4Y7NK

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y7nK00
4A3MK 3S1RK 2NVQC 3GTMK 1TWCC 3S14K 3HOZK 5FLMC 2NVTK 2NVQK 4A3GC 2NVTC 5M5XK 5C3EC 4A3DC 1Y1VK 4A3GK 5M5WK 5M3MK 4BY1K 5IYBC 5IP7C 3H0GK 1TWFC 4A3IC 4QJVA 3GTJC 5IP9K 3GTLK 4OINA 3HOUC 3I4MK 3GTJK 3S15K 3S1MK 2BE5A 1WCMK 4Q4ZA 4BBRC 3GTGK 4QIWL 4BBRK 5C44C 2R93C 4KN4A 5IYDK 5C44K 3PO2C 1Y1WC 4X6AK 1SMYA 2YU9K 2R7ZK 2NVYC 5C4XC 2YU9C 2R7ZC 1I6HK 2NVYK 2WB1L 3H3VL 1I6HC 1YNJA 4MQ9A 2PPBA 2O5IA 1K83K 3GTQC 1R9TC 4BXXK 1K83C 3DXJA 3HKZL 4YFNA 4BXXC 3CQZC 3I4NC 3CQZK 3I4NK 4QJVB 4C3HK 4Y52K 2WAQL 1TWCK 2PA8L 4YFKA 3HKZD 3S1RC 4A3BK 4A3BC 1TWGC 3HOYC 1Y1VC 5M3FK 4A3FC 2PMZL 4G7HA 5C3EK 4A3DK 4BY7K 3RZDK 4BY7C 3S17C 1YNNA 1TWFK 2A69A 2PMZD 5M5YK 5IP9C 4A3IK 2VUMC 3I4MC 4LLGA 4KMUA 5IYCC 4MEYA 4AYBL 2Y0SD 3HOWK 3PO2K 3RZOK 4A3LC 3M4OC 5IYDC 3HOWC 4C3JK 2JA7K 4A3LK 4XSZA 2JA7C 1HQMA 2JA6C 2R92C 5C4JC 1TWAC 2B63K 3FKIC 4C2MK 3S2HK 3GTQK 3GTOC 1I6VA 3FKIK 3M3YC 4A93K 3GTOK 4A3EK 2E2IK 4A93C 1SFOC 2JA5K 4G7OA 1I3QK 5TMCA 1TWGK 2WAQD 4JK1A 3GTMC 3S14C 3HOZC 4LJZA 4A3FK 4OIQA 5IP7K 1ZYRA 1IW7A 3S1QK 4LK1A 4BY1C 4BBSK 1I50K 3S17K 3S16K 3S1MC 2A6HA 5IYCK 2JA8C 4G7ZA 3GTGC 3S15C 4KN7A 4Q5SA 3WODA 3S1NK 3HOXK 3PO3C 4X6AC 2JA6K 3S2HC 3M4OK 5C4JK 2E2JC 1Y1WK 4A3CK 2E2HC 2E2JK 3GTPC 4A3CC 2E2HK 2NVXC 4MEXA 2A6EA 3GTPK 4OIOA 4A3EC 2E2IC 3GTKC 4GZYA 4A3KK 4XLNA 4Y52C 4A3KC 4YFXA 4OIRA 2O5JA 1TWHC 4OIPA 5FJ8K 4XLPA 1TWHK 5FLMK 3S2DK 3HOYK 3S1QC 5IYBK 4BBSC 3S2DC 3H0GC 3GTLC 4XSXA 3HOUK 3RZDC 2VUMK 4AYBD 2JA8K 3K7AK 1I50C 1WCMC 3S16C 3K7AC 4C3IK 2R93K 2A68A 3S1NC 3EQLA 3RZOC 3HOXC 4ZH4A 3PO3K 3HOVC 4QIWD 5D4DA 3HOVK 5C4XK 1TWAK 2WB1D 5TMFA 2NVXK 3H3VD 4YG2A 3M3YK 2Y0SL 2R92K 3GTKK 4LK0A 4Y7NC 4A3JC 2B63C 1R9TK 1BDFA 1XPPA 4Y7NK 4A3JK 4NOIA 2JA5C 2CW0A 1I3QC 2PA8D 4A3MC 1SFOK
chains in the Genus database with same CATH superfamily
3S1RK 3HOZK 1XZPA 1ISEA 3GEEA 1Y1VK 5M3MK 4P5AA 5IP7C 3H0GK 1O24A 4GTLA 1J6WA 5IP9K 5JFEA 3S15K 2GSUA 4C3IC 3AD7C 2GSNA 2JA6A 3GTGK 2FQOA 4QIWL 4BBRK 3FKIA 1B4AA 1BGWA 1O25A 1SMYA 2NVYC 1I50A 1IQ0A 2NVYK 2WB1L 3H3VL 1YNJA 2O5IA 1K83K 3DXJA 5IOTA 4FZBA 1WQFA 1TWCK 3SZYA 2CFAB 2ZUFA 1WSVA 3HOYC 2PMZL 4G7HA 4A3DK 1O28A 4BY7K 5EGHA 1WSRA 3GSIA 4BLAA 2D6FC 4BY7C 3T02A 1GE9A 2A69A 5L46A 2ZUEA 2RGRA 2JA7A 4MEYA 1HI9A 2Y0SD 3PO2K 3RZOK 4A3LC 5IYDC 1WQHA 4XSZA 2JA6C 3S2HK 1AB4A 1UV7A 3M3YC 4AH6A 3AD8C 3GTOK 4A3EK 1KQ4A 3T00A 3GEIA 1SFOC 3GTJA 2JA5K 3GEHA 4G7OA 3GTLA 2ZFZA 3AQPA 3GTMC 5IP7K 2PHCB 1ZYRA 1IW7A 4XCHA 1X31C 3S1QK 4KASA 3S17K 3S16K 3GTGC 3N3YA 1F9NA 3M4OK 2E2HC 3GTPC 3GTPK 4GFQA 3GTKC 2XCQA 1VGXA 5HL8A 4GTDA 1PJ7A 4OIRA 3GTMA 1IS1A 5FLMK 5EGEA 3RZDC 2NVXA 1I50C 3LAPA 4KATA 4C3IK 2A68A 3N0BA 3RZOC 5D4DA 2V6TA 2P8TA 3M3YK 3NUHA 4NOIA 1I3QC 4A93K 2V6SA 1TWCC 4PABA 2NVTK 1G51A 5M5XK 5C3EC 2FQTA 3Q3QA 5IYBC 3A8KA 3OREA 1TWFC 3GTLK 3GTJC 3HOUC 3I4MK 1Y1WA 3GTJK 2JH3A 3S1MK 4Q4ZA 3GTOA 2R93C 1V5VA 3IPJA 5IYDK 3PO2C 1Y1WC 4X6AK 2YU9C 2PPBA 2XCRB 4BXXK 1R9TC 1O2AA 4BXXC 4YFNA 3I4NC 3CQZK 4KARA 4Y52K 2PA8L 3GDZA 4GTFA 3HKZD 3S1RC 4A3BK 4A3BC 1I3QA 1TWGC 1Y1VC 4KDDA 3FOFA 2E2IA 4A3MC 3RZDK 1DCPA 1TWCA 1F7VA 3S17C 1F93A 2KWAA 4A3IK 2VUMC 3BP3A 5JVOA 4LLGA 5IYCC 2GAHC 1K83A 4O2DA 3AH5A 2NVYA 3HOWK 3JSTA 1EI6A 4C3JK 3HOWC 4C3JC 1HQMA 2R92C 5C4JC 1TWAC 2B63K 3FKIK 1EFWA 1F7UA 3GTGA 4A93C 4WILA 3H0GA 5TMCA 3S14C 1Y1VA 3HOZC 4LJZA 4BKWA 3A8JA 2W7VA 4DDQA 5IOQA 4A3FK 4LOWA 4KM9A 4BBSK 5CJ9A 3GTKA 4X6AC 1TWAA 3OPFA 2E2JC 3ADAC 2NVXC 4A3EC 3BUEA 4A3KK 4XLNA 1O2FB 4A3KC 4KMHA 1TWHC 4XLPA 4KMAA 3S2DK 1BS2A 1WIHA 1R9TA 1VLOA 1EQRA 3HOUK 2VUMK 3HXAA 3S16C 3EQLA 1WOSA 1YX2A 5TJ3A 5C4XK 4KB4A 1USMA 2WB1D 5TMFA 3H3VD 4YG2A 1R9TK 1XPPA 4A3JK 4G0WA 2PA8D 2GSOA 4A3MK 3SZZA 4C3HC 1IE0A 3MMLB 3S14K 5FLMC 3OEPA 4A3GC 1USOA 4A3GK 5M5WK 3VA7A 4A3IC 4QJVA 4OINA 2BE5A 1WCMK 4BBRC 4KN4A 1WOPA 2R7ZK 2R7ZC 1I6HK 3LPXA 1I6HC 4MQ9A 4RMFA 1K83C 3AQOA 4FM9A 4LR2A 3ERED 4A3FC 1YCLA 5C3EK 2B63A 3L4KA 1TWFK 2PMZD 3I4MC 3BP8C 2XCOA 4AYBL 3CAGA 4P5BA 2YU9A 3V4GA 4A3LK 4C2MK 1EK8A 1ZBSA 3G4AA 3GTOC 3GTQK 4C2MC 1WORA 3AD9C 2E2IK 1I3QK 4BLBA 1TWGK 2WAQD 4JK1A 3CQZA 4PAAA 2EBBA 3TFHA 1VJEA 4BY1C 2A6HA 3S0XA 5IYCK 4G7ZA 1WQGA 4LQYA 3WODA 3S1NK 2R92A 1IL2A 3HOXK 1J98A 5C4JK 3TTGA 1Y1WK 4A3CK 4A3CC 2E2HK 4OIOA 4KB2A 3QX3A 4G0UA 4YFXA 4KM8A 2O5JA 1PJ6A 1JOEA 3LAJA 4BBSC 3H0GC 1EH1A 1XZQB 4XSXA 2JA8K 1WCMC 4KC6A 1WOOA 1VH2A 4GTBA 3PO3K 4ZH4A 2E2HA 5IORA 3T01A 3FOEA 2NVXK 3L4JA 2R92K 4LK0A 4Y7NC 2B63C 4ILDA 4Y7NK 2JA5C 2CW0A 2NVQK 2NVQC 3GTMK 1XXBA 2GAGC 2NVTC 4A3DC 1TWGA 1ZXOA 1INNA 4BY1K 4WJ4A 3GTPA 1DCHA 1BJTA 4GTAA 5C44C 1IBAA 3GTQA 5C44K 2YU9K 1XZPB 5C4XC 3GTQC 1O2BA 3HKZL 3CQZC 1TWFA 3I4NK 4QJVB 4C3HK 2WAQL 4YFKA 2RH6A 1B4BA 4KMDA 2JA5A 5M3FK 1C0AA 4WJ3M 1XXAA 1YNNA 5M5YK 5IP9C 3TFIA 4KMUA 2P5MA 1JVIA 1ZVUA 3M4OC 2JA7K 2R7ZA 2JA7C 4P9SA 3FKIC 3N0CA 1I6VA 1WCMA 4C45A 1XZQA 1DD5A 5CHPA 4OIQA 4G0VA 2CFAA 4LK1A 5IOSA 3G4CA 4GT9A 1I50K 1ZQ1C 3S1MC 1J6XA 4J3NA 1XXCA 1PJ5A 5E68A 3FHZA 2JA8C 3S15C 4KN7A 4Q5SA 3TFJA 3PO3C 2JA6K 3S2HC 2E2JK 4MEXA 2A6EA 2E2IC 4GZYA 4KAWX 1O26A 4M1XA 3A8IA 4Y52C 1JQWA 2VUMA 1RU0A 1L0WA 5FJ8K 4OIPA 4GTCA 1SFOA 1TWHK 3HOYK 3S1QC 5IYBK 3S2DC 3GTLC 3GIRA 4GTEA 4AYBD 3K7AK 1J6VA 3K7AC 2R93K 3S1NC 1DCOA 1VRQC 3HOXC 2Y3PA 3HOVC 2R93A 4QIWD 3HOVK 1TWAK 1O27A 2Y0SL 3GTKK 1O29A 2V6UA 4A3JC 1BDFA 1TWHA 1SFOK
chains in the Genus database with same CATH topology
4A3MK 3S1RK 2NVQC 3GTMK 1TWCC 3S14K 3HOZK 5FLMC 2NVTK 2NVQK 4A3GC 2NVTC 5M5XK 5C3EC 4A3DC 1Y1VK 4A3GK 5M5WK 5M3MK 4BY1K 5IYBC 5IP7C 3H0GK 1TWFC 4A3IC 4QJVA 3GTJC 5IP9K 3GTLK 4OINA 3HOUC 3I4MK 3GTJK 3S15K 3S1MK 2BE5A 1WCMK 4Q4ZA 4BBRC 3GTGK 4QIWL 4BBRK 5C44C 2R93C 4KN4A 5IYDK 5C44K 3PO2C 1Y1WC 4X6AK 1SMYA 2YU9K 2R7ZK 2NVYC 5C4XC 2YU9C 2R7ZC 1I6HK 2NVYK 2WB1L 3H3VL 1I6HC 1YNJA 4MQ9A 2PPBA 2O5IA 1K83K 3GTQC 1R9TC 4BXXK 1K83C 3DXJA 3HKZL 4YFNA 4BXXC 3CQZC 3I4NC 3CQZK 3I4NK 4QJVB 4C3HK 4Y52K 2WAQL 1TWCK 2PA8L 4YFKA 3HKZD 3S1RC 4A3BK 4A3BC 1TWGC 3HOYC 1Y1VC 5M3FK 4A3FC 2PMZL 4G7HA 5C3EK 4A3DK 4BY7K 3RZDK 4BY7C 3S17C 1YNNA 1TWFK 2A69A 2PMZD 5M5YK 5IP9C 4A3IK 2VUMC 3I4MC 4LLGA 4KMUA 5IYCC 4MEYA 4AYBL 2Y0SD 3HOWK 3PO2K 3RZOK 4A3LC 3M4OC 5IYDC 3HOWC 4C3JK 2JA7K 4A3LK 4XSZA 2JA7C 1HQMA 2JA6C 2R92C 5C4JC 1TWAC 2B63K 3FKIC 4C2MK 3S2HK 3GTQK 3GTOC 1I6VA 3FKIK 3M3YC 4A93K 3GTOK 4A3EK 2E2IK 4A93C 1SFOC 2JA5K 4G7OA 1I3QK 5TMCA 1TWGK 2WAQD 4JK1A 3GTMC 3S14C 3HOZC 4LJZA 4A3FK 4OIQA 5IP7K 1ZYRA 1IW7A 3S1QK 4LK1A 4BY1C 4BBSK 1I50K 3S17K 3S16K 3S1MC 2A6HA 5IYCK 2JA8C 4G7ZA 3GTGC 3S15C 4KN7A 4Q5SA 3WODA 3S1NK 3HOXK 3PO3C 4X6AC 2JA6K 3S2HC 3M4OK 5C4JK 2E2JC 1Y1WK 4A3CK 2E2HC 2E2JK 3GTPC 4A3CC 2E2HK 2NVXC 4MEXA 2A6EA 3GTPK 4OIOA 4A3EC 2E2IC 3GTKC 4GZYA 4A3KK 4XLNA 4Y52C 4A3KC 4YFXA 4OIRA 2O5JA 1TWHC 4OIPA 5FJ8K 4XLPA 1TWHK 5FLMK 3S2DK 3HOYK 3S1QC 5IYBK 4BBSC 3S2DC 3H0GC 3GTLC 4XSXA 3HOUK 3RZDC 2VUMK 4AYBD 2JA8K 3K7AK 1I50C 1WCMC 3S16C 3K7AC 4C3IK 2R93K 2A68A 3S1NC 3EQLA 3RZOC 3HOXC 4ZH4A 3PO3K 3HOVC 4QIWD 5D4DA 3HOVK 5C4XK 1TWAK 2WB1D 5TMFA 2NVXK 3H3VD 4YG2A 3M3YK 2Y0SL 2R92K 3GTKK 4LK0A 4Y7NC 4A3JC 2B63C 1R9TK 1BDFA 1XPPA 4Y7NK 4A3JK 4NOIA 2JA5C 2CW0A 1I3QC 2PA8D 4A3MC 1SFOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M K;  3S1R K;  2NVQ C;  3GTM K;  1TWC C;  3S14 K;  3HOZ K;  5FLM C;  2NVT K;  2NVQ K;  4A3G C;  2NVT C;  5M5X K;  5C3E C;  4A3D C;  1Y1V K;  4A3G K;  5M5W K;  5M3M K;  4BY1 K;  5IYB C;  5IP7 C;  3H0G K;  1TWF C;  4A3I C;  4QJV A;  3GTJ C;  5IP9 K;  3GTL K;  4OIN A;  3HOU C;  3I4M K;  3GTJ K;  3S15 K;  3S1M K;  2BE5 A;  1WCM K;  4Q4Z A;  4BBR C;  3GTG K;  4QIW L;  4BBR K;  5C44 C;  2R93 C;  4KN4 A;  5IYD K;  5C44 K;  3PO2 C;  1Y1W C;  4X6A K;  1SMY A;  2YU9 K;  2R7Z K;  2NVY C;  5C4X C;  2YU9 C;  2R7Z C;  1I6H K;  2NVY K;  2WB1 L;  3H3V L;  1I6H C;  1YNJ A;  4MQ9 A;  2PPB A;  2O5I A;  1K83 K;  3GTQ C;  1R9T C;  4BXX K;  1K83 C;  3DXJ A;  3HKZ L;  4YFN A;  4BXX C;  3CQZ C;  3I4N C;  3CQZ K;  3I4N K;  4QJV B;  4C3H K;  4Y52 K;  2WAQ L;  1TWC K;  2PA8 L;  4YFK A;  3HKZ D;  3S1R C;  4A3B K;  4A3B C;  1TWG C;  3HOY C;  1Y1V C;  5M3F K;  4A3F C;  2PMZ L;  4G7H A;  5C3E K;  4A3D K;  4BY7 K;  3RZD K;  4BY7 C;  3S17 C;  1YNN A;  1TWF K;  2A69 A;  2PMZ D;  5M5Y K;  5IP9 C;  4A3I K;  2VUM C;  3I4M C;  4LLG A;  4KMU A;  5IYC C;  4MEY A;  4AYB L;  2Y0S D;  3HOW K;  3PO2 K;  3RZO K;  4A3L C;  3M4O C;  5IYD C;  3HOW C;  4C3J K;  2JA7 K;  4A3L K;  4XSZ A;  2JA7 C;  1HQM A;  2JA6 C;  2R92 C;  5C4J C;  1TWA C;  2B63 K;  3FKI C;  4C2M K;  3S2H K;  3GTQ K;  3GTO C;  1I6V A;  3FKI K;  3M3Y C;  4A93 K;  3GTO K;  4A3E K;  2E2I K;  4A93 C;  1SFO C;  2JA5 K;  4G7O A;  1I3Q K;  5TMC A;  1TWG K;  2WAQ D;  4JK1 A;  3GTM C;  3S14 C;  3HOZ C;  4LJZ A;  4A3F K;  4OIQ A;  5IP7 K;  1ZYR A;  1IW7 A;  3S1Q K;  4LK1 A;  4BY1 C;  4BBS K;  1I50 K;  3S17 K;  3S16 K;  3S1M C;  2A6H A;  5IYC K;  2JA8 C;  4G7Z A;  3GTG C;  3S15 C;  4KN7 A;  4Q5S A;  3WOD A;  3S1N K;  3HOX K;  3PO3 C;  4X6A C;  2JA6 K;  3S2H C;  3M4O K;  5C4J K;  2E2J C;  1Y1W K;  4A3C K;  2E2H C;  2E2J K;  3GTP C;  4A3C C;  2E2H K;  2NVX C;  4MEX A;  2A6E A;  3GTP K;  4OIO A;  4A3E C;  2E2I C;  3GTK C;  4GZY A;  4A3K K;  4XLN A;  4Y52 C;  4A3K C;  4YFX A;  4OIR A;  2O5J A;  1TWH C;  4OIP A;  5FJ8 K;  4XLP A;  1TWH K;  5FLM K;  3S2D K;  3HOY K;  3S1Q C;  5IYB K;  4BBS C;  3S2D C;  3H0G C;  3GTL C;  4XSX A;  3HOU K;  3RZD C;  2VUM K;  4AYB D;  2JA8 K;  3K7A K;  1I50 C;  1WCM C;  3S16 C;  3K7A C;  4C3I K;  2R93 K;  2A68 A;  3S1N C;  3EQL A;  3RZO C;  3HOX C;  4ZH4 A;  3PO3 K;  3HOV C;  4QIW D;  5D4D A;  3HOV K;  5C4X K;  1TWA K;  2WB1 D;  5TMF A;  2NVX K;  3H3V D;  4YG2 A;  3M3Y K;  2Y0S L;  2R92 K;  3GTK K;  4LK0 A;  4Y7N C;  4A3J C;  2B63 C;  1R9T K;  1BDF A;  1XPP A;  4Y7N K;  4A3J K;  4NOI A;  2JA5 C;  2CW0 A;  1I3Q C;  2PA8 D;  4A3M C;  1SFO K; 
#chains in the Genus database with same CATH topology
 3S1R K;  3HOZ K;  1XZP A;  1ISE A;  3GEE A;  1Y1V K;  5M3M K;  4P5A A;  5IP7 C;  3H0G K;  1O24 A;  4GTL A;  1J6W A;  5IP9 K;  5JFE A;  3S15 K;  2GSU A;  4C3I C;  3AD7 C;  2GSN A;  2JA6 A;  3GTG K;  2FQO A;  4QIW L;  4BBR K;  3FKI A;  1B4A A;  1BGW A;  1O25 A;  1SMY A;  2NVY C;  1I50 A;  1IQ0 A;  2NVY K;  2WB1 L;  3H3V L;  1YNJ A;  2O5I A;  1K83 K;  3DXJ A;  5IOT A;  4FZB A;  1WQF A;  1TWC K;  3SZY A;  2CFA B;  2ZUF A;  1WSV A;  3HOY C;  2PMZ L;  4G7H A;  4A3D K;  1O28 A;  4BY7 K;  5EGH A;  1WSR A;  3GSI A;  4BLA A;  2D6F C;  4BY7 C;  3T02 A;  1GE9 A;  2A69 A;  5L46 A;  2ZUE A;  2RGR A;  2JA7 A;  4MEY A;  1HI9 A;  2Y0S D;  3PO2 K;  3RZO K;  4A3L C;  5IYD C;  1WQH A;  4XSZ A;  2JA6 C;  3S2H K;  1AB4 A;  1UV7 A;  3M3Y C;  4AH6 A;  3AD8 C;  3GTO K;  4A3E K;  1KQ4 A;  3T00 A;  3GEI A;  1SFO C;  3GTJ A;  2JA5 K;  3GEH A;  4G7O A;  3GTL A;  2ZFZ A;  3AQP A;  3GTM C;  5IP7 K;  2PHC B;  1ZYR A;  1IW7 A;  4XCH A;  1X31 C;  3S1Q K;  4KAS A;  3S17 K;  3S16 K;  3GTG C;  3N3Y A;  1F9N A;  3M4O K;  2E2H C;  3GTP C;  3GTP K;  4GFQ A;  3GTK C;  2XCQ A;  1VGX A;  5HL8 A;  4GTD A;  1PJ7 A;  4OIR A;  3GTM A;  1IS1 A;  5FLM K;  5EGE A;  3RZD C;  2NVX A;  1I50 C;  3LAP A;  4KAT A;  4C3I K;  2A68 A;  3N0B A;  3RZO C;  5D4D A;  2V6T A;  2P8T A;  3M3Y K;  3NUH A;  4NOI A;  1I3Q C;  4A93 K;  2V6S A;  1TWC C;  4PAB A;  2NVT K;  1G51 A;  5M5X K;  5C3E C;  2FQT A;  3Q3Q A;  5IYB C;  3A8K A;  3ORE A;  1TWF C;  3GTL K;  3GTJ C;  3HOU C;  3I4M K;  1Y1W A;  3GTJ K;  2JH3 A;  3S1M K;  4Q4Z A;  3GTO A;  2R93 C;  1V5V A;  3IPJ A;  5IYD K;  3PO2 C;  1Y1W C;  4X6A K;  2YU9 C;  2PPB A;  2XCR B;  4BXX K;  1R9T C;  1O2A A;  4BXX C;  4YFN A;  3I4N C;  3CQZ K;  4KAR A;  4Y52 K;  2PA8 L;  3GDZ A;  4GTF A;  3HKZ D;  3S1R C;  4A3B K;  4A3B C;  1I3Q A;  1TWG C;  1Y1V C;  4KDD A;  3FOF A;  2E2I A;  4A3M C;  3RZD K;  1DCP A;  1TWC A;  1F7V A;  3S17 C;  1F93 A;  2KWA A;  4A3I K;  2VUM C;  3BP3 A;  5JVO A;  4LLG A;  5IYC C;  2GAH C;  1K83 A;  4O2D A;  3AH5 A;  2NVY A;  3HOW K;  3JST A;  1EI6 A;  4C3J K;  3HOW C;  4C3J C;  1HQM A;  2R92 C;  5C4J C;  1TWA C;  2B63 K;  3FKI K;  1EFW A;  1F7U A;  3GTG A;  4A93 C;  4WIL A;  3H0G A;  5TMC A;  3S14 C;  1Y1V A;  3HOZ C;  4LJZ A;  4BKW A;  3A8J A;  2W7V A;  4DDQ A;  5IOQ A;  4A3F K;  4LOW A;  4KM9 A;  4BBS K;  5CJ9 A;  3GTK A;  4X6A C;  1TWA A;  3OPF A;  2E2J C;  3ADA C;  2NVX C;  4A3E C;  3BUE A;  4A3K K;  4XLN A;  1O2F B;  4A3K C;  4KMH A;  1TWH C;  4XLP A;  4KMA A;  3S2D K;  1BS2 A;  1WIH A;  1R9T A;  1VLO A;  1EQR A;  3HOU K;  2VUM K;  3HXA A;  3S16 C;  3EQL A;  1WOS A;  1YX2 A;  5TJ3 A;  5C4X K;  4KB4 A;  1USM A;  2WB1 D;  5TMF A;  3H3V D;  4YG2 A;  1R9T K;  1XPP A;  4A3J K;  4G0W A;  2PA8 D;  2GSO A;  4A3M K;  3SZZ A;  4C3H C;  1IE0 A;  3MML B;  3S14 K;  5FLM C;  3OEP A;  4A3G C;  1USO A;  4A3G K;  5M5W K;  3VA7 A;  4A3I C;  4QJV A;  4OIN A;  2BE5 A;  1WCM K;  4BBR C;  4KN4 A;  1WOP A;  2R7Z K;  2R7Z C;  1I6H K;  3LPX A;  1I6H C;  4MQ9 A;  4RMF A;  1K83 C;  3AQO A;  4FM9 A;  4LR2 A;  3ERE D;  4A3F C;  1YCL A;  5C3E K;  2B63 A;  3L4K A;  1TWF K;  2PMZ D;  3I4M C;  3BP8 C;  2XCO A;  4AYB L;  3CAG A;  4P5B A;  2YU9 A;  3V4G A;  4A3L K;  4C2M K;  1EK8 A;  1ZBS A;  3G4A A;  3GTO C;  3GTQ K;  4C2M C;  1WOR A;  3AD9 C;  2E2I K;  1I3Q K;  4BLB A;  1TWG K;  2WAQ D;  4JK1 A;  3CQZ A;  4PAA A;  2EBB A;  3TFH A;  1VJE A;  4BY1 C;  2A6H A;  3S0X A;  5IYC K;  4G7Z A;  1WQG A;  4LQY A;  3WOD A;  3S1N K;  2R92 A;  1IL2 A;  3HOX K;  1J98 A;  5C4J K;  3TTG A;  1Y1W K;  4A3C K;  4A3C C;  2E2H K;  4OIO A;  4KB2 A;  3QX3 A;  4G0U A;  4YFX A;  4KM8 A;  2O5J A;  1PJ6 A;  1JOE A;  3LAJ A;  4BBS C;  3H0G C;  1EH1 A;  1XZQ B;  4XSX A;  2JA8 K;  1WCM C;  4KC6 A;  1WOO A;  1VH2 A;  4GTB A;  3PO3 K;  4ZH4 A;  2E2H A;  5IOR A;  3T01 A;  3FOE A;  2NVX K;  3L4J A;  2R92 K;  4LK0 A;  4Y7N C;  2B63 C;  4ILD A;  4Y7N K;  2JA5 C;  2CW0 A;  2NVQ K;  2NVQ C;  3GTM K;  1XXB A;  2GAG C;  2NVT C;  4A3D C;  1TWG A;  1ZXO A;  1INN A;  4BY1 K;  4WJ4 A;  3GTP A;  1DCH A;  1BJT A;  4GTA A;  5C44 C;  1IBA A;  3GTQ A;  5C44 K;  2YU9 K;  1XZP B;  5C4X C;  3GTQ C;  1O2B A;  3HKZ L;  3CQZ C;  1TWF A;  3I4N K;  4QJV B;  4C3H K;  2WAQ L;  4YFK A;  2RH6 A;  1B4B A;  4KMD A;  2JA5 A;  5M3F K;  1C0A A;  4WJ3 M;  1XXA A;  1YNN A;  5M5Y K;  5IP9 C;  3TFI A;  4KMU A;  2P5M A;  1JVI A;  1ZVU A;  3M4O C;  2JA7 K;  2R7Z A;  2JA7 C;  4P9S A;  3FKI C;  3N0C A;  1I6V A;  1WCM A;  4C45 A;  1XZQ A;  1DD5 A;  5CHP A;  4OIQ A;  4G0V A;  2CFA A;  4LK1 A;  5IOS A;  3G4C A;  4GT9 A;  1I50 K;  1ZQ1 C;  3S1M C;  1J6X A;  4J3N A;  1XXC A;  1PJ5 A;  5E68 A;  3FHZ A;  2JA8 C;  3S15 C;  4KN7 A;  4Q5S A;  3TFJ A;  3PO3 C;  2JA6 K;  3S2H C;  2E2J K;  4MEX A;  2A6E A;  2E2I C;  4GZY A;  4KAW X;  1O26 A;  4M1X A;  3A8I A;  4Y52 C;  1JQW A;  2VUM A;  1RU0 A;  1L0W A;  5FJ8 K;  4OIP A;  4GTC A;  1SFO A;  1TWH K;  3HOY K;  3S1Q C;  5IYB K;  3S2D C;  3GTL C;  3GIR A;  4GTE A;  4AYB D;  3K7A K;  1J6V A;  3K7A C;  2R93 K;  3S1N C;  1DCO A;  1VRQ C;  3HOX C;  2Y3P A;  3HOV C;  2R93 A;  4QIW D;  3HOV K;  1TWA K;  1O27 A;  2Y0S L;  3GTK K;  1O29 A;  2V6U A;  4A3J C;  1BDF A;  1TWH A;  1SFO K; 
#chains in the Genus database with same CATH homology
 4A3M K;  3S1R K;  2NVQ C;  3GTM K;  1TWC C;  3S14 K;  3HOZ K;  5FLM C;  2NVT K;  2NVQ K;  4A3G C;  2NVT C;  5M5X K;  5C3E C;  4A3D C;  1Y1V K;  4A3G K;  5M5W K;  5M3M K;  4BY1 K;  5IYB C;  5IP7 C;  3H0G K;  1TWF C;  4A3I C;  4QJV A;  3GTJ C;  5IP9 K;  3GTL K;  4OIN A;  3HOU C;  3I4M K;  3GTJ K;  3S15 K;  3S1M K;  2BE5 A;  1WCM K;  4Q4Z A;  4BBR C;  3GTG K;  4QIW L;  4BBR K;  5C44 C;  2R93 C;  4KN4 A;  5IYD K;  5C44 K;  3PO2 C;  1Y1W C;  4X6A K;  1SMY A;  2YU9 K;  2R7Z K;  2NVY C;  5C4X C;  2YU9 C;  2R7Z C;  1I6H K;  2NVY K;  2WB1 L;  3H3V L;  1I6H C;  1YNJ A;  4MQ9 A;  2PPB A;  2O5I A;  1K83 K;  3GTQ C;  1R9T C;  4BXX K;  1K83 C;  3DXJ A;  3HKZ L;  4YFN A;  4BXX C;  3CQZ C;  3I4N C;  3CQZ K;  3I4N K;  4QJV B;  4C3H K;  4Y52 K;  2WAQ L;  1TWC K;  2PA8 L;  4YFK A;  3HKZ D;  3S1R C;  4A3B K;  4A3B C;  1TWG C;  3HOY C;  1Y1V C;  5M3F K;  4A3F C;  2PMZ L;  4G7H A;  5C3E K;  4A3D K;  4BY7 K;  3RZD K;  4BY7 C;  3S17 C;  1YNN A;  1TWF K;  2A69 A;  2PMZ D;  5M5Y K;  5IP9 C;  4A3I K;  2VUM C;  3I4M C;  4LLG A;  4KMU A;  5IYC C;  4MEY A;  4AYB L;  2Y0S D;  3HOW K;  3PO2 K;  3RZO K;  4A3L C;  3M4O C;  5IYD C;  3HOW C;  4C3J K;  2JA7 K;  4A3L K;  4XSZ A;  2JA7 C;  1HQM A;  2JA6 C;  2R92 C;  5C4J C;  1TWA C;  2B63 K;  3FKI C;  4C2M K;  3S2H K;  3GTQ K;  3GTO C;  1I6V A;  3FKI K;  3M3Y C;  4A93 K;  3GTO K;  4A3E K;  2E2I K;  4A93 C;  1SFO C;  2JA5 K;  4G7O A;  1I3Q K;  5TMC A;  1TWG K;  2WAQ D;  4JK1 A;  3GTM C;  3S14 C;  3HOZ C;  4LJZ A;  4A3F K;  4OIQ A;  5IP7 K;  1ZYR A;  1IW7 A;  3S1Q K;  4LK1 A;  4BY1 C;  4BBS K;  1I50 K;  3S17 K;  3S16 K;  3S1M C;  2A6H A;  5IYC K;  2JA8 C;  4G7Z A;  3GTG C;  3S15 C;  4KN7 A;  4Q5S A;  3WOD A;  3S1N K;  3HOX K;  3PO3 C;  4X6A C;  2JA6 K;  3S2H C;  3M4O K;  5C4J K;  2E2J C;  1Y1W K;  4A3C K;  2E2H C;  2E2J K;  3GTP C;  4A3C C;  2E2H K;  2NVX C;  4MEX A;  2A6E A;  3GTP K;  4OIO A;  4A3E C;  2E2I C;  3GTK C;  4GZY A;  4A3K K;  4XLN A;  4Y52 C;  4A3K C;  4YFX A;  4OIR A;  2O5J A;  1TWH C;  4OIP A;  5FJ8 K;  4XLP A;  1TWH K;  5FLM K;  3S2D K;  3HOY K;  3S1Q C;  5IYB K;  4BBS C;  3S2D C;  3H0G C;  3GTL C;  4XSX A;  3HOU K;  3RZD C;  2VUM K;  4AYB D;  2JA8 K;  3K7A K;  1I50 C;  1WCM C;  3S16 C;  3K7A C;  4C3I K;  2R93 K;  2A68 A;  3S1N C;  3EQL A;  3RZO C;  3HOX C;  4ZH4 A;  3PO3 K;  3HOV C;  4QIW D;  5D4D A;  3HOV K;  5C4X K;  1TWA K;  2WB1 D;  5TMF A;  2NVX K;  3H3V D;  4YG2 A;  3M3Y K;  2Y0S L;  2R92 K;  3GTK K;  4LK0 A;  4Y7N C;  4A3J C;  2B63 C;  1R9T K;  1BDF A;  1XPP A;  4Y7N K;  4A3J K;  4NOI A;  2JA5 C;  2CW0 A;  1I3Q C;  2PA8 D;  4A3M C;  1SFO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...