3PO3K

Arrested rna polymerase ii reactivation intermediate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3po3K00
4QIWD 4NOIA 3DXJA 5C4JC 4OIQA 4BBRK 2R92K 3GTMK 3CQZK 5IP9C 4YFXA 3S14K 3S16K 1BDFA 5M5WK 3S2DK 4QJVB 4A3JC 5D4DA 4X6AC 4YG2A 3S1RK 5M3FK 3H3VD 4A3MC 2BE5A 3GTJC 4BY7C 3RZOK 4LK0A 4C3HK 4A3IK 1TWHC 3GTPC 4OIRA 2PMZD 2E2JC 3S1NC 4XSXA 1R9TK 1K83C 1TWAC 2R93K 3PO3K 3S17C 2PPBA 1YNJA 1Y1VK 5IP7C 2B63K 5IYBC 2JA7C 2E2IC 4A3GC 2NVXC 4BXXC 3EQLA 2YU9C 3GTMC 2A6HA 2A69A 3S15K 5C44C 3GTLC 3S1MK 4YFNA 5M5YK 4A3CC 4G7HA 2JA5K 1SFOK 3S2DC 2E2HK 3S14C 3HOZC 1ZYRA 1I50K 1Y1WC 4Y52K 2PA8L 2R7ZC 2VUMC 4ZH4A 3S1QK 4Y7NK 4MQ9A 1XPPA 4A3BC 4A3LK 3GTJK 5C4JK 2R92C 3PO2K 3CQZC 5IP9K 4C2MK 4XLNA 5C3EK 4MEYA 4LK1A 5IYBK 3M4OC 4BXXK 2NVYC 3HKZL 4AYBD 4XLPA 3S17K 1TWGC 1YNNA 2E2JK 2NVXK 3S1NK 4YFKA 4A3FC 2WB1D 4A3IC 4X6AK 5C4XC 5FJ8K 3GTGC 4LJZA 4A3KC 3S2HK 3I4MK 2JA7K 4A3GK 3H0GK 4C3IK 2E2HC 3HOXK 4A3DC 3GTKC 3HOUK 4MEXA 4A3BK 5IYCK 4A3EC 3I4NC 2JA6K 2CW0A 4KMUA 3HOVC 3GTQK 4AYBL 4LLGA 1TWFC 3FKIC 5FLMK 5C3EC 4Y52C 4G7ZA 2JA8C 1I6HK 4BY1K 1WCMC 3S1QC 2JA5C 4A3LC 1I3QC 1TWCK 2A6EA 1I50C 2PA8D 5M3MK 5M5XK 5IYDK 5C4XK 3RZDC 1TWGK 2WAQD 4BBSK 3K7AK 2NVQC 3M4OK 2Y0SD 4GZYA 3PO2C 4A93K 3GTOC 4A3DK 3WODA 5IYCC 5TMCA 3M3YC 3H0GC 2O5JA 2JA6C 3HOVK 4A3FK 4BBRC 2NVYK 4Q4ZA 1TWFK 5TMFA 3GTGK 4OIOA 4A3EK 3I4NK 3HOYC 4XSZA 4BY1C 2A68A 3I4MC 4A3MK 2NVTC 3HOXC 1TWCC 4KN4A 4C3JK 3HOUC 2Y0SL 2O5IA 1TWHK 3GTPK 3RZDK 4A3KK 3GTKK 3HOWC 3S2HC 2PMZL 3K7AC 2WAQL 2NVQK 1I3QK 3GTQC 1K83K 1I6VA 1SMYA 4OINA 4A3JK 5IP7K 2B63C 1R9TC 1WCMK 3S16C 1TWAK 2R93C 2YU9K 3FKIK 5FLMC 3RZOC 3S15C 2JA8K 1I6HC 3S1RC 2E2IK 1HQMA 3HOYK 4BBSC 1SFOC 4BY7K 2NVTK 5IYDC 4JK1A 4A93C 1Y1WK 5C44K 2WB1L 3GTLK 3HOWK 4A3CK 4QJVA 1IW7A 3M3YK 4OIPA 4G7OA 4Q5SA 3H3VL 4QIWL 3HOZK 3GTOK 3PO3C 2VUMK 3HKZD 4KN7A 2R7ZK 1Y1VC 4Y7NC 3S1MC
chains in the Genus database with same CATH superfamily
4NOIA 4OIQA 4YFXA 3S14K 3MMLB 1WSRA 3A8IA 4YG2A 2NVXA 1WQHA 4DDQA 4BY7C 4LK0A 4OIRA 4P5AA 3S1NC 4XSXA 4PAAA 4FZBA 4A3GC 2JA5A 2YU9C 3S15K 1DCHA 3GTLC 2E2HK 5IORA 1Y1WC 4Y52K 3GEIA 2R7ZC 2VUMC 3S1QK 4MQ9A 3L4JA 4A3LK 3FHZA 2R92C 4GTLA 3CQZC 3AQPA 4XLNA 4MEYA 1SFOA 2ZUEA 5IYBK 4AYBD 3AH5A 4YFKA 4A3FC 4A3IC 3GTQA 5FJ8K 3H0GK 3HOXK 1DCPA 3GTKC 3HOUK 4A3BK 3GTOA 2JA6K 2CW0A 4ILDA 1TWFC 3TFIA 2JA8C 2FQOA 1WCMC 2GSNA 5IYDK 2WAQD 4C3IC 1PJ6A 3PO2C 3BP3A 3H0GC 2JA6C 1O24A 1ZQ1C 5TMFA 1K83A 4KARA 3GTGK 3I4NK 3I4MC 4P9SA 4X6AC 1IS1A 4PABA 4KASA 1B4BA 4C3HC 1SMYA 1WQFA 5L46A 5IP7K 2B63C 4KM8A 1O2AA 4C45A 3QX3A 3S16C 1TWCA 2XCQA 3FKIK 1WOSA 2E2IK 4BBSC 3OREA 4BY7K 2XCOA 3GTLK 2WB1L 4KC6A 4WJ3M 4RMFA 4QIWL 1EI6A 2CFAB 4QIWD 1JQWA 4LOWA 5IOSA 3S0XA 4BBRK 2R92K 3GTMK 1O28A 3CQZK 3S16K 4KATA 3S2DK 1BDFA 4GTDA 4C3JC 1XZPB 4GTFA 4G0UA 3H3VD 3T01A 1V5VA 1YX2A 3GTPC 2PMZD 1K83C 4M1XA 1TWAC 2V6TA 1XXAA 5IYBC 4KMAA 3GTMC 2A6HA 2A69A 1G51A 1RU0A 5M5YK 4A3CC 1VJEA 2JA5K 1VH2A 3S2DC 3HOZC 1ZYRA 4P5BA 2PA8L 2P8TA 4Y7NK 1J98A 1WOOA 5IP9K 1JVIA 4BXXK 2NVYC 3L4KA 3HKZL 3S17K 1HI9A 3V4GA 3ADAC 1R9TA 4LR2A 1IBAA 1VRQC 4A3KC 3S2HK 2JA7K 4C3IK 3N3YA 4A3DC 3I4NC 1B4AA 1XZPA 1ZBSA 3JSTA 4AYBL 4G0WA 4KB2A 5C3EC 4G7ZA 2JH3A 1IE0A 3H0GA 3AQOA 1TWCK 2A6EA 1F93A 3M4OK 3LAJA 4GZYA 4AH6A 4GFQA 4A3DK 1O25A 1TWHA 4WILA 2ZUFA 4O2DA 5JFEA 3HOVK 3TFJA 5E68A 4XSZA 3AD8C 3BP8C 4A3MK 1ZVUA 1TWCC 4C3JK 2Y0SL 2O5IA 2E2HA 2NVYA 3A8JA 3K7AC 2WAQL 3GTQC 4A3JK 2EBBA 1TWAK 2Y3PA 2YU9K 3GEEA 3S15C 2JA8K 3HXAA 1HQMA 3HOYK 4GT9A 5IOTA 1SFOC 1BJTA 4A93C 1Y1WK 2W7VA 3AD7C 4A3CK 1WCMA 4G7OA 4Q5SA 2VUMK 2R7ZK 4KN7A 3N0CA 1XXCA 4Y7NC 3S1MC 2V6SA 1AB4A 4KM9A 3DXJA 3AD9C 5IP9C 3GTKA 4QJVB 4A3JC 5D4DA 3S1RK 2PHCB 5EGEA 3GTJC 3TFHA 1GE9A 4C2MC 1TWHC 4GTEA 4KB4A 1O26A 2R93K 3IPJA 2PPBA 3S17C 1Y1VK 5IP7C 2B63K 3LPXA 2NVXC 5TJ3A 4BXXC 3EQLA 4BKWA 5C44C 3S1MK 3T02A 3OPFA 3N0BA 1O2BA 2KWAA 1I50K 4ZH4A 2RGRA 1XPPA 5IOQA 4KAWX 3GTJK 5C4JK 3PO2K 4C2MK 1EK8A 5C3EK 3GTMA 4KMHA 4XLPA 2NVXK 2E2JK 4WJ4A 2WB1D 1VLOA 3GTGC 1O27A 3I4MK 4A3GK 1L0WA 2FQTA 3TTGA 4MEXA 3HOVC 4LLGA 2RH6A 5FLMK 4Y52C 1I6HK 5HL8A 5JVOA 2PA8D 5M5XK 1Y1WA 5C4XK 4BBSK 3A8KA 3K7AK 2Y0SD 3GTLA 1EH1A 3T00A 4A93K 3GTOC 3GTPA 3LAPA 5TMCA 2B63A 3GSIA 4BBRC 2NVYK 4A3FK 4Q4ZA 1F9NA 4OIOA 4A3EK 1J6WA 3HOYC 1F7VA 4LQYA 3GTPK 3RZDK 4A3KK 3S2HC 1VGXA 2NVQK 1I3QK 1XXBA 1WIHA 4OINA 1INNA 1XZQA 2JA6A 4BLBA 2R93C 1WORA 2VUMA 2R7ZA 4GTBA 3S1RC 1X31C 1WQGA 4GTCA 3CQZA 5IYDC 1USOA 2GSOA 2R92A 5C44K 4J3NA 3FOFA 4QJVA 1IW7A 1IQ0A 3M3YK 3H3VL 3HOZK 1BGWA 1KQ4A 3HKZD 1Y1VC 3GIRA 1TWAA 2D6FC 3SZZA 5C4JC 1O29A 5M5WK 5M3FK 4KMDA 4A3MC 2BE5A 1JOEA 3RZOK 4C3HK 4A3IK 2E2JC 1R9TK 2V6UA 3BUEA 1F7UA 1WOPA 3PO3K 3Q3QA 1YNJA 2JA7C 1YCLA 1I50A 2E2IC 1IL2A 4FM9A 4YFNA 4G7HA 1EFWA 1SFOK 1DD5A 3S14C 1I3QA 3GDZA 4G0VA 4LK1A 3M4OC 1TWGC 1YNNA 3S1NK 1O2FB 4BLAA 1C0AA 4X6AK 5C4XC 4LJZA 2CFAA 2E2HC 2GSUA 3CAGA 5IYCK 4A3EC 1DCOA 4KMUA 3GTQK 2GAGC 5CHPA 3FKIC 2P5MA 3VA7A 4BY1K 3ERED 2GAHC 2YU9A 2JA5C 3S1QC 4A3LC 1I3QC 5M3MK 1I50C 2E2IA 3G4CA 1TWFA 3RZDC 1TWGK 2NVQC 1WSVA 3WODA 5IYCC 2R93A 3M3YC 2O5JA 2ZFZA 1USMA 1BS2A 3NUHA 1EQRA 1TWFK 4GTAA 5EGHA 1ISEA 5CJ9A 4BY1C 2A68A 1TWGA 2NVTC 3HOXC 4XCHA 4KN4A 4KDDA 3HOUC 3GTKK 1TWHK 1J6VA 3GTJA 1PJ5A 3HOWC 4A3BC 2PMZL 3G4AA 1K83K 3GTGA 1I6VA 1ZXOA 3SZYA 1R9TC 1WCMK 1Y1VA 5FLMC 3RZOC 1I6HC 3GEHA 1UV7A 2NVTK 4JK1A 1XZQB 3HOWK 1PJ7A 4OIPA 2XCRB 1J6XA 3GTOK 2JA7A 3PO3C 3FKIA 3FOEA 3OEPA
chains in the Genus database with same CATH topology
4QIWD 4NOIA 3DXJA 5C4JC 4OIQA 4BBRK 2R92K 3GTMK 3CQZK 5IP9C 4YFXA 3S14K 3S16K 1BDFA 5M5WK 3S2DK 4QJVB 4A3JC 5D4DA 4X6AC 4YG2A 3S1RK 5M3FK 3H3VD 4A3MC 2BE5A 3GTJC 4BY7C 3RZOK 4LK0A 4C3HK 4A3IK 1TWHC 3GTPC 4OIRA 2PMZD 2E2JC 3S1NC 4XSXA 1R9TK 1K83C 1TWAC 2R93K 3PO3K 3S17C 2PPBA 1YNJA 1Y1VK 5IP7C 2B63K 5IYBC 2JA7C 2E2IC 4A3GC 2NVXC 4BXXC 3EQLA 2YU9C 3GTMC 2A6HA 2A69A 3S15K 5C44C 3GTLC 3S1MK 4YFNA 5M5YK 4A3CC 4G7HA 2JA5K 1SFOK 3S2DC 2E2HK 3S14C 3HOZC 1ZYRA 1I50K 1Y1WC 4Y52K 2PA8L 2R7ZC 2VUMC 4ZH4A 3S1QK 4Y7NK 4MQ9A 1XPPA 4A3BC 4A3LK 3GTJK 5C4JK 2R92C 3PO2K 3CQZC 5IP9K 4C2MK 4XLNA 5C3EK 4MEYA 4LK1A 5IYBK 3M4OC 4BXXK 2NVYC 3HKZL 4AYBD 4XLPA 3S17K 1TWGC 1YNNA 2E2JK 2NVXK 3S1NK 4YFKA 4A3FC 2WB1D 4A3IC 4X6AK 5C4XC 5FJ8K 3GTGC 4LJZA 4A3KC 3S2HK 3I4MK 2JA7K 4A3GK 3H0GK 4C3IK 2E2HC 3HOXK 4A3DC 3GTKC 3HOUK 4MEXA 4A3BK 5IYCK 4A3EC 3I4NC 2JA6K 2CW0A 4KMUA 3HOVC 3GTQK 4AYBL 4LLGA 1TWFC 3FKIC 5FLMK 5C3EC 4Y52C 4G7ZA 2JA8C 1I6HK 4BY1K 1WCMC 3S1QC 2JA5C 4A3LC 1I3QC 1TWCK 2A6EA 1I50C 2PA8D 5M3MK 5M5XK 5IYDK 5C4XK 3RZDC 1TWGK 2WAQD 4BBSK 3K7AK 2NVQC 3M4OK 2Y0SD 4GZYA 3PO2C 4A93K 3GTOC 4A3DK 3WODA 5IYCC 5TMCA 3M3YC 3H0GC 2O5JA 2JA6C 3HOVK 4A3FK 4BBRC 2NVYK 4Q4ZA 1TWFK 5TMFA 3GTGK 4OIOA 4A3EK 3I4NK 3HOYC 4XSZA 4BY1C 2A68A 3I4MC 4A3MK 2NVTC 3HOXC 1TWCC 4KN4A 4C3JK 3HOUC 2Y0SL 2O5IA 1TWHK 3GTPK 3RZDK 4A3KK 3GTKK 3HOWC 3S2HC 2PMZL 3K7AC 2WAQL 2NVQK 1I3QK 3GTQC 1K83K 1I6VA 1SMYA 4OINA 4A3JK 5IP7K 2B63C 1R9TC 1WCMK 3S16C 1TWAK 2R93C 2YU9K 3FKIK 5FLMC 3RZOC 3S15C 2JA8K 1I6HC 3S1RC 2E2IK 1HQMA 3HOYK 4BBSC 1SFOC 4BY7K 2NVTK 5IYDC 4JK1A 4A93C 1Y1WK 5C44K 2WB1L 3GTLK 3HOWK 4A3CK 4QJVA 1IW7A 3M3YK 4OIPA 4G7OA 4Q5SA 3H3VL 4QIWL 3HOZK 3GTOK 3PO3C 2VUMK 3HKZD 4KN7A 2R7ZK 1Y1VC 4Y7NC 3S1MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW D;  4NOI A;  3DXJ A;  5C4J C;  4OIQ A;  4BBR K;  2R92 K;  3GTM K;  3CQZ K;  5IP9 C;  4YFX A;  3S14 K;  3S16 K;  1BDF A;  5M5W K;  3S2D K;  4QJV B;  4A3J C;  5D4D A;  4X6A C;  4YG2 A;  3S1R K;  5M3F K;  3H3V D;  4A3M C;  2BE5 A;  3GTJ C;  4BY7 C;  3RZO K;  4LK0 A;  4C3H K;  4A3I K;  1TWH C;  3GTP C;  4OIR A;  2PMZ D;  2E2J C;  3S1N C;  4XSX A;  1R9T K;  1K83 C;  1TWA C;  2R93 K;  3PO3 K;  3S17 C;  2PPB A;  1YNJ A;  1Y1V K;  5IP7 C;  2B63 K;  5IYB C;  2JA7 C;  2E2I C;  4A3G C;  2NVX C;  4BXX C;  3EQL A;  2YU9 C;  3GTM C;  2A6H A;  2A69 A;  3S15 K;  5C44 C;  3GTL C;  3S1M K;  4YFN A;  5M5Y K;  4A3C C;  4G7H A;  2JA5 K;  1SFO K;  3S2D C;  2E2H K;  3S14 C;  3HOZ C;  1ZYR A;  1I50 K;  1Y1W C;  4Y52 K;  2PA8 L;  2R7Z C;  2VUM C;  4ZH4 A;  3S1Q K;  4Y7N K;  4MQ9 A;  1XPP A;  4A3B C;  4A3L K;  3GTJ K;  5C4J K;  2R92 C;  3PO2 K;  3CQZ C;  5IP9 K;  4C2M K;  4XLN A;  5C3E K;  4MEY A;  4LK1 A;  5IYB K;  3M4O C;  4BXX K;  2NVY C;  3HKZ L;  4AYB D;  4XLP A;  3S17 K;  1TWG C;  1YNN A;  2E2J K;  2NVX K;  3S1N K;  4YFK A;  4A3F C;  2WB1 D;  4A3I C;  4X6A K;  5C4X C;  5FJ8 K;  3GTG C;  4LJZ A;  4A3K C;  3S2H K;  3I4M K;  2JA7 K;  4A3G K;  3H0G K;  4C3I K;  2E2H C;  3HOX K;  4A3D C;  3GTK C;  3HOU K;  4MEX A;  4A3B K;  5IYC K;  4A3E C;  3I4N C;  2JA6 K;  2CW0 A;  4KMU A;  3HOV C;  3GTQ K;  4AYB L;  4LLG A;  1TWF C;  3FKI C;  5FLM K;  5C3E C;  4Y52 C;  4G7Z A;  2JA8 C;  1I6H K;  4BY1 K;  1WCM C;  3S1Q C;  2JA5 C;  4A3L C;  1I3Q C;  1TWC K;  2A6E A;  1I50 C;  2PA8 D;  5M3M K;  5M5X K;  5IYD K;  5C4X K;  3RZD C;  1TWG K;  2WAQ D;  4BBS K;  3K7A K;  2NVQ C;  3M4O K;  2Y0S D;  4GZY A;  3PO2 C;  4A93 K;  3GTO C;  4A3D K;  3WOD A;  5IYC C;  5TMC A;  3M3Y C;  3H0G C;  2O5J A;  2JA6 C;  3HOV K;  4A3F K;  4BBR C;  2NVY K;  4Q4Z A;  1TWF K;  5TMF A;  3GTG K;  4OIO A;  4A3E K;  3I4N K;  3HOY C;  4XSZ A;  4BY1 C;  2A68 A;  3I4M C;  4A3M K;  2NVT C;  3HOX C;  1TWC C;  4KN4 A;  4C3J K;  3HOU C;  2Y0S L;  2O5I A;  1TWH K;  3GTP K;  3RZD K;  4A3K K;  3GTK K;  3HOW C;  3S2H C;  2PMZ L;  3K7A C;  2WAQ L;  2NVQ K;  1I3Q K;  3GTQ C;  1K83 K;  1I6V A;  1SMY A;  4OIN A;  4A3J K;  5IP7 K;  2B63 C;  1R9T C;  1WCM K;  3S16 C;  1TWA K;  2R93 C;  2YU9 K;  3FKI K;  5FLM C;  3RZO C;  3S15 C;  2JA8 K;  1I6H C;  3S1R C;  2E2I K;  1HQM A;  3HOY K;  4BBS C;  1SFO C;  4BY7 K;  2NVT K;  5IYD C;  4JK1 A;  4A93 C;  1Y1W K;  5C44 K;  2WB1 L;  3GTL K;  3HOW K;  4A3C K;  4QJV A;  1IW7 A;  3M3Y K;  4OIP A;  4G7O A;  4Q5S A;  3H3V L;  4QIW L;  3HOZ K;  3GTO K;  3PO3 C;  2VUM K;  3HKZ D;  4KN7 A;  2R7Z K;  1Y1V C;  4Y7N C;  3S1M C; 
#chains in the Genus database with same CATH topology
 4NOI A;  4OIQ A;  4YFX A;  3S14 K;  3MML B;  1WSR A;  3A8I A;  4YG2 A;  2NVX A;  1WQH A;  4DDQ A;  4BY7 C;  4LK0 A;  4OIR A;  4P5A A;  3S1N C;  4XSX A;  4PAA A;  4FZB A;  4A3G C;  2JA5 A;  2YU9 C;  3S15 K;  1DCH A;  3GTL C;  2E2H K;  5IOR A;  1Y1W C;  4Y52 K;  3GEI A;  2R7Z C;  2VUM C;  3S1Q K;  4MQ9 A;  3L4J A;  4A3L K;  3FHZ A;  2R92 C;  4GTL A;  3CQZ C;  3AQP A;  4XLN A;  4MEY A;  1SFO A;  2ZUE A;  5IYB K;  4AYB D;  3AH5 A;  4YFK A;  4A3F C;  4A3I C;  3GTQ A;  5FJ8 K;  3H0G K;  3HOX K;  1DCP A;  3GTK C;  3HOU K;  4A3B K;  3GTO A;  2JA6 K;  2CW0 A;  4ILD A;  1TWF C;  3TFI A;  2JA8 C;  2FQO A;  1WCM C;  2GSN A;  5IYD K;  2WAQ D;  4C3I C;  1PJ6 A;  3PO2 C;  3BP3 A;  3H0G C;  2JA6 C;  1O24 A;  1ZQ1 C;  5TMF A;  1K83 A;  4KAR A;  3GTG K;  3I4N K;  3I4M C;  4P9S A;  4X6A C;  1IS1 A;  4PAB A;  4KAS A;  1B4B A;  4C3H C;  1SMY A;  1WQF A;  5L46 A;  5IP7 K;  2B63 C;  4KM8 A;  1O2A A;  4C45 A;  3QX3 A;  3S16 C;  1TWC A;  2XCQ A;  3FKI K;  1WOS A;  2E2I K;  4BBS C;  3ORE A;  4BY7 K;  2XCO A;  3GTL K;  2WB1 L;  4KC6 A;  4WJ3 M;  4RMF A;  4QIW L;  1EI6 A;  2CFA B;  4QIW D;  1JQW A;  4LOW A;  5IOS A;  3S0X A;  4BBR K;  2R92 K;  3GTM K;  1O28 A;  3CQZ K;  3S16 K;  4KAT A;  3S2D K;  1BDF A;  4GTD A;  4C3J C;  1XZP B;  4GTF A;  4G0U A;  3H3V D;  3T01 A;  1V5V A;  1YX2 A;  3GTP C;  2PMZ D;  1K83 C;  4M1X A;  1TWA C;  2V6T A;  1XXA A;  5IYB C;  4KMA A;  3GTM C;  2A6H A;  2A69 A;  1G51 A;  1RU0 A;  5M5Y K;  4A3C C;  1VJE A;  2JA5 K;  1VH2 A;  3S2D C;  3HOZ C;  1ZYR A;  4P5B A;  2PA8 L;  2P8T A;  4Y7N K;  1J98 A;  1WOO A;  5IP9 K;  1JVI A;  4BXX K;  2NVY C;  3L4K A;  3HKZ L;  3S17 K;  1HI9 A;  3V4G A;  3ADA C;  1R9T A;  4LR2 A;  1IBA A;  1VRQ C;  4A3K C;  3S2H K;  2JA7 K;  4C3I K;  3N3Y A;  4A3D C;  3I4N C;  1B4A A;  1XZP A;  1ZBS A;  3JST A;  4AYB L;  4G0W A;  4KB2 A;  5C3E C;  4G7Z A;  2JH3 A;  1IE0 A;  3H0G A;  3AQO A;  1TWC K;  2A6E A;  1F93 A;  3M4O K;  3LAJ A;  4GZY A;  4AH6 A;  4GFQ A;  4A3D K;  1O25 A;  1TWH A;  4WIL A;  2ZUF A;  4O2D A;  5JFE A;  3HOV K;  3TFJ A;  5E68 A;  4XSZ A;  3AD8 C;  3BP8 C;  4A3M K;  1ZVU A;  1TWC C;  4C3J K;  2Y0S L;  2O5I A;  2E2H A;  2NVY A;  3A8J A;  3K7A C;  2WAQ L;  3GTQ C;  4A3J K;  2EBB A;  1TWA K;  2Y3P A;  2YU9 K;  3GEE A;  3S15 C;  2JA8 K;  3HXA A;  1HQM A;  3HOY K;  4GT9 A;  5IOT A;  1SFO C;  1BJT A;  4A93 C;  1Y1W K;  2W7V A;  3AD7 C;  4A3C K;  1WCM A;  4G7O A;  4Q5S A;  2VUM K;  2R7Z K;  4KN7 A;  3N0C A;  1XXC A;  4Y7N C;  3S1M C;  2V6S A;  1AB4 A;  4KM9 A;  3DXJ A;  3AD9 C;  5IP9 C;  3GTK A;  4QJV B;  4A3J C;  5D4D A;  3S1R K;  2PHC B;  5EGE A;  3GTJ C;  3TFH A;  1GE9 A;  4C2M C;  1TWH C;  4GTE A;  4KB4 A;  1O26 A;  2R93 K;  3IPJ A;  2PPB A;  3S17 C;  1Y1V K;  5IP7 C;  2B63 K;  3LPX A;  2NVX C;  5TJ3 A;  4BXX C;  3EQL A;  4BKW A;  5C44 C;  3S1M K;  3T02 A;  3OPF A;  3N0B A;  1O2B A;  2KWA A;  1I50 K;  4ZH4 A;  2RGR A;  1XPP A;  5IOQ A;  4KAW X;  3GTJ K;  5C4J K;  3PO2 K;  4C2M K;  1EK8 A;  5C3E K;  3GTM A;  4KMH A;  4XLP A;  2NVX K;  2E2J K;  4WJ4 A;  2WB1 D;  1VLO A;  3GTG C;  1O27 A;  3I4M K;  4A3G K;  1L0W A;  2FQT A;  3TTG A;  4MEX A;  3HOV C;  4LLG A;  2RH6 A;  5FLM K;  4Y52 C;  1I6H K;  5HL8 A;  5JVO A;  2PA8 D;  5M5X K;  1Y1W A;  5C4X K;  4BBS K;  3A8K A;  3K7A K;  2Y0S D;  3GTL A;  1EH1 A;  3T00 A;  4A93 K;  3GTO C;  3GTP A;  3LAP A;  5TMC A;  2B63 A;  3GSI A;  4BBR C;  2NVY K;  4A3F K;  4Q4Z A;  1F9N A;  4OIO A;  4A3E K;  1J6W A;  3HOY C;  1F7V A;  4LQY A;  3GTP K;  3RZD K;  4A3K K;  3S2H C;  1VGX A;  2NVQ K;  1I3Q K;  1XXB A;  1WIH A;  4OIN A;  1INN A;  1XZQ A;  2JA6 A;  4BLB A;  2R93 C;  1WOR A;  2VUM A;  2R7Z A;  4GTB A;  3S1R C;  1X31 C;  1WQG A;  4GTC A;  3CQZ A;  5IYD C;  1USO A;  2GSO A;  2R92 A;  5C44 K;  4J3N A;  3FOF A;  4QJV A;  1IW7 A;  1IQ0 A;  3M3Y K;  3H3V L;  3HOZ K;  1BGW A;  1KQ4 A;  3HKZ D;  1Y1V C;  3GIR A;  1TWA A;  2D6F C;  3SZZ A;  5C4J C;  1O29 A;  5M5W K;  5M3F K;  4KMD A;  4A3M C;  2BE5 A;  1JOE A;  3RZO K;  4C3H K;  4A3I K;  2E2J C;  1R9T K;  2V6U A;  3BUE A;  1F7U A;  1WOP A;  3PO3 K;  3Q3Q A;  1YNJ A;  2JA7 C;  1YCL A;  1I50 A;  2E2I C;  1IL2 A;  4FM9 A;  4YFN A;  4G7H A;  1EFW A;  1SFO K;  1DD5 A;  3S14 C;  1I3Q A;  3GDZ A;  4G0V A;  4LK1 A;  3M4O C;  1TWG C;  1YNN A;  3S1N K;  1O2F B;  4BLA A;  1C0A A;  4X6A K;  5C4X C;  4LJZ A;  2CFA A;  2E2H C;  2GSU A;  3CAG A;  5IYC K;  4A3E C;  1DCO A;  4KMU A;  3GTQ K;  2GAG C;  5CHP A;  3FKI C;  2P5M A;  3VA7 A;  4BY1 K;  3ERE D;  2GAH C;  2YU9 A;  2JA5 C;  3S1Q C;  4A3L C;  1I3Q C;  5M3M K;  1I50 C;  2E2I A;  3G4C A;  1TWF A;  3RZD C;  1TWG K;  2NVQ C;  1WSV A;  3WOD A;  5IYC C;  2R93 A;  3M3Y C;  2O5J A;  2ZFZ A;  1USM A;  1BS2 A;  3NUH A;  1EQR A;  1TWF K;  4GTA A;  5EGH A;  1ISE A;  5CJ9 A;  4BY1 C;  2A68 A;  1TWG A;  2NVT C;  3HOX C;  4XCH A;  4KN4 A;  4KDD A;  3HOU C;  3GTK K;  1TWH K;  1J6V A;  3GTJ A;  1PJ5 A;  3HOW C;  4A3B C;  2PMZ L;  3G4A A;  1K83 K;  3GTG A;  1I6V A;  1ZXO A;  3SZY A;  1R9T C;  1WCM K;  1Y1V A;  5FLM C;  3RZO C;  1I6H C;  3GEH A;  1UV7 A;  2NVT K;  4JK1 A;  1XZQ B;  3HOW K;  1PJ7 A;  4OIP A;  2XCR B;  1J6X A;  3GTO K;  2JA7 A;  3PO3 C;  3FKI A;  3FOE A;  3OEP A; 
#chains in the Genus database with same CATH homology
 4QIW D;  4NOI A;  3DXJ A;  5C4J C;  4OIQ A;  4BBR K;  2R92 K;  3GTM K;  3CQZ K;  5IP9 C;  4YFX A;  3S14 K;  3S16 K;  1BDF A;  5M5W K;  3S2D K;  4QJV B;  4A3J C;  5D4D A;  4X6A C;  4YG2 A;  3S1R K;  5M3F K;  3H3V D;  4A3M C;  2BE5 A;  3GTJ C;  4BY7 C;  3RZO K;  4LK0 A;  4C3H K;  4A3I K;  1TWH C;  3GTP C;  4OIR A;  2PMZ D;  2E2J C;  3S1N C;  4XSX A;  1R9T K;  1K83 C;  1TWA C;  2R93 K;  3PO3 K;  3S17 C;  2PPB A;  1YNJ A;  1Y1V K;  5IP7 C;  2B63 K;  5IYB C;  2JA7 C;  2E2I C;  4A3G C;  2NVX C;  4BXX C;  3EQL A;  2YU9 C;  3GTM C;  2A6H A;  2A69 A;  3S15 K;  5C44 C;  3GTL C;  3S1M K;  4YFN A;  5M5Y K;  4A3C C;  4G7H A;  2JA5 K;  1SFO K;  3S2D C;  2E2H K;  3S14 C;  3HOZ C;  1ZYR A;  1I50 K;  1Y1W C;  4Y52 K;  2PA8 L;  2R7Z C;  2VUM C;  4ZH4 A;  3S1Q K;  4Y7N K;  4MQ9 A;  1XPP A;  4A3B C;  4A3L K;  3GTJ K;  5C4J K;  2R92 C;  3PO2 K;  3CQZ C;  5IP9 K;  4C2M K;  4XLN A;  5C3E K;  4MEY A;  4LK1 A;  5IYB K;  3M4O C;  4BXX K;  2NVY C;  3HKZ L;  4AYB D;  4XLP A;  3S17 K;  1TWG C;  1YNN A;  2E2J K;  2NVX K;  3S1N K;  4YFK A;  4A3F C;  2WB1 D;  4A3I C;  4X6A K;  5C4X C;  5FJ8 K;  3GTG C;  4LJZ A;  4A3K C;  3S2H K;  3I4M K;  2JA7 K;  4A3G K;  3H0G K;  4C3I K;  2E2H C;  3HOX K;  4A3D C;  3GTK C;  3HOU K;  4MEX A;  4A3B K;  5IYC K;  4A3E C;  3I4N C;  2JA6 K;  2CW0 A;  4KMU A;  3HOV C;  3GTQ K;  4AYB L;  4LLG A;  1TWF C;  3FKI C;  5FLM K;  5C3E C;  4Y52 C;  4G7Z A;  2JA8 C;  1I6H K;  4BY1 K;  1WCM C;  3S1Q C;  2JA5 C;  4A3L C;  1I3Q C;  1TWC K;  2A6E A;  1I50 C;  2PA8 D;  5M3M K;  5M5X K;  5IYD K;  5C4X K;  3RZD C;  1TWG K;  2WAQ D;  4BBS K;  3K7A K;  2NVQ C;  3M4O K;  2Y0S D;  4GZY A;  3PO2 C;  4A93 K;  3GTO C;  4A3D K;  3WOD A;  5IYC C;  5TMC A;  3M3Y C;  3H0G C;  2O5J A;  2JA6 C;  3HOV K;  4A3F K;  4BBR C;  2NVY K;  4Q4Z A;  1TWF K;  5TMF A;  3GTG K;  4OIO A;  4A3E K;  3I4N K;  3HOY C;  4XSZ A;  4BY1 C;  2A68 A;  3I4M C;  4A3M K;  2NVT C;  3HOX C;  1TWC C;  4KN4 A;  4C3J K;  3HOU C;  2Y0S L;  2O5I A;  1TWH K;  3GTP K;  3RZD K;  4A3K K;  3GTK K;  3HOW C;  3S2H C;  2PMZ L;  3K7A C;  2WAQ L;  2NVQ K;  1I3Q K;  3GTQ C;  1K83 K;  1I6V A;  1SMY A;  4OIN A;  4A3J K;  5IP7 K;  2B63 C;  1R9T C;  1WCM K;  3S16 C;  1TWA K;  2R93 C;  2YU9 K;  3FKI K;  5FLM C;  3RZO C;  3S15 C;  2JA8 K;  1I6H C;  3S1R C;  2E2I K;  1HQM A;  3HOY K;  4BBS C;  1SFO C;  4BY7 K;  2NVT K;  5IYD C;  4JK1 A;  4A93 C;  1Y1W K;  5C44 K;  2WB1 L;  3GTL K;  3HOW K;  4A3C K;  4QJV A;  1IW7 A;  3M3Y K;  4OIP A;  4G7O A;  4Q5S A;  3H3V L;  4QIW L;  3HOZ K;  3GTO K;  3PO3 C;  2VUM K;  3HKZ D;  4KN7 A;  2R7Z K;  1Y1V C;  4Y7N C;  3S1M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...