4Y7NK

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y7nK00
2PMZL 2NVQK 2WAQL 4A3EK 2YU9C 5TMCA 4AYBL 4OIPA 5FLMK 2NVTC 4GZYA 1I50K 4MEYA 2NVYC 3S1MK 3S1QC 2R7ZC 1TWGK 3S1RK 3PO2K 4C3IK 2WB1L 2NVXK 2YU9K 2PA8L 3S17K 4BY1C 2A69A 5M3FK 5M5YK 4LJZA 2NVYK 5IYCC 3H3VL 3S1QK 2R7ZK 3S2HC 4NOIA 1BDFA 5M5XK 4BY1K 1TWFC 4A3CC 4A93C 2PPBA 2NVQC 4QIWL 4JK1A 5IYCK 5M5WK 3S2HK 3S14K 5FLMC 3GTQC 4ZH4A 4C3JK 2JA8K 1TWFK 3FKIC 4A3CK 3S1MC 2R93C 4C2MK 1SFOC 2B63K 4A93K 5C44K 1TWGC 1TWAK 3S1RC 5IP7K 3PO2C 3WODA 2NVXC 4OINA 3GTKC 1I3QK 4A3FC 3S17C 2A6EA 3GTQK 3GTPK 1TWHC 1YNNA 3HOUC 3I4MC 3FKIK 4YG2A 3GTJC 2E2JC 3GTLC 2R93K 1SFOK 4BBRC 1WCMC 1ZYRA 4QJVB 2JA5K 3K7AC 1XPPA 3GTKK 4A3FK 3EQLA 1TWHK 5D4DA 5C3EC 4MEXA 2E2JK 3HOUK 3GTJK 3I4MK 3GTLK 3S16C 2O5JA 4BXXC 3S14C 4BBRK 4A3KC 3GTMK 1WCMK 4A3IK 2JA6K 2JA8C 3K7AK 4BY7C 5IYBK 2B63C 4C3HK 2WB1D 5C44C 5C3EK 1TWAC 2PA8D 5IP7C 3S16K 4OIOA 1HQMA 4BXXK 1I3QC 4XLNA 3S2DC 4A3KK 2Y0SD 2VUMC 3GTPC 4QJVA 4BY7K 1I6HC 5C4JK 4MQ9A 3RZDC 3HKZD 2JA5C 4A3MK 2R92C 3HOVC 4KMUA 3HOWC 3PO3C 3S2DK 4A3BK 4QIWD 2VUMK 3M3YC 2BE5A 4A3LC 1I6HK 4XSZA 2JA7K 3HOZK 5TMFA 3RZDK 3GTMC 4Q4ZA 2JA6C 4A3IC 3HOVK 3S1NK 2R92K 4XLPA 3GTOC 3HOWK 3PO3K 1IW7A 2PMZD 5IYBC 1TWCK 2WAQD 3M3YK 3H0GC 3GTGK 1Y1WK 2E2HK 4G7ZA 4Y7NK 4A3LK 4AYBD 4A3DK 4Q5SA 1Y1VC 3S15K 2A68A 3RZOC 2CW0A 3GTOK 3M4OK 4Y52C 4G7HA 5C4JC 2E2IC 3H0GK 1R9TC 4KN4A 4OIRA 4LLGA 4G7OA 4A3MC 3I4NK 3DXJA 1K83C 1Y1VK 3RZOK 4A3BC 4BBSC 1I6VA 4OIQA 3H3VD 4Y52K 2JA7C 4A3JK 2E2IK 3HOZC 4LK1A 4YFXA 1R9TK 3CQZC 1YNJA 3S1NC 4YFKA 4X6AC 1K83K 5C4XC 4BBSK 1TWCC 3GTGC 1Y1WC 2E2HC 4Y7NC 2NVTK 4A3DC 2Y0SL 3CQZK 3S15C 4XSXA 5IP9C 3M4OC 4YFNA 4X6AK 5C4XK 3HOXC 4A3GC 3HKZL 5IYDC 3HOYC 4KN7A 3I4NC 1SMYA 5FJ8K 4A3EC 2O5IA 5IP9K 5M3MK 3HOXK 4A3GK 4A3JC 5IYDK 1I50C 3HOYK 2A6HA 4LK0A
chains in the Genus database with same CATH superfamily
2PMZL 2WAQL 1IE0A 4G0WA 2YU9C 5TMCA 1VLOA 4P5BA 2NVYC 3GTMA 1TWGK 3A8KA 2D6FC 2NVXK 2YU9K 1O26A 4BY1C 4GTCA 4KARA 2P5MA 4LJZA 2NVYK 3H3VL 5IOQA 2JH3A 1EFWA 4BY1K 4A3CC 2PPBA 2NVQC 4RMFA 1WOPA 1F93A 2VUMA 1ZXOA 5FLMC 4A3CK 2B63K 5C44K 1PJ6A 2GSOA 2XCOA 3I4MC 3GTLC 1WOOA 1WCMC 3G4CA 1B4BA 4GTBA 5D4DA 3I4MK 3S16C 3GTLK 2O5JA 3GEEA 4BXXC 4P5AA 1WCMK 2JA8C 4C3JC 1WORA 2RGRA 2V6TA 3S16K 3AH5A 4BXXK 1I3QC 4XLNA 2Y0SD 3GTPC 2P8TA 2JA5C 3HOVC 1J6VA 1TWCA 5HL8A 4A3BK 3M3YC 2RH6A 1DCHA 4Q4ZA 3HOVK 1AB4A 3GTOC 1XZQB 3M3YK 3GTGK 3AD9C 4P9SA 3GTOK 4KMHA 3M4OK 1I50A 5C4JC 4KM8A 1R9TC 1EQRA 3JSTA 4AH6A 3DXJA 1K83C 2CFAA 1XZPB 4A3JK 4G0VA 1R9TK 3CQZC 4M1XA 1DD5A 1K83K 4KB2A 2W7VA 2E2HC 5IOTA 4Y7NC 2Y0SL 3CQZK 1F7VA 3AQPA 1VH2A 3HOXC 4A3EC 4BLAA 3LAJA 3HOXK 2JA5A 3GTKA 4A3EK 3FOFA 3N3YA 1TWHA 1J98A 1EH1A 2NVTC 3S1MK 1ZVUA 3S1RK 3FOEA 3PO2K 2WB1L 4KM9A 3S2HC 2GAGC 5M5XK 4KB4A 1TWFC 1UV7A 4C2MC 4A93C 1F9NA 3OPFA 3S2HK 3S14K 3GTQC 1TWFK 2R93C 4C2MK 4A93K 3A8JA 1TWGC 5E68A 1BJTA 5L46A 2NVXC 3GTQK 2E2HA 3HOUC 2R93K 4YG2A 3GTJC 3OREA 2JA6A 1B4AA 1ZYRA 3K7AC 4C3HC 3HOUK 4MEXA 3GTJK 1O28A 4A3IK 1XXCA 3K7AK 2B63C 4C3HK 2V6SA 5C44C 2PA8D 4BLBA 4OIOA 3TFIA 4GTLA 4ILDA 4C45A 4QJVA 1O29A 2JA7A 4GFQA 4GTAA 5CHPA 1WQHA 5JVOA 4A3MK 2R92C 4QIWD 2R92K 1TWCK 3QX3A 3H0GC 1XZPA 1Y1WK 4A3DK 4AYBD 3ADAC 1Y1VC 4WJ3M 3S15K 2A68A 3TTGA 1X31C 1XXBA 4Y52C 2E2IC 2XCRB 3H0GK 4GT9A 1L0WA 4DDQA 3I4NK 1EK8A 3S0XA 1Y1VK 2YU9A 4BBSC 4A3BC 1I6VA 4G0UA 2GSNA 4LQYA 4Y52K 2E2IK 2NVYA 4LK1A 1O25A 4X6AC 3GEHA 5C4XC 3GIRA 4BBSK 5EGEA 3GTGC 3CAGA 3N0BA 4XSXA 3M4OC 1JOEA 4YFNA 1V5VA 4X6AK 4KAWX 5C4XK 4A3GC 2B63A 5CJ9A 1SMYA 1IL2A 4J3NA 4A3JC 4A3GK 4C3IC 2FQTA 1HI9A 4AYBL 4GZYA 3GSIA 3GTLA 3S1QC 2R7ZC 1WCMA 4C3IK 3S17K 5M3FK 3A8IA 5M5YK 5IYCC 3S1QK 2R7ZK 1BDFA 4PAAA 2FQOA 3G4AA 4JK1A 1XXAA 5IYCK 5TJ3A 1I3QA 5M5WK 4FZBA 3GTPA 1YCLA 5JFEA 3FKIC 3S1MC 1SFOC 3IPJA 1TWAK 1WQGA 5IP7K 3S1RC 3PO2C 4OINA 3V4GA 4A3FC 1WSRA 3GTGA 3FKIK 1SFOK 3BUEA 4BBRC 3GTOA 4A3FK 3S14C 4BBRK 4A3KC 3GTMK 2JA6K 5IOSA 1WOSA 3T01A 5IYBK 1PJ5A 4GTEA 1R9TA 3GDZA 1HQMA 1K83A 3Q3QA 4A3KK 2VUMC 3NUHA 1I6HC 4KDDA 3CQZA 3RZDC 2ZUEA 4KMUA 3HOWC 2VUMK 2BE5A 3HXAA 1I6HK 4XSZA 2JA7K 3HOZK 2CFAB 3GEIA 3RZDK 3S1NK 4A3IC 4XLPA 3HOWK 2EBBA 4Q5SA 4WILA 3LAPA 3RZOC 3BP3A 1RU0A 4G7HA 4KN4A 4OIRA 5EGHA 4G7OA 4A3MC 1YX2A 3TFJA 3RZOK 1GE9A 4OIQA 1O2BA 1C0AA 1XZQA 1G51A 2ZFZA 2GAHC 1TWCC 3AD7C 2KWAA 1Y1WC 4A3DC 3S15C 5IP9C 1TWFA 5IYDC 3HOYC 1BS2A 3OEPA 3I4NC 5FJ8K 2O5IA 5IP9K 4XCHA 3GTQA 5M3MK 2R93A 5IYDK 1I50C 3HOYK 2A6HA 1TWGA 4KC6A 2NVQK 2NVXA 3AD8C 1VGXA 4OIPA 5FLMK 1I50K 4GTDA 3GTJA 4MEYA 1J6XA 1IS1A 1J6WA 3FHZA 2GSUA 2PA8L 2A69A 2ZUFA 3LPXA 3AQOA 4GTFA 4NOIA 1USOA 4QIWL 4WJ4A 4ZH4A 1KQ4A 4C3JK 2JA8K 1WQFA 3T02A 2R92A 4KMDA 3WODA 3GTKC 3S17C 1I3QK 2A6EA 3GTPK 1TWHC 2V6UA 1YNNA 1Y1WA 3TFHA 2E2JC 1PJ7A 4QJVB 2JA5K 1VJEA 1XPPA 3GTKK 1O24A 3EQLA 3H0GA 1BGWA 1TWHK 4LOWA 5C3EC 4FM9A 2E2JK 1Y1VA 3ERED 1WIHA 3L4JA 4BY7C 2E2IA 2WB1D 4KASA 5C3EK 1TWAC 5IP7C 1O2FB 3S2DC 1IBAA 5IORA 3T00A 4BY7K 5C4JK 3BP8C 4MQ9A 3HKZD 1ZQ1C 3SZYA 4PABA 3PO3C 3S2DK 1F7UA 1ISEA 4A3LC 1O27A 2Y3PA 5TMFA 1JQWA 3GTMC 2JA6C 3PO3K 1IW7A 2PMZD 3VA7A 5IYBC 4BKWA 2WAQD 1EI6A 4KATA 4G7ZA 4Y7NK 2E2HK 2PHCB 1USMA 4A3LK 3MMLB 3N0CA 2CW0A 1VRQC 1O2AA 4LLGA 1IQ0A 2XCQA 3H3VD 2JA7C 3HOZC 4O2DA 4YFXA 3L4KA 1YNJA 3S1NC 4YFKA 2R7ZA 4LR2A 1WSVA 1DCPA 4KMAA 2NVTK 1INNA 3SZZA 1ZBSA 3HKZL 4KN7A 1TWAA 1DCOA 1JVIA 3FKIA 1SFOA 4LK0A
chains in the Genus database with same CATH topology
2PMZL 2NVQK 2WAQL 4A3EK 2YU9C 5TMCA 4AYBL 4OIPA 5FLMK 2NVTC 4GZYA 1I50K 4MEYA 2NVYC 3S1MK 3S1QC 2R7ZC 1TWGK 3S1RK 3PO2K 4C3IK 2WB1L 2NVXK 2YU9K 2PA8L 3S17K 4BY1C 2A69A 5M3FK 5M5YK 4LJZA 2NVYK 5IYCC 3H3VL 3S1QK 2R7ZK 3S2HC 4NOIA 1BDFA 5M5XK 4BY1K 1TWFC 4A3CC 4A93C 2PPBA 2NVQC 4QIWL 4JK1A 5IYCK 5M5WK 3S2HK 3S14K 5FLMC 3GTQC 4ZH4A 4C3JK 2JA8K 1TWFK 3FKIC 4A3CK 3S1MC 2R93C 4C2MK 1SFOC 2B63K 4A93K 5C44K 1TWGC 1TWAK 3S1RC 5IP7K 3PO2C 3WODA 2NVXC 4OINA 3GTKC 1I3QK 4A3FC 3S17C 2A6EA 3GTQK 3GTPK 1TWHC 1YNNA 3HOUC 3I4MC 3FKIK 4YG2A 3GTJC 2E2JC 3GTLC 2R93K 1SFOK 4BBRC 1WCMC 1ZYRA 4QJVB 2JA5K 3K7AC 1XPPA 3GTKK 4A3FK 3EQLA 1TWHK 5D4DA 5C3EC 4MEXA 2E2JK 3HOUK 3GTJK 3I4MK 3GTLK 3S16C 2O5JA 4BXXC 3S14C 4BBRK 4A3KC 3GTMK 1WCMK 4A3IK 2JA6K 2JA8C 3K7AK 4BY7C 5IYBK 2B63C 4C3HK 2WB1D 5C44C 5C3EK 1TWAC 2PA8D 5IP7C 3S16K 4OIOA 1HQMA 4BXXK 1I3QC 4XLNA 3S2DC 4A3KK 2Y0SD 2VUMC 3GTPC 4QJVA 4BY7K 1I6HC 5C4JK 4MQ9A 3RZDC 3HKZD 2JA5C 4A3MK 2R92C 3HOVC 4KMUA 3HOWC 3PO3C 3S2DK 4A3BK 4QIWD 2VUMK 3M3YC 2BE5A 4A3LC 1I6HK 4XSZA 2JA7K 3HOZK 5TMFA 3RZDK 3GTMC 4Q4ZA 2JA6C 4A3IC 3HOVK 3S1NK 2R92K 4XLPA 3GTOC 3HOWK 3PO3K 1IW7A 2PMZD 5IYBC 1TWCK 2WAQD 3M3YK 3H0GC 3GTGK 1Y1WK 2E2HK 4G7ZA 4Y7NK 4A3LK 4AYBD 4A3DK 4Q5SA 1Y1VC 3S15K 2A68A 3RZOC 2CW0A 3GTOK 3M4OK 4Y52C 4G7HA 5C4JC 2E2IC 3H0GK 1R9TC 4KN4A 4OIRA 4LLGA 4G7OA 4A3MC 3I4NK 3DXJA 1K83C 1Y1VK 3RZOK 4A3BC 4BBSC 1I6VA 4OIQA 3H3VD 4Y52K 2JA7C 4A3JK 2E2IK 3HOZC 4LK1A 4YFXA 1R9TK 3CQZC 1YNJA 3S1NC 4YFKA 4X6AC 1K83K 5C4XC 4BBSK 1TWCC 3GTGC 1Y1WC 2E2HC 4Y7NC 2NVTK 4A3DC 2Y0SL 3CQZK 3S15C 4XSXA 5IP9C 3M4OC 4YFNA 4X6AK 5C4XK 3HOXC 4A3GC 3HKZL 5IYDC 3HOYC 4KN7A 3I4NC 1SMYA 5FJ8K 4A3EC 2O5IA 5IP9K 5M3MK 3HOXK 4A3GK 4A3JC 5IYDK 1I50C 3HOYK 2A6HA 4LK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ L;  2NVQ K;  2WAQ L;  4A3E K;  2YU9 C;  5TMC A;  4AYB L;  4OIP A;  5FLM K;  2NVT C;  4GZY A;  1I50 K;  4MEY A;  2NVY C;  3S1M K;  3S1Q C;  2R7Z C;  1TWG K;  3S1R K;  3PO2 K;  4C3I K;  2WB1 L;  2NVX K;  2YU9 K;  2PA8 L;  3S17 K;  4BY1 C;  2A69 A;  5M3F K;  5M5Y K;  4LJZ A;  2NVY K;  5IYC C;  3H3V L;  3S1Q K;  2R7Z K;  3S2H C;  4NOI A;  1BDF A;  5M5X K;  4BY1 K;  1TWF C;  4A3C C;  4A93 C;  2PPB A;  2NVQ C;  4QIW L;  4JK1 A;  5IYC K;  5M5W K;  3S2H K;  3S14 K;  5FLM C;  3GTQ C;  4ZH4 A;  4C3J K;  2JA8 K;  1TWF K;  3FKI C;  4A3C K;  3S1M C;  2R93 C;  4C2M K;  1SFO C;  2B63 K;  4A93 K;  5C44 K;  1TWG C;  1TWA K;  3S1R C;  5IP7 K;  3PO2 C;  3WOD A;  2NVX C;  4OIN A;  3GTK C;  1I3Q K;  4A3F C;  3S17 C;  2A6E A;  3GTQ K;  3GTP K;  1TWH C;  1YNN A;  3HOU C;  3I4M C;  3FKI K;  4YG2 A;  3GTJ C;  2E2J C;  3GTL C;  2R93 K;  1SFO K;  4BBR C;  1WCM C;  1ZYR A;  4QJV B;  2JA5 K;  3K7A C;  1XPP A;  3GTK K;  4A3F K;  3EQL A;  1TWH K;  5D4D A;  5C3E C;  4MEX A;  2E2J K;  3HOU K;  3GTJ K;  3I4M K;  3GTL K;  3S16 C;  2O5J A;  4BXX C;  3S14 C;  4BBR K;  4A3K C;  3GTM K;  1WCM K;  4A3I K;  2JA6 K;  2JA8 C;  3K7A K;  4BY7 C;  5IYB K;  2B63 C;  4C3H K;  2WB1 D;  5C44 C;  5C3E K;  1TWA C;  2PA8 D;  5IP7 C;  3S16 K;  4OIO A;  1HQM A;  4BXX K;  1I3Q C;  4XLN A;  3S2D C;  4A3K K;  2Y0S D;  2VUM C;  3GTP C;  4QJV A;  4BY7 K;  1I6H C;  5C4J K;  4MQ9 A;  3RZD C;  3HKZ D;  2JA5 C;  4A3M K;  2R92 C;  3HOV C;  4KMU A;  3HOW C;  3PO3 C;  3S2D K;  4A3B K;  4QIW D;  2VUM K;  3M3Y C;  2BE5 A;  4A3L C;  1I6H K;  4XSZ A;  2JA7 K;  3HOZ K;  5TMF A;  3RZD K;  3GTM C;  4Q4Z A;  2JA6 C;  4A3I C;  3HOV K;  3S1N K;  2R92 K;  4XLP A;  3GTO C;  3HOW K;  3PO3 K;  1IW7 A;  2PMZ D;  5IYB C;  1TWC K;  2WAQ D;  3M3Y K;  3H0G C;  3GTG K;  1Y1W K;  2E2H K;  4G7Z A;  4Y7N K;  4A3L K;  4AYB D;  4A3D K;  4Q5S A;  1Y1V C;  3S15 K;  2A68 A;  3RZO C;  2CW0 A;  3GTO K;  3M4O K;  4Y52 C;  4G7H A;  5C4J C;  2E2I C;  3H0G K;  1R9T C;  4KN4 A;  4OIR A;  4LLG A;  4G7O A;  4A3M C;  3I4N K;  3DXJ A;  1K83 C;  1Y1V K;  3RZO K;  4A3B C;  4BBS C;  1I6V A;  4OIQ A;  3H3V D;  4Y52 K;  2JA7 C;  4A3J K;  2E2I K;  3HOZ C;  4LK1 A;  4YFX A;  1R9T K;  3CQZ C;  1YNJ A;  3S1N C;  4YFK A;  4X6A C;  1K83 K;  5C4X C;  4BBS K;  1TWC C;  3GTG C;  1Y1W C;  2E2H C;  4Y7N C;  2NVT K;  4A3D C;  2Y0S L;  3CQZ K;  3S15 C;  4XSX A;  5IP9 C;  3M4O C;  4YFN A;  4X6A K;  5C4X K;  3HOX C;  4A3G C;  3HKZ L;  5IYD C;  3HOY C;  4KN7 A;  3I4N C;  1SMY A;  5FJ8 K;  4A3E C;  2O5I A;  5IP9 K;  5M3M K;  3HOX K;  4A3G K;  4A3J C;  5IYD K;  1I50 C;  3HOY K;  2A6H A;  4LK0 A; 
#chains in the Genus database with same CATH topology
 2PMZ L;  2WAQ L;  1IE0 A;  4G0W A;  2YU9 C;  5TMC A;  1VLO A;  4P5B A;  2NVY C;  3GTM A;  1TWG K;  3A8K A;  2D6F C;  2NVX K;  2YU9 K;  1O26 A;  4BY1 C;  4GTC A;  4KAR A;  2P5M A;  4LJZ A;  2NVY K;  3H3V L;  5IOQ A;  2JH3 A;  1EFW A;  4BY1 K;  4A3C C;  2PPB A;  2NVQ C;  4RMF A;  1WOP A;  1F93 A;  2VUM A;  1ZXO A;  5FLM C;  4A3C K;  2B63 K;  5C44 K;  1PJ6 A;  2GSO A;  2XCO A;  3I4M C;  3GTL C;  1WOO A;  1WCM C;  3G4C A;  1B4B A;  4GTB A;  5D4D A;  3I4M K;  3S16 C;  3GTL K;  2O5J A;  3GEE A;  4BXX C;  4P5A A;  1WCM K;  2JA8 C;  4C3J C;  1WOR A;  2RGR A;  2V6T A;  3S16 K;  3AH5 A;  4BXX K;  1I3Q C;  4XLN A;  2Y0S D;  3GTP C;  2P8T A;  2JA5 C;  3HOV C;  1J6V A;  1TWC A;  5HL8 A;  4A3B K;  3M3Y C;  2RH6 A;  1DCH A;  4Q4Z A;  3HOV K;  1AB4 A;  3GTO C;  1XZQ B;  3M3Y K;  3GTG K;  3AD9 C;  4P9S A;  3GTO K;  4KMH A;  3M4O K;  1I50 A;  5C4J C;  4KM8 A;  1R9T C;  1EQR A;  3JST A;  4AH6 A;  3DXJ A;  1K83 C;  2CFA A;  1XZP B;  4A3J K;  4G0V A;  1R9T K;  3CQZ C;  4M1X A;  1DD5 A;  1K83 K;  4KB2 A;  2W7V A;  2E2H C;  5IOT A;  4Y7N C;  2Y0S L;  3CQZ K;  1F7V A;  3AQP A;  1VH2 A;  3HOX C;  4A3E C;  4BLA A;  3LAJ A;  3HOX K;  2JA5 A;  3GTK A;  4A3E K;  3FOF A;  3N3Y A;  1TWH A;  1J98 A;  1EH1 A;  2NVT C;  3S1M K;  1ZVU A;  3S1R K;  3FOE A;  3PO2 K;  2WB1 L;  4KM9 A;  3S2H C;  2GAG C;  5M5X K;  4KB4 A;  1TWF C;  1UV7 A;  4C2M C;  4A93 C;  1F9N A;  3OPF A;  3S2H K;  3S14 K;  3GTQ C;  1TWF K;  2R93 C;  4C2M K;  4A93 K;  3A8J A;  1TWG C;  5E68 A;  1BJT A;  5L46 A;  2NVX C;  3GTQ K;  2E2H A;  3HOU C;  2R93 K;  4YG2 A;  3GTJ C;  3ORE A;  2JA6 A;  1B4A A;  1ZYR A;  3K7A C;  4C3H C;  3HOU K;  4MEX A;  3GTJ K;  1O28 A;  4A3I K;  1XXC A;  3K7A K;  2B63 C;  4C3H K;  2V6S A;  5C44 C;  2PA8 D;  4BLB A;  4OIO A;  3TFI A;  4GTL A;  4ILD A;  4C45 A;  4QJV A;  1O29 A;  2JA7 A;  4GFQ A;  4GTA A;  5CHP A;  1WQH A;  5JVO A;  4A3M K;  2R92 C;  4QIW D;  2R92 K;  1TWC K;  3QX3 A;  3H0G C;  1XZP A;  1Y1W K;  4A3D K;  4AYB D;  3ADA C;  1Y1V C;  4WJ3 M;  3S15 K;  2A68 A;  3TTG A;  1X31 C;  1XXB A;  4Y52 C;  2E2I C;  2XCR B;  3H0G K;  4GT9 A;  1L0W A;  4DDQ A;  3I4N K;  1EK8 A;  3S0X A;  1Y1V K;  2YU9 A;  4BBS C;  4A3B C;  1I6V A;  4G0U A;  2GSN A;  4LQY A;  4Y52 K;  2E2I K;  2NVY A;  4LK1 A;  1O25 A;  4X6A C;  3GEH A;  5C4X C;  3GIR A;  4BBS K;  5EGE A;  3GTG C;  3CAG A;  3N0B A;  4XSX A;  3M4O C;  1JOE A;  4YFN A;  1V5V A;  4X6A K;  4KAW X;  5C4X K;  4A3G C;  2B63 A;  5CJ9 A;  1SMY A;  1IL2 A;  4J3N A;  4A3J C;  4A3G K;  4C3I C;  2FQT A;  1HI9 A;  4AYB L;  4GZY A;  3GSI A;  3GTL A;  3S1Q C;  2R7Z C;  1WCM A;  4C3I K;  3S17 K;  5M3F K;  3A8I A;  5M5Y K;  5IYC C;  3S1Q K;  2R7Z K;  1BDF A;  4PAA A;  2FQO A;  3G4A A;  4JK1 A;  1XXA A;  5IYC K;  5TJ3 A;  1I3Q A;  5M5W K;  4FZB A;  3GTP A;  1YCL A;  5JFE A;  3FKI C;  3S1M C;  1SFO C;  3IPJ A;  1TWA K;  1WQG A;  5IP7 K;  3S1R C;  3PO2 C;  4OIN A;  3V4G A;  4A3F C;  1WSR A;  3GTG A;  3FKI K;  1SFO K;  3BUE A;  4BBR C;  3GTO A;  4A3F K;  3S14 C;  4BBR K;  4A3K C;  3GTM K;  2JA6 K;  5IOS A;  1WOS A;  3T01 A;  5IYB K;  1PJ5 A;  4GTE A;  1R9T A;  3GDZ A;  1HQM A;  1K83 A;  3Q3Q A;  4A3K K;  2VUM C;  3NUH A;  1I6H C;  4KDD A;  3CQZ A;  3RZD C;  2ZUE A;  4KMU A;  3HOW C;  2VUM K;  2BE5 A;  3HXA A;  1I6H K;  4XSZ A;  2JA7 K;  3HOZ K;  2CFA B;  3GEI A;  3RZD K;  3S1N K;  4A3I C;  4XLP A;  3HOW K;  2EBB A;  4Q5S A;  4WIL A;  3LAP A;  3RZO C;  3BP3 A;  1RU0 A;  4G7H A;  4KN4 A;  4OIR A;  5EGH A;  4G7O A;  4A3M C;  1YX2 A;  3TFJ A;  3RZO K;  1GE9 A;  4OIQ A;  1O2B A;  1C0A A;  1XZQ A;  1G51 A;  2ZFZ A;  2GAH C;  1TWC C;  3AD7 C;  2KWA A;  1Y1W C;  4A3D C;  3S15 C;  5IP9 C;  1TWF A;  5IYD C;  3HOY C;  1BS2 A;  3OEP A;  3I4N C;  5FJ8 K;  2O5I A;  5IP9 K;  4XCH A;  3GTQ A;  5M3M K;  2R93 A;  5IYD K;  1I50 C;  3HOY K;  2A6H A;  1TWG A;  4KC6 A;  2NVQ K;  2NVX A;  3AD8 C;  1VGX A;  4OIP A;  5FLM K;  1I50 K;  4GTD A;  3GTJ A;  4MEY A;  1J6X A;  1IS1 A;  1J6W A;  3FHZ A;  2GSU A;  2PA8 L;  2A69 A;  2ZUF A;  3LPX A;  3AQO A;  4GTF A;  4NOI A;  1USO A;  4QIW L;  4WJ4 A;  4ZH4 A;  1KQ4 A;  4C3J K;  2JA8 K;  1WQF A;  3T02 A;  2R92 A;  4KMD A;  3WOD A;  3GTK C;  3S17 C;  1I3Q K;  2A6E A;  3GTP K;  1TWH C;  2V6U A;  1YNN A;  1Y1W A;  3TFH A;  2E2J C;  1PJ7 A;  4QJV B;  2JA5 K;  1VJE A;  1XPP A;  3GTK K;  1O24 A;  3EQL A;  3H0G A;  1BGW A;  1TWH K;  4LOW A;  5C3E C;  4FM9 A;  2E2J K;  1Y1V A;  3ERE D;  1WIH A;  3L4J A;  4BY7 C;  2E2I A;  2WB1 D;  4KAS A;  5C3E K;  1TWA C;  5IP7 C;  1O2F B;  3S2D C;  1IBA A;  5IOR A;  3T00 A;  4BY7 K;  5C4J K;  3BP8 C;  4MQ9 A;  3HKZ D;  1ZQ1 C;  3SZY A;  4PAB A;  3PO3 C;  3S2D K;  1F7U A;  1ISE A;  4A3L C;  1O27 A;  2Y3P A;  5TMF A;  1JQW A;  3GTM C;  2JA6 C;  3PO3 K;  1IW7 A;  2PMZ D;  3VA7 A;  5IYB C;  4BKW A;  2WAQ D;  1EI6 A;  4KAT A;  4G7Z A;  4Y7N K;  2E2H K;  2PHC B;  1USM A;  4A3L K;  3MML B;  3N0C A;  2CW0 A;  1VRQ C;  1O2A A;  4LLG A;  1IQ0 A;  2XCQ A;  3H3V D;  2JA7 C;  3HOZ C;  4O2D A;  4YFX A;  3L4K A;  1YNJ A;  3S1N C;  4YFK A;  2R7Z A;  4LR2 A;  1WSV A;  1DCP A;  4KMA A;  2NVT K;  1INN A;  3SZZ A;  1ZBS A;  3HKZ L;  4KN7 A;  1TWA A;  1DCO A;  1JVI A;  3FKI A;  1SFO A;  4LK0 A; 
#chains in the Genus database with same CATH homology
 2PMZ L;  2NVQ K;  2WAQ L;  4A3E K;  2YU9 C;  5TMC A;  4AYB L;  4OIP A;  5FLM K;  2NVT C;  4GZY A;  1I50 K;  4MEY A;  2NVY C;  3S1M K;  3S1Q C;  2R7Z C;  1TWG K;  3S1R K;  3PO2 K;  4C3I K;  2WB1 L;  2NVX K;  2YU9 K;  2PA8 L;  3S17 K;  4BY1 C;  2A69 A;  5M3F K;  5M5Y K;  4LJZ A;  2NVY K;  5IYC C;  3H3V L;  3S1Q K;  2R7Z K;  3S2H C;  4NOI A;  1BDF A;  5M5X K;  4BY1 K;  1TWF C;  4A3C C;  4A93 C;  2PPB A;  2NVQ C;  4QIW L;  4JK1 A;  5IYC K;  5M5W K;  3S2H K;  3S14 K;  5FLM C;  3GTQ C;  4ZH4 A;  4C3J K;  2JA8 K;  1TWF K;  3FKI C;  4A3C K;  3S1M C;  2R93 C;  4C2M K;  1SFO C;  2B63 K;  4A93 K;  5C44 K;  1TWG C;  1TWA K;  3S1R C;  5IP7 K;  3PO2 C;  3WOD A;  2NVX C;  4OIN A;  3GTK C;  1I3Q K;  4A3F C;  3S17 C;  2A6E A;  3GTQ K;  3GTP K;  1TWH C;  1YNN A;  3HOU C;  3I4M C;  3FKI K;  4YG2 A;  3GTJ C;  2E2J C;  3GTL C;  2R93 K;  1SFO K;  4BBR C;  1WCM C;  1ZYR A;  4QJV B;  2JA5 K;  3K7A C;  1XPP A;  3GTK K;  4A3F K;  3EQL A;  1TWH K;  5D4D A;  5C3E C;  4MEX A;  2E2J K;  3HOU K;  3GTJ K;  3I4M K;  3GTL K;  3S16 C;  2O5J A;  4BXX C;  3S14 C;  4BBR K;  4A3K C;  3GTM K;  1WCM K;  4A3I K;  2JA6 K;  2JA8 C;  3K7A K;  4BY7 C;  5IYB K;  2B63 C;  4C3H K;  2WB1 D;  5C44 C;  5C3E K;  1TWA C;  2PA8 D;  5IP7 C;  3S16 K;  4OIO A;  1HQM A;  4BXX K;  1I3Q C;  4XLN A;  3S2D C;  4A3K K;  2Y0S D;  2VUM C;  3GTP C;  4QJV A;  4BY7 K;  1I6H C;  5C4J K;  4MQ9 A;  3RZD C;  3HKZ D;  2JA5 C;  4A3M K;  2R92 C;  3HOV C;  4KMU A;  3HOW C;  3PO3 C;  3S2D K;  4A3B K;  4QIW D;  2VUM K;  3M3Y C;  2BE5 A;  4A3L C;  1I6H K;  4XSZ A;  2JA7 K;  3HOZ K;  5TMF A;  3RZD K;  3GTM C;  4Q4Z A;  2JA6 C;  4A3I C;  3HOV K;  3S1N K;  2R92 K;  4XLP A;  3GTO C;  3HOW K;  3PO3 K;  1IW7 A;  2PMZ D;  5IYB C;  1TWC K;  2WAQ D;  3M3Y K;  3H0G C;  3GTG K;  1Y1W K;  2E2H K;  4G7Z A;  4Y7N K;  4A3L K;  4AYB D;  4A3D K;  4Q5S A;  1Y1V C;  3S15 K;  2A68 A;  3RZO C;  2CW0 A;  3GTO K;  3M4O K;  4Y52 C;  4G7H A;  5C4J C;  2E2I C;  3H0G K;  1R9T C;  4KN4 A;  4OIR A;  4LLG A;  4G7O A;  4A3M C;  3I4N K;  3DXJ A;  1K83 C;  1Y1V K;  3RZO K;  4A3B C;  4BBS C;  1I6V A;  4OIQ A;  3H3V D;  4Y52 K;  2JA7 C;  4A3J K;  2E2I K;  3HOZ C;  4LK1 A;  4YFX A;  1R9T K;  3CQZ C;  1YNJ A;  3S1N C;  4YFK A;  4X6A C;  1K83 K;  5C4X C;  4BBS K;  1TWC C;  3GTG C;  1Y1W C;  2E2H C;  4Y7N C;  2NVT K;  4A3D C;  2Y0S L;  3CQZ K;  3S15 C;  4XSX A;  5IP9 C;  3M4O C;  4YFN A;  4X6A K;  5C4X K;  3HOX C;  4A3G C;  3HKZ L;  5IYD C;  3HOY C;  4KN7 A;  3I4N C;  1SMY A;  5FJ8 K;  4A3E C;  2O5I A;  5IP9 K;  5M3M K;  3HOX K;  4A3G K;  4A3J C;  5IYD K;  1I50 C;  3HOY K;  2A6H A;  4LK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...