3PO3K

Arrested rna polymerase ii reactivation intermediate
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3po3K00
2R92C 2R92K 1TWCC 1Y1VC 5FJ8K 1TWCK 1Y1VK 1TWFK 4Y52C 5IYBC 4A3KC 2YU9C 3HOWC 3HOZC 3M3YC 2YU9K 5IYBK 3HOZK 3M3YK 3HOWK 4Y52K 5C4JC 3GTMK 1YNNA 4XLNA 4Y7NC 4C3JK 5IYCC 2B63C 4Y7NK 2B63K 2R93C 5IYDC 2WB1L 4C2MK 5M3FK 3FKIK 2R93K 5IYDK 3I4MC 2O5IA 3GTQC 3I4MK 3S2DC 4G7OA 3S1RC 3S2HK 3GTQK 4G7HA 3S15C 4MEYA 3S1RK 4OINA 3S2DK 3HKZL 3HOXC 3S15K 2NVXC 1TWAC 3H3VD 3HOXK 3S1QC 1TWAK 5TMCA 4GZYA 2JA6C 3S17C 3EQLA 2JA6K 3S17K 2A6HA 4X6AC 1YNJA 4KN7A 5IP7C 2NVTC 4X6AK 2A69A 5IP7K 2NVTK 4NOIA 2JA8C 4A3LC 5M5YK 4A3IC 2JA8K 4YFNA 5M5XK 3GTJC 3CQZC 4A3LK 4A3IK 4A3KK 3HOYC 3GTJK 3CQZK 2O5JA 3HOYK 3GTKC 4QIWD 2Y0SD 4C3IK 3GTKK 5C4JK 4A3FC 2PA8D 3GTLC 2E2HC 4KMUA 2CW0A 3GTLK 5IYCK 1SMYA 4AYBD 2A68A 2E2HK 4A3MC 4BXXK 4A3MK 3PO2C 4BY7C 2NVQC 5C4XC 4BY7K 4KN4A 2R7ZC 5C4XK 2R7ZK 4JK1A 4A3CC 4YG2A 3GTPC 4A3CK 4OIRA 4C3HK 4OIOA 5M5WK 4OIPA 2NVXK 3GTPK 2WAQD 3S1QK 1I3QC 5TMFA 1Y1WC 1WCMC 4G7ZA 5M3MK 3M4OC 1HQMA 3WODA 1TWHC 5IP9C 2PMZD 3S16C 3M4OK 3GTGC 1TWHK 5IP9K 3S16K 3H0GC 3GTGK 2BE5A 4QIWL 2Y0SL 1I6HC 4Q4ZA 4ZH4A 2PA8L 1I6HK 4LK0A 2WB1D 5D4DA 4YFXA 5FLMC 4AYBL 4A3FK 1BDFA 3PO3C 3RZOC 3RZOK 5FLMK 4A3BC 3PO3K 3S1MC 4A3GC 4A3BK 2PPBA 3S1MK 4A3GK 4OIQA 3HKZD 5C44C 3PO2K 4A3JC 2NVYC 4BBSC 2NVQK 5C44K 1I50C 4A3JK 3I4NC 4MQ9A 4BBSK 3DXJA 1I50K 3I4NK 3H3VL 2VUMC 5C3EC 2VUMK 2WAQL 1TWGC 5C3EK 1SFOC 1TWGK 1TWFC 4MEXA 2JA5C 1SFOK 3GTOC 1I3QK 2JA5K 1Y1WK 1WCMK 2A6EA 3GTOK 4Q5SA 2PMZL 3K7AC 3GTMC 4YFKA 3K7AK 1IW7A 4A93C 4A93K 4LK1A 3H0GK 4A3EC 3FKIC 4A3EK 4XSZA 4BY1C 4QJVB 1ZYRA 4A3DC 4XLPA 4BY1K 2E2JC 4A3DK 2E2IC 3RZDC 1R9TC 4LLGA 3S2HC 4LJZA 2E2JK 2E2IK 3RZDK 4XSXA 1R9TK 3S14C 3S1NK 3S1NC 3S14K 1I6VA 3HOUC 2JA7C 4BBRC 3HOUK 1XPPA 2NVYK 4BBRK 1K83C 4QJVA 2JA7K 3HOVC 3HOVK 4BXXC 1K83K
chains in the Genus database with same CATH superfamily
4KM8A 1G51A 4G0UA 3L4JA 3T02A 1O2AA 1TWGA 4Y52C 3S0XA 3HOZC 3M3YC 3HOWC 2JA5A 1KQ4A 1WORA 5IYBK 1YNNA 2B63C 5IYCC 4P5BA 4PAAA 4C2MK 3GTQC 4G7OA 3BUEA 3S1RC 4OINA 1VLOA 4C3HC 3S15K 3HOXK 3S1QC 1C0AA 3NUHA 5TMCA 4GZYA 4WILA 4FZBA 5CHPA 4X6AK 5IOQA 4WJ4A 2A69A 2V6UA 4A3LC 1USMA 4YFNA 1EQRA 1TWFA 3GTJK 2O5JA 3GTKC 4KARA 4LR2A 4A3FC 1ZBSA 4KASA 3GTMA 3LPXA 2E2HC 3GTLK 5IYCK 4AYBD 4A3MC 1PJ7A 1IBAA 2R93A 2R7ZC 5JVOA 3GTPC 4C3HK 5M5WK 1DCPA 2WAQD 3S1QK 4GTBA 1TWAA 2JA6A 5EGHA 1TWHC 2ZUFA 1JQWA 5IP9K 3S16K 2Y3PA 1WOPA 1XXAA 3ADAC 4A3FK 5L46A 2GAHC 2JH3A 3PO3K 3FOEA 4A3BK 3HKZD 4BBSC 5C44K 4A3JK 1INNA 5CJ9A 2VUMC 3L4KA 3G4CA 5C3EK 1WOOA 1SFOC 1TWGK 1TWFC 4G0VA 2JA5K 3OPFA 2A6EA 2GSOA 2PMZL 3AQOA 3GTMC 1F7VA 2ZFZA 4G0WA 1F7UA 4BKWA 4BY1C 1EI6A 1XZPB 2E2JC 4A3DK 2E2IC 3GEEA 4LJZA 3GEHA 1USOA 2JA7C 1XZQB 2W7VA 4J3NA 3HOUK 3HOVC 4C3JC 4GTCA 1I50A 4KAWX 4LOWA 1TWFK 5IYBC 1WCMA 3GTOA 4GTFA 3GTMK 4C2MC 2R93K 5IYDK 3FKIA 2O5IA 1IL2A 3I4MK 3S15C 3HKZL 3HOXC 1JOEA 4KDDA 1UV7A 3IPJA 1TWAK 1IQ0A 5IOTA 2JA6K 3S17K 1DCOA 4X6AC 1K83A 4KN7A 2R92A 5IP7K 3A8IA 1TWCA 1J98A 1Y1VA 1XZQA 3GTJC 2JA8K 3TFHA 1ZXOA 1EFWA 1ZVUA 2YU9A 3GTLC 2P5MA 4KMUA 4GTLA 2A68A 3SZYA 1WQHA 4BY7K 5C4XK 4JK1A 3T01A 4KATA 1VH2A 5TMFA 1WCMC 4G7ZA 4PABA 3JSTA 5IP9C 2PMZD 3S16C 1EH1A 3A8JA 3Q3QA 1AB4A 3CQZA 2GAGC 1I6HK 2WB1D 2GSNA 5D4DA 2D6FC 3PO3C 2XCRB 5FLMK 4A3BC 3TTGA 5C44C 4A3JC 1I50K 3BP3A 3I4NK 5C3EC 1TWGC 2NVXA 4GTEA 1B4AA 4MEXA 2JA5C 1WOSA 5EGEA 1WCMK 3GTOK 3K7AK 4LK1A 3GTGA 1ISEA 1J6XA 3N3YA 1J6VA 4A3DC 4O2DA 1DCHA 4LLGA 1IS1A 3HOUC 4GFQA 4BXXK 1K83K 4P9SA 2R92K 1L0WA 1TWCK 4DDQA 1Y1VK 2EBBA 4A3KC 1WQGA 1I3QA 2YU9K 1Y1WA 3HXAA 5C4JC 3G4AA 4ILDA 4XLNA 1RU0A 4Y7NK 3H0GA 3A8KA 2R93C 5IYDC 2WB1L 1PJ6A 5M3FK 1BGWA 3LAPA 3I4MC 4G7HA 3S2DK 4MEYA 1R9TA 1WQFA 2NVXC 1TWAC 1V5VA 2V6SA 3AD9C 1B4BA 5HL8A 2JA6C 3S17C 2RH6A 1YNJA 5IP7C 2NVTK 3AD7C 1JVIA 1O25A 4NOIA 3MMLB 2JA8C 5M5YK 1XXBA 5M5XK 1O2FB 4A3IK 4A3KK 3CQZK 3HOYK 4C3IK 5TJ3A 1XZPA 5C4JK 1O29A 1VGXA 2B63A 3V4GA 2GSUA 4BY7C 2NVQC 5C4XC 1F93A 3ERED 2PHCB 4YG2A 3GTQA 4A3CK 4OIRA 2NVXK 1I3QC 1Y1WC 1J6WA 4GTAA 1HQMA 3M4OK 3H0GC 4KMDA 3GTGK 4QIWL 2Y0SL 1I6HC 4ZH4A 2PA8L 4LK0A 3GTKA 5FLMC 3RZOK 4KC6A 2E2HA 3S1MK 4A3GK 4OIQA 2NVQK 1I50C 4M1XA 3I4NC 4MQ9A 3OEPA 2R7ZA 2FQTA 2XCOA 4GT9A 3LAJA 3GTPA 3GTOC 5E68A 1I3QK 1Y1WK 4Q5SA 4RMFA 3K7AC 4BLBA 4A93K 1TWHA 3H0GK 3TFIA 1VJEA 3FKIC 1O24A 4A3EK 4XSZA 1ZYRA 3AH5A 4FM9A 3S2HC 1XXCA 3RZDK 4XSXA 1R9TK 3S1NK 2P8TA 3S14K 1I6VA 1DD5A 1XPPA 4BBRK 4BLAA 1K83C 4QJVA 4BXXC 2CFAA 4KB2A 2R92C 3N0BA 1PJ5A 3AD8C 1TWCC 1Y1VC 5FJ8K 2VUMA 2YU9C 1SFOA 4Y52K 3HOZK 3M3YK 3HOWK 4Y7NC 3QX3A 2B63K 5JFEA 3FKIK 1O26A 3S2DC 2V6TA 3GTQK 3S2HK 3S1RK 3VA7A 2E2IA 1GE9A 3H3VD 3GEIA 4XCHA 4C45A 3EQLA 2JA7A 2NVYA 2A6HA 2NVTC 1WIHA 1ZQ1C 5IORA 3N0CA 4A3IC 3FOFA 4A3LK 3CQZC 3HOYC 4C3IC 4QIWD 2Y0SD 3GTKK 1X31C 2PA8D 1BS2A 3BP8C 1IE0A 2CW0A 2E2HK 1SMYA 4A3MK 1YCLA 3PO2C 3OREA 4KN4A 4WJ3M 2R7ZK 4KB4A 4A3CC 4GTDA 2XCQA 3GTPK 4OIOA 4OIPA 3GSIA 4KMHA 5M3MK 3M4OC 3WODA 3GIRA 4LQYA 3GTGC 1TWHK 3TFJA 2BE5A 3T00A 2ZUEA 1O2BA 3GTJA 4Q4ZA 1O27A 4YFXA 3RZOC 4AYBL 1BDFA 3GTLA 3S1MC 4A3GC 2PPBA 3CAGA 3PO2K 2NVYC 3GDZA 4BBSK 3DXJA 3FHZA 3H3VL 2RGRA 1WSRA 2VUMK 3AQPA 2WAQL 1F9NA 1SFOK 1BJTA 4KM9A 3SZZA 4YFKA 1IW7A 1HI9A 4A93C 5IOSA 4A3EC 1WSVA 4QJVB 1O28A 4XLPA 2CFAB 4BY1K 1EK8A 3RZDC 1R9TC 3S1NC 2E2JK 2E2IK 3S14C 2KWAA 2FQOA 1YX2A 4BBRC 1VRQC 2JA7K 2NVYK 4KMAA 4P5AA 4AH6A 3HOVK 4C3JK
chains in the Genus database with same CATH topology
2R92C 2R92K 1TWCC 1Y1VC 5FJ8K 1TWCK 1Y1VK 1TWFK 4Y52C 5IYBC 4A3KC 2YU9C 3HOWC 3HOZC 3M3YC 2YU9K 5IYBK 3HOZK 3M3YK 3HOWK 4Y52K 5C4JC 3GTMK 1YNNA 4XLNA 4Y7NC 4C3JK 5IYCC 2B63C 4Y7NK 2B63K 2R93C 5IYDC 2WB1L 4C2MK 5M3FK 3FKIK 2R93K 5IYDK 3I4MC 2O5IA 3GTQC 3I4MK 3S2DC 4G7OA 3S1RC 3S2HK 3GTQK 4G7HA 3S15C 4MEYA 3S1RK 4OINA 3S2DK 3HKZL 3HOXC 3S15K 2NVXC 1TWAC 3H3VD 3HOXK 3S1QC 1TWAK 5TMCA 4GZYA 2JA6C 3S17C 3EQLA 2JA6K 3S17K 2A6HA 4X6AC 1YNJA 4KN7A 5IP7C 2NVTC 4X6AK 2A69A 5IP7K 2NVTK 4NOIA 2JA8C 4A3LC 5M5YK 4A3IC 2JA8K 4YFNA 5M5XK 3GTJC 3CQZC 4A3LK 4A3IK 4A3KK 3HOYC 3GTJK 3CQZK 2O5JA 3HOYK 3GTKC 4QIWD 2Y0SD 4C3IK 3GTKK 5C4JK 4A3FC 2PA8D 3GTLC 2E2HC 4KMUA 2CW0A 3GTLK 5IYCK 1SMYA 4AYBD 2A68A 2E2HK 4A3MC 4BXXK 4A3MK 3PO2C 4BY7C 2NVQC 5C4XC 4BY7K 4KN4A 2R7ZC 5C4XK 2R7ZK 4JK1A 4A3CC 4YG2A 3GTPC 4A3CK 4OIRA 4C3HK 4OIOA 5M5WK 4OIPA 2NVXK 3GTPK 2WAQD 3S1QK 1I3QC 5TMFA 1Y1WC 1WCMC 4G7ZA 5M3MK 3M4OC 1HQMA 3WODA 1TWHC 5IP9C 2PMZD 3S16C 3M4OK 3GTGC 1TWHK 5IP9K 3S16K 3H0GC 3GTGK 2BE5A 4QIWL 2Y0SL 1I6HC 4Q4ZA 4ZH4A 2PA8L 1I6HK 4LK0A 2WB1D 5D4DA 4YFXA 5FLMC 4AYBL 4A3FK 1BDFA 3PO3C 3RZOC 3RZOK 5FLMK 4A3BC 3PO3K 3S1MC 4A3GC 4A3BK 2PPBA 3S1MK 4A3GK 4OIQA 3HKZD 5C44C 3PO2K 4A3JC 2NVYC 4BBSC 2NVQK 5C44K 1I50C 4A3JK 3I4NC 4MQ9A 4BBSK 3DXJA 1I50K 3I4NK 3H3VL 2VUMC 5C3EC 2VUMK 2WAQL 1TWGC 5C3EK 1SFOC 1TWGK 1TWFC 4MEXA 2JA5C 1SFOK 3GTOC 1I3QK 2JA5K 1Y1WK 1WCMK 2A6EA 3GTOK 4Q5SA 2PMZL 3K7AC 3GTMC 4YFKA 3K7AK 1IW7A 4A93C 4A93K 4LK1A 3H0GK 4A3EC 3FKIC 4A3EK 4XSZA 4BY1C 4QJVB 1ZYRA 4A3DC 4XLPA 4BY1K 2E2JC 4A3DK 2E2IC 3RZDC 1R9TC 4LLGA 3S2HC 4LJZA 2E2JK 2E2IK 3RZDK 4XSXA 1R9TK 3S14C 3S1NK 3S1NC 3S14K 1I6VA 3HOUC 2JA7C 4BBRC 3HOUK 1XPPA 2NVYK 4BBRK 1K83C 4QJVA 2JA7K 3HOVC 3HOVK 4BXXC 1K83K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 C;  2R92 K;  1TWC C;  1Y1V C;  5FJ8 K;  1TWC K;  1Y1V K;  1TWF K;  4Y52 C;  5IYB C;  4A3K C;  2YU9 C;  3HOW C;  3HOZ C;  3M3Y C;  2YU9 K;  5IYB K;  3HOZ K;  3M3Y K;  3HOW K;  4Y52 K;  5C4J C;  3GTM K;  1YNN A;  4XLN A;  4Y7N C;  4C3J K;  5IYC C;  2B63 C;  4Y7N K;  2B63 K;  2R93 C;  5IYD C;  2WB1 L;  4C2M K;  5M3F K;  3FKI K;  2R93 K;  5IYD K;  3I4M C;  2O5I A;  3GTQ C;  3I4M K;  3S2D C;  4G7O A;  3S1R C;  3S2H K;  3GTQ K;  4G7H A;  3S15 C;  4MEY A;  3S1R K;  4OIN A;  3S2D K;  3HKZ L;  3HOX C;  3S15 K;  2NVX C;  1TWA C;  3H3V D;  3HOX K;  3S1Q C;  1TWA K;  5TMC A;  4GZY A;  2JA6 C;  3S17 C;  3EQL A;  2JA6 K;  3S17 K;  2A6H A;  4X6A C;  1YNJ A;  4KN7 A;  5IP7 C;  2NVT C;  4X6A K;  2A69 A;  5IP7 K;  2NVT K;  4NOI A;  2JA8 C;  4A3L C;  5M5Y K;  4A3I C;  2JA8 K;  4YFN A;  5M5X K;  3GTJ C;  3CQZ C;  4A3L K;  4A3I K;  4A3K K;  3HOY C;  3GTJ K;  3CQZ K;  2O5J A;  3HOY K;  3GTK C;  4QIW D;  2Y0S D;  4C3I K;  3GTK K;  5C4J K;  4A3F C;  2PA8 D;  3GTL C;  2E2H C;  4KMU A;  2CW0 A;  3GTL K;  5IYC K;  1SMY A;  4AYB D;  2A68 A;  2E2H K;  4A3M C;  4BXX K;  4A3M K;  3PO2 C;  4BY7 C;  2NVQ C;  5C4X C;  4BY7 K;  4KN4 A;  2R7Z C;  5C4X K;  2R7Z K;  4JK1 A;  4A3C C;  4YG2 A;  3GTP C;  4A3C K;  4OIR A;  4C3H K;  4OIO A;  5M5W K;  4OIP A;  2NVX K;  3GTP K;  2WAQ D;  3S1Q K;  1I3Q C;  5TMF A;  1Y1W C;  1WCM C;  4G7Z A;  5M3M K;  3M4O C;  1HQM A;  3WOD A;  1TWH C;  5IP9 C;  2PMZ D;  3S16 C;  3M4O K;  3GTG C;  1TWH K;  5IP9 K;  3S16 K;  3H0G C;  3GTG K;  2BE5 A;  4QIW L;  2Y0S L;  1I6H C;  4Q4Z A;  4ZH4 A;  2PA8 L;  1I6H K;  4LK0 A;  2WB1 D;  5D4D A;  4YFX A;  5FLM C;  4AYB L;  4A3F K;  1BDF A;  3PO3 C;  3RZO C;  3RZO K;  5FLM K;  4A3B C;  3PO3 K;  3S1M C;  4A3G C;  4A3B K;  2PPB A;  3S1M K;  4A3G K;  4OIQ A;  3HKZ D;  5C44 C;  3PO2 K;  4A3J C;  2NVY C;  4BBS C;  2NVQ K;  5C44 K;  1I50 C;  4A3J K;  3I4N C;  4MQ9 A;  4BBS K;  3DXJ A;  1I50 K;  3I4N K;  3H3V L;  2VUM C;  5C3E C;  2VUM K;  2WAQ L;  1TWG C;  5C3E K;  1SFO C;  1TWG K;  1TWF C;  4MEX A;  2JA5 C;  1SFO K;  3GTO C;  1I3Q K;  2JA5 K;  1Y1W K;  1WCM K;  2A6E A;  3GTO K;  4Q5S A;  2PMZ L;  3K7A C;  3GTM C;  4YFK A;  3K7A K;  1IW7 A;  4A93 C;  4A93 K;  4LK1 A;  3H0G K;  4A3E C;  3FKI C;  4A3E K;  4XSZ A;  4BY1 C;  4QJV B;  1ZYR A;  4A3D C;  4XLP A;  4BY1 K;  2E2J C;  4A3D K;  2E2I C;  3RZD C;  1R9T C;  4LLG A;  3S2H C;  4LJZ A;  2E2J K;  2E2I K;  3RZD K;  4XSX A;  1R9T K;  3S14 C;  3S1N K;  3S1N C;  3S14 K;  1I6V A;  3HOU C;  2JA7 C;  4BBR C;  3HOU K;  1XPP A;  2NVY K;  4BBR K;  1K83 C;  4QJV A;  2JA7 K;  3HOV C;  3HOV K;  4BXX C;  1K83 K; 
#chains in the Genus database with same CATH topology
 4KM8 A;  1G51 A;  4G0U A;  3L4J A;  3T02 A;  1O2A A;  1TWG A;  4Y52 C;  3S0X A;  3HOZ C;  3M3Y C;  3HOW C;  2JA5 A;  1KQ4 A;  1WOR A;  5IYB K;  1YNN A;  2B63 C;  5IYC C;  4P5B A;  4PAA A;  4C2M K;  3GTQ C;  4G7O A;  3BUE A;  3S1R C;  4OIN A;  1VLO A;  4C3H C;  3S15 K;  3HOX K;  3S1Q C;  1C0A A;  3NUH A;  5TMC A;  4GZY A;  4WIL A;  4FZB A;  5CHP A;  4X6A K;  5IOQ A;  4WJ4 A;  2A69 A;  2V6U A;  4A3L C;  1USM A;  4YFN A;  1EQR A;  1TWF A;  3GTJ K;  2O5J A;  3GTK C;  4KAR A;  4LR2 A;  4A3F C;  1ZBS A;  4KAS A;  3GTM A;  3LPX A;  2E2H C;  3GTL K;  5IYC K;  4AYB D;  4A3M C;  1PJ7 A;  1IBA A;  2R93 A;  2R7Z C;  5JVO A;  3GTP C;  4C3H K;  5M5W K;  1DCP A;  2WAQ D;  3S1Q K;  4GTB A;  1TWA A;  2JA6 A;  5EGH A;  1TWH C;  2ZUF A;  1JQW A;  5IP9 K;  3S16 K;  2Y3P A;  1WOP A;  1XXA A;  3ADA C;  4A3F K;  5L46 A;  2GAH C;  2JH3 A;  3PO3 K;  3FOE A;  4A3B K;  3HKZ D;  4BBS C;  5C44 K;  4A3J K;  1INN A;  5CJ9 A;  2VUM C;  3L4K A;  3G4C A;  5C3E K;  1WOO A;  1SFO C;  1TWG K;  1TWF C;  4G0V A;  2JA5 K;  3OPF A;  2A6E A;  2GSO A;  2PMZ L;  3AQO A;  3GTM C;  1F7V A;  2ZFZ A;  4G0W A;  1F7U A;  4BKW A;  4BY1 C;  1EI6 A;  1XZP B;  2E2J C;  4A3D K;  2E2I C;  3GEE A;  4LJZ A;  3GEH A;  1USO A;  2JA7 C;  1XZQ B;  2W7V A;  4J3N A;  3HOU K;  3HOV C;  4C3J C;  4GTC A;  1I50 A;  4KAW X;  4LOW A;  1TWF K;  5IYB C;  1WCM A;  3GTO A;  4GTF A;  3GTM K;  4C2M C;  2R93 K;  5IYD K;  3FKI A;  2O5I A;  1IL2 A;  3I4M K;  3S15 C;  3HKZ L;  3HOX C;  1JOE A;  4KDD A;  1UV7 A;  3IPJ A;  1TWA K;  1IQ0 A;  5IOT A;  2JA6 K;  3S17 K;  1DCO A;  4X6A C;  1K83 A;  4KN7 A;  2R92 A;  5IP7 K;  3A8I A;  1TWC A;  1J98 A;  1Y1V A;  1XZQ A;  3GTJ C;  2JA8 K;  3TFH A;  1ZXO A;  1EFW A;  1ZVU A;  2YU9 A;  3GTL C;  2P5M A;  4KMU A;  4GTL A;  2A68 A;  3SZY A;  1WQH A;  4BY7 K;  5C4X K;  4JK1 A;  3T01 A;  4KAT A;  1VH2 A;  5TMF A;  1WCM C;  4G7Z A;  4PAB A;  3JST A;  5IP9 C;  2PMZ D;  3S16 C;  1EH1 A;  3A8J A;  3Q3Q A;  1AB4 A;  3CQZ A;  2GAG C;  1I6H K;  2WB1 D;  2GSN A;  5D4D A;  2D6F C;  3PO3 C;  2XCR B;  5FLM K;  4A3B C;  3TTG A;  5C44 C;  4A3J C;  1I50 K;  3BP3 A;  3I4N K;  5C3E C;  1TWG C;  2NVX A;  4GTE A;  1B4A A;  4MEX A;  2JA5 C;  1WOS A;  5EGE A;  1WCM K;  3GTO K;  3K7A K;  4LK1 A;  3GTG A;  1ISE A;  1J6X A;  3N3Y A;  1J6V A;  4A3D C;  4O2D A;  1DCH A;  4LLG A;  1IS1 A;  3HOU C;  4GFQ A;  4BXX K;  1K83 K;  4P9S A;  2R92 K;  1L0W A;  1TWC K;  4DDQ A;  1Y1V K;  2EBB A;  4A3K C;  1WQG A;  1I3Q A;  2YU9 K;  1Y1W A;  3HXA A;  5C4J C;  3G4A A;  4ILD A;  4XLN A;  1RU0 A;  4Y7N K;  3H0G A;  3A8K A;  2R93 C;  5IYD C;  2WB1 L;  1PJ6 A;  5M3F K;  1BGW A;  3LAP A;  3I4M C;  4G7H A;  3S2D K;  4MEY A;  1R9T A;  1WQF A;  2NVX C;  1TWA C;  1V5V A;  2V6S A;  3AD9 C;  1B4B A;  5HL8 A;  2JA6 C;  3S17 C;  2RH6 A;  1YNJ A;  5IP7 C;  2NVT K;  3AD7 C;  1JVI A;  1O25 A;  4NOI A;  3MML B;  2JA8 C;  5M5Y K;  1XXB A;  5M5X K;  1O2F B;  4A3I K;  4A3K K;  3CQZ K;  3HOY K;  4C3I K;  5TJ3 A;  1XZP A;  5C4J K;  1O29 A;  1VGX A;  2B63 A;  3V4G A;  2GSU A;  4BY7 C;  2NVQ C;  5C4X C;  1F93 A;  3ERE D;  2PHC B;  4YG2 A;  3GTQ A;  4A3C K;  4OIR A;  2NVX K;  1I3Q C;  1Y1W C;  1J6W A;  4GTA A;  1HQM A;  3M4O K;  3H0G C;  4KMD A;  3GTG K;  4QIW L;  2Y0S L;  1I6H C;  4ZH4 A;  2PA8 L;  4LK0 A;  3GTK A;  5FLM C;  3RZO K;  4KC6 A;  2E2H A;  3S1M K;  4A3G K;  4OIQ A;  2NVQ K;  1I50 C;  4M1X A;  3I4N C;  4MQ9 A;  3OEP A;  2R7Z A;  2FQT A;  2XCO A;  4GT9 A;  3LAJ A;  3GTP A;  3GTO C;  5E68 A;  1I3Q K;  1Y1W K;  4Q5S A;  4RMF A;  3K7A C;  4BLB A;  4A93 K;  1TWH A;  3H0G K;  3TFI A;  1VJE A;  3FKI C;  1O24 A;  4A3E K;  4XSZ A;  1ZYR A;  3AH5 A;  4FM9 A;  3S2H C;  1XXC A;  3RZD K;  4XSX A;  1R9T K;  3S1N K;  2P8T A;  3S14 K;  1I6V A;  1DD5 A;  1XPP A;  4BBR K;  4BLA A;  1K83 C;  4QJV A;  4BXX C;  2CFA A;  4KB2 A;  2R92 C;  3N0B A;  1PJ5 A;  3AD8 C;  1TWC C;  1Y1V C;  5FJ8 K;  2VUM A;  2YU9 C;  1SFO A;  4Y52 K;  3HOZ K;  3M3Y K;  3HOW K;  4Y7N C;  3QX3 A;  2B63 K;  5JFE A;  3FKI K;  1O26 A;  3S2D C;  2V6T A;  3GTQ K;  3S2H K;  3S1R K;  3VA7 A;  2E2I A;  1GE9 A;  3H3V D;  3GEI A;  4XCH A;  4C45 A;  3EQL A;  2JA7 A;  2NVY A;  2A6H A;  2NVT C;  1WIH A;  1ZQ1 C;  5IOR A;  3N0C A;  4A3I C;  3FOF A;  4A3L K;  3CQZ C;  3HOY C;  4C3I C;  4QIW D;  2Y0S D;  3GTK K;  1X31 C;  2PA8 D;  1BS2 A;  3BP8 C;  1IE0 A;  2CW0 A;  2E2H K;  1SMY A;  4A3M K;  1YCL A;  3PO2 C;  3ORE A;  4KN4 A;  4WJ3 M;  2R7Z K;  4KB4 A;  4A3C C;  4GTD A;  2XCQ A;  3GTP K;  4OIO A;  4OIP A;  3GSI A;  4KMH A;  5M3M K;  3M4O C;  3WOD A;  3GIR A;  4LQY A;  3GTG C;  1TWH K;  3TFJ A;  2BE5 A;  3T00 A;  2ZUE A;  1O2B A;  3GTJ A;  4Q4Z A;  1O27 A;  4YFX A;  3RZO C;  4AYB L;  1BDF A;  3GTL A;  3S1M C;  4A3G C;  2PPB A;  3CAG A;  3PO2 K;  2NVY C;  3GDZ A;  4BBS K;  3DXJ A;  3FHZ A;  3H3V L;  2RGR A;  1WSR A;  2VUM K;  3AQP A;  2WAQ L;  1F9N A;  1SFO K;  1BJT A;  4KM9 A;  3SZZ A;  4YFK A;  1IW7 A;  1HI9 A;  4A93 C;  5IOS A;  4A3E C;  1WSV A;  4QJV B;  1O28 A;  4XLP A;  2CFA B;  4BY1 K;  1EK8 A;  3RZD C;  1R9T C;  3S1N C;  2E2J K;  2E2I K;  3S14 C;  2KWA A;  2FQO A;  1YX2 A;  4BBR C;  1VRQ C;  2JA7 K;  2NVY K;  4KMA A;  4P5A A;  4AH6 A;  3HOV K;  4C3J K; 
#chains in the Genus database with same CATH homology
 2R92 C;  2R92 K;  1TWC C;  1Y1V C;  5FJ8 K;  1TWC K;  1Y1V K;  1TWF K;  4Y52 C;  5IYB C;  4A3K C;  2YU9 C;  3HOW C;  3HOZ C;  3M3Y C;  2YU9 K;  5IYB K;  3HOZ K;  3M3Y K;  3HOW K;  4Y52 K;  5C4J C;  3GTM K;  1YNN A;  4XLN A;  4Y7N C;  4C3J K;  5IYC C;  2B63 C;  4Y7N K;  2B63 K;  2R93 C;  5IYD C;  2WB1 L;  4C2M K;  5M3F K;  3FKI K;  2R93 K;  5IYD K;  3I4M C;  2O5I A;  3GTQ C;  3I4M K;  3S2D C;  4G7O A;  3S1R C;  3S2H K;  3GTQ K;  4G7H A;  3S15 C;  4MEY A;  3S1R K;  4OIN A;  3S2D K;  3HKZ L;  3HOX C;  3S15 K;  2NVX C;  1TWA C;  3H3V D;  3HOX K;  3S1Q C;  1TWA K;  5TMC A;  4GZY A;  2JA6 C;  3S17 C;  3EQL A;  2JA6 K;  3S17 K;  2A6H A;  4X6A C;  1YNJ A;  4KN7 A;  5IP7 C;  2NVT C;  4X6A K;  2A69 A;  5IP7 K;  2NVT K;  4NOI A;  2JA8 C;  4A3L C;  5M5Y K;  4A3I C;  2JA8 K;  4YFN A;  5M5X K;  3GTJ C;  3CQZ C;  4A3L K;  4A3I K;  4A3K K;  3HOY C;  3GTJ K;  3CQZ K;  2O5J A;  3HOY K;  3GTK C;  4QIW D;  2Y0S D;  4C3I K;  3GTK K;  5C4J K;  4A3F C;  2PA8 D;  3GTL C;  2E2H C;  4KMU A;  2CW0 A;  3GTL K;  5IYC K;  1SMY A;  4AYB D;  2A68 A;  2E2H K;  4A3M C;  4BXX K;  4A3M K;  3PO2 C;  4BY7 C;  2NVQ C;  5C4X C;  4BY7 K;  4KN4 A;  2R7Z C;  5C4X K;  2R7Z K;  4JK1 A;  4A3C C;  4YG2 A;  3GTP C;  4A3C K;  4OIR A;  4C3H K;  4OIO A;  5M5W K;  4OIP A;  2NVX K;  3GTP K;  2WAQ D;  3S1Q K;  1I3Q C;  5TMF A;  1Y1W C;  1WCM C;  4G7Z A;  5M3M K;  3M4O C;  1HQM A;  3WOD A;  1TWH C;  5IP9 C;  2PMZ D;  3S16 C;  3M4O K;  3GTG C;  1TWH K;  5IP9 K;  3S16 K;  3H0G C;  3GTG K;  2BE5 A;  4QIW L;  2Y0S L;  1I6H C;  4Q4Z A;  4ZH4 A;  2PA8 L;  1I6H K;  4LK0 A;  2WB1 D;  5D4D A;  4YFX A;  5FLM C;  4AYB L;  4A3F K;  1BDF A;  3PO3 C;  3RZO C;  3RZO K;  5FLM K;  4A3B C;  3PO3 K;  3S1M C;  4A3G C;  4A3B K;  2PPB A;  3S1M K;  4A3G K;  4OIQ A;  3HKZ D;  5C44 C;  3PO2 K;  4A3J C;  2NVY C;  4BBS C;  2NVQ K;  5C44 K;  1I50 C;  4A3J K;  3I4N C;  4MQ9 A;  4BBS K;  3DXJ A;  1I50 K;  3I4N K;  3H3V L;  2VUM C;  5C3E C;  2VUM K;  2WAQ L;  1TWG C;  5C3E K;  1SFO C;  1TWG K;  1TWF C;  4MEX A;  2JA5 C;  1SFO K;  3GTO C;  1I3Q K;  2JA5 K;  1Y1W K;  1WCM K;  2A6E A;  3GTO K;  4Q5S A;  2PMZ L;  3K7A C;  3GTM C;  4YFK A;  3K7A K;  1IW7 A;  4A93 C;  4A93 K;  4LK1 A;  3H0G K;  4A3E C;  3FKI C;  4A3E K;  4XSZ A;  4BY1 C;  4QJV B;  1ZYR A;  4A3D C;  4XLP A;  4BY1 K;  2E2J C;  4A3D K;  2E2I C;  3RZD C;  1R9T C;  4LLG A;  3S2H C;  4LJZ A;  2E2J K;  2E2I K;  3RZD K;  4XSX A;  1R9T K;  3S14 C;  3S1N K;  3S1N C;  3S14 K;  1I6V A;  3HOU C;  2JA7 C;  4BBR C;  3HOU K;  1XPP A;  2NVY K;  4BBR K;  1K83 C;  4QJV A;  2JA7 K;  3HOV C;  3HOV K;  4BXX C;  1K83 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...