;  3S2H C;  3GTP K;  2A68 A;  3S2H K;  4OIN A;  3H3V L;  4KN7 A;  1I6V A;  4A3E C;  3S17 K;  4OIP A;  3S1Q C;  3FKI C;  4A3E K;  3CQZ C;  3EQL A;  5TMF A;  3FKI K;  5D4D A;  3HOW K;  3CQZ K;  3S1Q K;  1TWH C;  4MQ9 A;  1SFO C;  4A3C K;  3S14 C;  1SFO K;  2BE5 A;  2JA8 C;  2JA8 K;  1YNJ A;  2PMZ L;  4ZH4 A;  4YFX A;  3HOZ C;  2PA8 D;  5IYC C;  4BXX C;  3GTJ C;  2E2I K;  3HOZ K;  4BXX K;  4BY1 C;  3GTJ K;  5M5Y K;  4BY1 K;  5C4X C;  1I3Q K;  4C3I K;  5M5X K;  3GTO K;  3HOY K;  2NVX C;  3HOU C;  3WOD A;  4OIO A;  3HOU K;  5C44 C;  2WB1 L;  4A93 C;  5C44 K;  4C3J K;  1BDF A;  1WCM C;  3I4M C;  2WAQ D;  3I4M K;  3PO3 C;  1WCM K;  2R93 C;  3GTK C;  3HKZ L;  1I6H C;  3GTK K;  2R93 K;  4LJZ A;  3I4N C;  1I6H K;  4A3J C;  3I4N K;  2NVT C;  3H3V D;  2A6E A;  4A3J K;  2NVT K;  3S2D C;  3S16 C;  3PO2 C;  4C3H K;  5TMC A;  2JA6 C;  4A3I C;  3PO2 K;  1TWH K;  2JA6 K;  1TWF C;  4A3I K;  3S14 K;  4LLG A;  1TWF K;  5IP9 C;  5FJ8 K;  5C3E C;  3GTM C;  5IP9 K;  5C3E K;  2YU9 C;  3GTM K;  1SMY A;  1TWC C;  2YU9 K;  5IYC K;  5IYB C;  1TWC K;  4AYB L;  2R92 C;  3HOV C;  5M3F K;  3HOV K;  5C4X K;  3GTQ C;  4XLP A;  2JA5 C;  4Y7N C;  5M3M K;  4G7Z A;  2JA5 K;  4A3D C;  4BBR C;  4Y7N K;  4A3D K;  4BBR K;  3RZO C;  2NVX K;  4A3L C;  3RZO K;  2Y0S D;  1Y1W C;  4G7H A;  1Y1W K;  3GTG C;  2PPB A;  4C2M K;  4A93 K;  4A3G C;  3GTG K;  3HOX C;  4XSX A;  3PO3 K;  3H0G C;  5C4J C;  3M4O C;  4A3G K;  4A3M C;  5C4J K;  3M4O K;  4A3M K;  1TWG C;  3K7A C;  2O5I A;  4BBS C;  4MEX A;  2B63 C;  2A6H A;  4BBS K;  5M5W K;  2B63 K;  2PA8 L;  3S2D K;  4YFN A;  3DXJ A;  2E2J C;  3S1M C;  4X6A C;  1K83 C;  4MEY A;  2E2J K;  4QIW L;  5FLM C;  3S1M K;  1K83 K;  4JK1 A;  2PMZ D;  5FLM K;  3S1N C;  2NVY C;  4AYB D;  5IYB K;  2R92 K;  2NVY K;  3S1N K;  1IW7 A;  2A69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...