4Y7NK

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y7nK00
3HOZC 1K83K 1TWGK 4C3IK 5TMFA 2Y0SL 4KN4A 5IYCK 4Q5SA 2WAQL 3HOYK 5IP7C 4MQ9A 3H3VD 4G7ZA 3M4OK 4A3GK 4XSXA 4YG2A 1WCMC 4Y7NK 4A3MC 2B63C 3HOVC 4BXXK 4A3IK 2E2IC 1I6HC 4QIWD 4A3KC 5C4XC 2E2HK 4BBSK 3HOUC 4A3LC 4BY7K 4A3EK 1TWCC 1Y1WK 4A3DC 4KN7A 2JA5C 2R92C 3PO3K 4NOIA 3S1NK 2R93K 5C3EK 2JA7C 1TWAK 3S1QK 2JA6K 3I4NK 3K7AK 3S16K 3GTJK 2NVYK 3CQZK 2WB1D 2E2JC 3GTPK 4XLNA 4BBRK 5C4JK 4QJVB 4ZH4A 1SFOK 2NVQK 1I3QC 3GTMK 2PMZD 1Y1VC 4OIOA 4BY1K 3S15K 3S2HC 4A3BK 4A93C 2NVXK 2O5JA 4AYBL 4XLPA 3S1RC 5IYDK 4Y52K 2WAQD 4MEXA 3RZDK 3HOWK 4LLGA 2NVTC 5IYCC 3GTGK 1TWHC 5IP9K 3PO2C 4YFXA 1R9TC 2JA8K 3M3YK 3RZOK 2PA8L 3S14C 3S17C 3GTQK 3HKZL 1XPPA 1TWFK 3HOZK 3M4OC 3EQLA 3GTKC 5IYBK 4OIPA 4YFKA 5FLMK 4Y7NC 4KMUA 4BXXC 4A3FC 1ZYRA 3H0GC 4BY7C 3S1MK 3GTOC 3S2DK 3H3VL 4A3JC 1WCMK 4QJVA 4A3MK 2B63K 4C3HK 5C44K 2VUMC 3S1NC 1I6HK 5C3EC 2A6HA 3GTLK 3HOUK 4A3LK 1I50C 1TWAC 2CW0A 3I4MC 1TWCK 2A69A 4C2MK 2JA5K 4QIWL 2R92K 3I4NC 2Y0SD 5M5WK 4X6AC 3FKIC 4BBSC 4OIRA 3GTPC 4BBRC 2JA7K 1HQMA 1K83C 1TWGC 2NVQC 4A3CK 5M5YK 4A3BC 1SMYA 4MEYA 3HOYC 2E2JK 1YNNA 4OINA 3HOXK 2R7ZK 2YU9K 4A3GC 1Y1VK 2WB1L 3HKZD 2A68A 3S2HK 4A93K 1YNJA 5IP9C 5IP7K 2O5IA 4GZYA 2JA8C 4A3IC 2PMZL 2E2HC 1TWFC 5D4DA 2NVTK 4A3EC 4LJZA 5IYBC 1TWHK 1Y1WC 3HOVK 5FLMC 3PO2K 1R9TK 3PO3C 3S14K 2E2IK 4A3KK 3S17K 5C4XK 2R93C 3DXJA 4LK0A 4JK1A 4YFNA 3WODA 3GTKK 3S1QC 3S1MC 2JA6C 4A3DK 3S2DC 3K7AC 3S16C 3GTJC 2NVYC 3CQZC 5FJ8K 4G7OA 4C3JK 5C44C 5C4JC 5TMCA 1SFOC 4A3FK 3GTLC 3H0GK 4AYBD 5M3MK 3GTMC 4BY1C 3GTOK 4G7HA 3S15C 4A3JK 4OIQA 4XSZA 5M3FK 2NVXC 2VUMK 5IYDC 4Y52C 2A6EA 3HOWC 3RZDC 1I3QK 1I50K 2PA8D 4A3CC 4Q4ZA 3I4MK 2PPBA 3GTGC 1BDFA 4LK1A 4X6AK 5M5XK 1I6VA 3FKIK 1IW7A 3S1RK 3M3YC 3RZOC 2BE5A 3HOXC 3GTQC 2R7ZC 2YU9C
chains in the Genus database with same CATH superfamily
1K83K 5TMFA 4GTEA 3L4KA 4KAWX 1RU0A 3H3VD 4G7ZA 1JVIA 4C3HC 4A3EK 4GTAA 2B63A 1DCOA 4KN7A 3PO3K 1WQGA 4GTCA 2R93K 5C3EK 3OEPA 2JA7C 2JA5A 2JA6K 1EK8A 1V5VA 2E2JC 4XLNA 2XCQA 2NVQK 1I3QC 4DDQA 3GTMK 2PMZD 4BY1K 3S2HC 4A93C 3SZZA 1WORA 1G51A 4XCHA 2NVTC 1IS1A 1TWHC 1R9TC 2JA8K 3GTQK 1EI6A 1ZQ1C 1XPPA 1TWFK 5E68A 3EQLA 4KMAA 5IOQA 5FLMK 4G0VA 4KMUA 4KB4A 3GTKA 4BLAA 3GTOC 3H3VL 2JA7A 2VUMC 1O2AA 4WJ3M 1F93A 3H0GA 5C3EC 3GTLK 1I50C 3I4MC 3FHZA 1WSVA 2Y0SD 3BP3A 4BBSC 3T00A 1I3QA 1PJ6A 2NVQC 1SMYA 3GEHA 3HOYC 1YNNA 1K83A 3HXAA 2JA8C 2PMZL 1TWFC 5D4DA 3HOVK 2ZFZA 5FLMC 4A3KK 3S17K 4FZBA 3NUHA 1VRQC 4YFNA 3AD9C 5JFEA 2R93A 3CQZC 1X31C 2W7VA 4C3JK 1SFOC 4A3FK 3LAJA 3GTLC 2JA6A 4AYBD 3S15C 1F9NA 3GSIA 2NVXC 5IYDC 3T01A 5IORA 3GTMA 3N0CA 2CFAA 4KMHA 4O2DA 1XXBA 2GAGC 4X6AK 3RZOC 3S1RK 2RGRA 3HOZC 2Y0SL 2WAQL 3GDZA 1O25A 3GTQA 1TWFA 4A3GK 4XSXA 4WJ4A 3HOVC 2B63C 3AQOA 4A3IK 1I6HC 4A3KC 4KATA 1XZQA 3HOUC 3BP8C 4A3LC 4BY7K 1PJ5A 1B4AA 5IOTA 3GEIA 2JA5C 4NOIA 3S1NK 3GTLA 1XZPB 1TWAK 3S1QK 1ISEA 3I4NK 1AB4A 3S16K 2NVYK 2WB1D 1IBAA 3GTPK 4QJVB 1EQRA 4OIOA 2V6TA 1UV7A 1YX2A 3QX3A 4AYBL 3S1RC 3RZDK 4P5AA 1O27A 4GTDA 2V6UA 3S14C 3M3YK 1EH1A 3HKZL 1WSRA 3GTKC 1BJTA 3VA7A 3H0GC 4BY7C 1C0AA 1VGXA 1WCMK 4A3MK 4P5BA 5C44K 3S1NC 4LOWA 1TWAC 1XXCA 1TWCK 2R92K 3I4NC 3GIRA 3GTPC 1K83C 3ADAC 1ZXOA 3HOXK 1Y1VK 2WB1L 1F7UA 2O5IA 4KC6A 4AH6A 2ZUFA 4A3EC 4LJZA 1KQ4A 3G4CA 3PO2K 3PO3C 2E2IK 2R93C 1WOOA 3MMLB 3A8IA 4JK1A 2JA6C 4A3DK 5L46A 4G7OA 4KB2A 5C44C 1TWAA 5M3MK 3GTMC 4BY1C 4A3JK 3BUEA 1O26A 3Q3QA 3GTPA 3N3YA 4XSZA 1VLOA 1HI9A 2A6EA 3L4JA 3IPJA 2PPBA 1BDFA 4LK1A 1I6VA 3FKIK 1WOSA 2JH3A 2GSUA 3HOXC 3GTQC 1TWGK 4C3IK 2KWAA 2GAHC 4KM8A 3CAGA 5IYCK 1IQ0A 4Q5SA 4GT9A 1O2FB 3JSTA 3M4OK 5IOSA 4YG2A 4Y7NK 2RH6A 2E2IC 2Y3PA 2E2HK 1J6VA 1WCMA 4ILDA 1Y1WK 3A8KA 1ZBSA 3AH5A 4KASA 4A3DC 1USMA 1TWCA 2R92A 3K7AK 1O24A 3GTJK 5C4JK 4ZH4A 3TFJA 4A3BK 2PHCB 3AD8C 4Y52K 4MEXA 3HOWK 4P9SA 1Y1VA 1DD5A 4J3NA 1JQWA 5IYCC 3GTGK 4GTBA 3S17C 1VH2A 3M4OC 4KMDA 1USOA 4OIPA 5IYBK 4YFKA 2CFAB 2E2IA 1O2BA 1XZPA 4Y7NC 4FM9A 4C3JC 3N0BA 4A3FC 4PAAA 3S1MK 4QJVA 4C3HK 3AD7C 1ZVUA 2A6HA 5JVOA 4GTFA 4C2MK 2EBBA 5M5WK 4X6AC 4OIRA 2JA7K 4WILA 4A3CK 4A3BC 3FKIA 2E2JK 4OINA 5EGEA 1TWGA 2YU9K 2R7ZK 3OPFA 4A3GC 2XCOA 1O28A 3S2HK 4G0UA 4A93K 2FQOA 5IP7K 4A3IC 3OREA 2NVTK 4PABA 5IYBC 1TWHK 1B4BA 1R9TK 3G4AA 2E2HA 3GEEA 5C4XK 4LK0A 2P5MA 3WODA 3S1QC 1Y1WA 3S1MC 1L0WA 4BKWA 3S16C 2NVYC 5FJ8K 4GFQA 3GTOK 4G7HA 4C2MC 3GTJA 4OIQA 2VUMK 3RZDC 1GE9A 1I50K 2PA8D 4A3CC 4Q4ZA 3I4MK 4LR2A 3A8JA 1J6WA 5M5XK 3M3YC 1IW7A 3FOFA 4BBSK 4LQYA 2R7ZC 2YU9C 3TFHA 3GTGA 4KN4A 1BGWA 2D6FC 3ERED 3HOYK 1INNA 5IP7C 4MQ9A 3V4GA 3FOEA 5CJ9A 1WCMC 4A3MC 4BXXK 4QIWD 5C4XC 5EGHA 1TWCC 2NVYA 2R92C 1WQFA 1WIHA 2FQTA 1O29A 3CQZK 4KARA 4BBRK 4C45A 1SFOK 4RMFA 4GTLA 3S15K 1Y1VC 3TFIA 5HL8A 2V6SA 5CHPA 5TJ3A 3SZYA 2NVXK 2YU9A 2R7ZA 2O5JA 4XLPA 5IYDK 2WAQD 2XCRB 4LLGA 1DCPA 1XXAA 1F7VA 5IP9K 3PO2C 4YFXA 2GSNA 3RZOK 2PA8L 3HOZK 1TWHA 4KDDA 1R9TA 4M1XA 3T02A 4BXXC 3LPXA 1ZYRA 4KM9A 1JOEA 3S2DK 3TTGA 4A3JC 1BS2A 2B63K 1IE0A 1I6HK 3HOUK 4A3LK 3GTOA 2CW0A 4G0WA 2A69A 2JA5K 4QIWL 2VUMA 3FKIC 1YCLA 1WOPA 3LAPA 4BBRC 1I50A 1HQMA 1TWGC 4C3IC 5M5YK 4MEYA 3HKZD 2A68A 1YNJA 5IP9C 4GZYA 2P8TA 2E2HC 1Y1WC 3S14K 3DXJA 2GSOA 1J6XA 3GTKK 3S2DC 1WQHA 3K7AC 3GTJC 1J98A 1VJEA 4BLBA 5C4JC 5TMCA 3H0GK 1XZQB 3CQZA 3S0XA 1IL2A 5M3FK 1SFOA 4Y52C 3HOWC 1I3QK 3GTGC 1DCHA 1PJ7A 3AQPA 1EFWA 2ZUEA 2NVXA 2BE5A
chains in the Genus database with same CATH topology
3HOZC 1K83K 1TWGK 4C3IK 5TMFA 2Y0SL 4KN4A 5IYCK 4Q5SA 2WAQL 3HOYK 5IP7C 4MQ9A 3H3VD 4G7ZA 3M4OK 4A3GK 4XSXA 4YG2A 1WCMC 4Y7NK 4A3MC 2B63C 3HOVC 4BXXK 4A3IK 2E2IC 1I6HC 4QIWD 4A3KC 5C4XC 2E2HK 4BBSK 3HOUC 4A3LC 4BY7K 4A3EK 1TWCC 1Y1WK 4A3DC 4KN7A 2JA5C 2R92C 3PO3K 4NOIA 3S1NK 2R93K 5C3EK 2JA7C 1TWAK 3S1QK 2JA6K 3I4NK 3K7AK 3S16K 3GTJK 2NVYK 3CQZK 2WB1D 2E2JC 3GTPK 4XLNA 4BBRK 5C4JK 4QJVB 4ZH4A 1SFOK 2NVQK 1I3QC 3GTMK 2PMZD 1Y1VC 4OIOA 4BY1K 3S15K 3S2HC 4A3BK 4A93C 2NVXK 2O5JA 4AYBL 4XLPA 3S1RC 5IYDK 4Y52K 2WAQD 4MEXA 3RZDK 3HOWK 4LLGA 2NVTC 5IYCC 3GTGK 1TWHC 5IP9K 3PO2C 4YFXA 1R9TC 2JA8K 3M3YK 3RZOK 2PA8L 3S14C 3S17C 3GTQK 3HKZL 1XPPA 1TWFK 3HOZK 3M4OC 3EQLA 3GTKC 5IYBK 4OIPA 4YFKA 5FLMK 4Y7NC 4KMUA 4BXXC 4A3FC 1ZYRA 3H0GC 4BY7C 3S1MK 3GTOC 3S2DK 3H3VL 4A3JC 1WCMK 4QJVA 4A3MK 2B63K 4C3HK 5C44K 2VUMC 3S1NC 1I6HK 5C3EC 2A6HA 3GTLK 3HOUK 4A3LK 1I50C 1TWAC 2CW0A 3I4MC 1TWCK 2A69A 4C2MK 2JA5K 4QIWL 2R92K 3I4NC 2Y0SD 5M5WK 4X6AC 3FKIC 4BBSC 4OIRA 3GTPC 4BBRC 2JA7K 1HQMA 1K83C 1TWGC 2NVQC 4A3CK 5M5YK 4A3BC 1SMYA 4MEYA 3HOYC 2E2JK 1YNNA 4OINA 3HOXK 2R7ZK 2YU9K 4A3GC 1Y1VK 2WB1L 3HKZD 2A68A 3S2HK 4A93K 1YNJA 5IP9C 5IP7K 2O5IA 4GZYA 2JA8C 4A3IC 2PMZL 2E2HC 1TWFC 5D4DA 2NVTK 4A3EC 4LJZA 5IYBC 1TWHK 1Y1WC 3HOVK 5FLMC 3PO2K 1R9TK 3PO3C 3S14K 2E2IK 4A3KK 3S17K 5C4XK 2R93C 3DXJA 4LK0A 4JK1A 4YFNA 3WODA 3GTKK 3S1QC 3S1MC 2JA6C 4A3DK 3S2DC 3K7AC 3S16C 3GTJC 2NVYC 3CQZC 5FJ8K 4G7OA 4C3JK 5C44C 5C4JC 5TMCA 1SFOC 4A3FK 3GTLC 3H0GK 4AYBD 5M3MK 3GTMC 4BY1C 3GTOK 4G7HA 3S15C 4A3JK 4OIQA 4XSZA 5M3FK 2NVXC 2VUMK 5IYDC 4Y52C 2A6EA 3HOWC 3RZDC 1I3QK 1I50K 2PA8D 4A3CC 4Q4ZA 3I4MK 2PPBA 3GTGC 1BDFA 4LK1A 4X6AK 5M5XK 1I6VA 3FKIK 1IW7A 3S1RK 3M3YC 3RZOC 2BE5A 3HOXC 3GTQC 2R7ZC 2YU9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ C;  1K83 K;  1TWG K;  4C3I K;  5TMF A;  2Y0S L;  4KN4 A;  5IYC K;  4Q5S A;  2WAQ L;  3HOY K;  5IP7 C;  4MQ9 A;  3H3V D;  4G7Z A;  3M4O K;  4A3G K;  4XSX A;  4YG2 A;  1WCM C;  4Y7N K;  4A3M C;  2B63 C;  3HOV C;  4BXX K;  4A3I K;  2E2I C;  1I6H C;  4QIW D;  4A3K C;  5C4X C;  2E2H K;  4BBS K;  3HOU C;  4A3L C;  4BY7 K;  4A3E K;  1TWC C;  1Y1W K;  4A3D C;  4KN7 A;  2JA5 C;  2R92 C;  3PO3 K;  4NOI A;  3S1N K;  2R93 K;  5C3E K;  2JA7 C;  1TWA K;  3S1Q K;  2JA6 K;  3I4N K;  3K7A K;  3S16 K;  3GTJ K;  2NVY K;  3CQZ K;  2WB1 D;  2E2J C;  3GTP K;  4XLN A;  4BBR K;  5C4J K;  4QJV B;  4ZH4 A;  1SFO K;  2NVQ K;  1I3Q C;  3GTM K;  2PMZ D;  1Y1V C;  4OIO A;  4BY1 K;  3S15 K;  3S2H C;  4A3B K;  4A93 C;  2NVX K;  2O5J A;  4AYB L;  4XLP A;  3S1R C;  5IYD K;  4Y52 K;  2WAQ D;  4MEX A;  3RZD K;  3HOW K;  4LLG A;  2NVT C;  5IYC C;  3GTG K;  1TWH C;  5IP9 K;  3PO2 C;  4YFX A;  1R9T C;  2JA8 K;  3M3Y K;  3RZO K;  2PA8 L;  3S14 C;  3S17 C;  3GTQ K;  3HKZ L;  1XPP A;  1TWF K;  3HOZ K;  3M4O C;  3EQL A;  3GTK C;  5IYB K;  4OIP A;  4YFK A;  5FLM K;  4Y7N C;  4KMU A;  4BXX C;  4A3F C;  1ZYR A;  3H0G C;  4BY7 C;  3S1M K;  3GTO C;  3S2D K;  3H3V L;  4A3J C;  1WCM K;  4QJV A;  4A3M K;  2B63 K;  4C3H K;  5C44 K;  2VUM C;  3S1N C;  1I6H K;  5C3E C;  2A6H A;  3GTL K;  3HOU K;  4A3L K;  1I50 C;  1TWA C;  2CW0 A;  3I4M C;  1TWC K;  2A69 A;  4C2M K;  2JA5 K;  4QIW L;  2R92 K;  3I4N C;  2Y0S D;  5M5W K;  4X6A C;  3FKI C;  4BBS C;  4OIR A;  3GTP C;  4BBR C;  2JA7 K;  1HQM A;  1K83 C;  1TWG C;  2NVQ C;  4A3C K;  5M5Y K;  4A3B C;  1SMY A;  4MEY A;  3HOY C;  2E2J K;  1YNN A;  4OIN A;  3HOX K;  2R7Z K;  2YU9 K;  4A3G C;  1Y1V K;  2WB1 L;  3HKZ D;  2A68 A;  3S2H K;  4A93 K;  1YNJ A;  5IP9 C;  5IP7 K;  2O5I A;  4GZY A;  2JA8 C;  4A3I C;  2PMZ L;  2E2H C;  1TWF C;  5D4D A;  2NVT K;  4A3E C;  4LJZ A;  5IYB C;  1TWH K;  1Y1W C;  3HOV K;  5FLM C;  3PO2 K;  1R9T K;  3PO3 C;  3S14 K;  2E2I K;  4A3K K;  3S17 K;  5C4X K;  2R93 C;  3DXJ A;  4LK0 A;  4JK1 A;  4YFN A;  3WOD A;  3GTK K;  3S1Q C;  3S1M C;  2JA6 C;  4A3D K;  3S2D C;  3K7A C;  3S16 C;  3GTJ C;  2NVY C;  3CQZ C;  5FJ8 K;  4G7O A;  4C3J K;  5C44 C;  5C4J C;  5TMC A;  1SFO C;  4A3F K;  3GTL C;  3H0G K;  4AYB D;  5M3M K;  3GTM C;  4BY1 C;  3GTO K;  4G7H A;  3S15 C;  4A3J K;  4OIQ A;  4XSZ A;  5M3F K;  2NVX C;  2VUM K;  5IYD C;  4Y52 C;  2A6E A;  3HOW C;  3RZD C;  1I3Q K;  1I50 K;  2PA8 D;  4A3C C;  4Q4Z A;  3I4M K;  2PPB A;  3GTG C;  1BDF A;  4LK1 A;  4X6A K;  5M5X K;  1I6V A;  3FKI K;  1IW7 A;  3S1R K;  3M3Y C;  3RZO C;  2BE5 A;  3HOX C;  3GTQ C;  2R7Z C;  2YU9 C; 
#chains in the Genus database with same CATH topology
 1K83 K;  5TMF A;  4GTE A;  3L4K A;  4KAW X;  1RU0 A;  3H3V D;  4G7Z A;  1JVI A;  4C3H C;  4A3E K;  4GTA A;  2B63 A;  1DCO A;  4KN7 A;  3PO3 K;  1WQG A;  4GTC A;  2R93 K;  5C3E K;  3OEP A;  2JA7 C;  2JA5 A;  2JA6 K;  1EK8 A;  1V5V A;  2E2J C;  4XLN A;  2XCQ A;  2NVQ K;  1I3Q C;  4DDQ A;  3GTM K;  2PMZ D;  4BY1 K;  3S2H C;  4A93 C;  3SZZ A;  1WOR A;  1G51 A;  4XCH A;  2NVT C;  1IS1 A;  1TWH C;  1R9T C;  2JA8 K;  3GTQ K;  1EI6 A;  1ZQ1 C;  1XPP A;  1TWF K;  5E68 A;  3EQL A;  4KMA A;  5IOQ A;  5FLM K;  4G0V A;  4KMU A;  4KB4 A;  3GTK A;  4BLA A;  3GTO C;  3H3V L;  2JA7 A;  2VUM C;  1O2A A;  4WJ3 M;  1F93 A;  3H0G A;  5C3E C;  3GTL K;  1I50 C;  3I4M C;  3FHZ A;  1WSV A;  2Y0S D;  3BP3 A;  4BBS C;  3T00 A;  1I3Q A;  1PJ6 A;  2NVQ C;  1SMY A;  3GEH A;  3HOY C;  1YNN A;  1K83 A;  3HXA A;  2JA8 C;  2PMZ L;  1TWF C;  5D4D A;  3HOV K;  2ZFZ A;  5FLM C;  4A3K K;  3S17 K;  4FZB A;  3NUH A;  1VRQ C;  4YFN A;  3AD9 C;  5JFE A;  2R93 A;  3CQZ C;  1X31 C;  2W7V A;  4C3J K;  1SFO C;  4A3F K;  3LAJ A;  3GTL C;  2JA6 A;  4AYB D;  3S15 C;  1F9N A;  3GSI A;  2NVX C;  5IYD C;  3T01 A;  5IOR A;  3GTM A;  3N0C A;  2CFA A;  4KMH A;  4O2D A;  1XXB A;  2GAG C;  4X6A K;  3RZO C;  3S1R K;  2RGR A;  3HOZ C;  2Y0S L;  2WAQ L;  3GDZ A;  1O25 A;  3GTQ A;  1TWF A;  4A3G K;  4XSX A;  4WJ4 A;  3HOV C;  2B63 C;  3AQO A;  4A3I K;  1I6H C;  4A3K C;  4KAT A;  1XZQ A;  3HOU C;  3BP8 C;  4A3L C;  4BY7 K;  1PJ5 A;  1B4A A;  5IOT A;  3GEI A;  2JA5 C;  4NOI A;  3S1N K;  3GTL A;  1XZP B;  1TWA K;  3S1Q K;  1ISE A;  3I4N K;  1AB4 A;  3S16 K;  2NVY K;  2WB1 D;  1IBA A;  3GTP K;  4QJV B;  1EQR A;  4OIO A;  2V6T A;  1UV7 A;  1YX2 A;  3QX3 A;  4AYB L;  3S1R C;  3RZD K;  4P5A A;  1O27 A;  4GTD A;  2V6U A;  3S14 C;  3M3Y K;  1EH1 A;  3HKZ L;  1WSR A;  3GTK C;  1BJT A;  3VA7 A;  3H0G C;  4BY7 C;  1C0A A;  1VGX A;  1WCM K;  4A3M K;  4P5B A;  5C44 K;  3S1N C;  4LOW A;  1TWA C;  1XXC A;  1TWC K;  2R92 K;  3I4N C;  3GIR A;  3GTP C;  1K83 C;  3ADA C;  1ZXO A;  3HOX K;  1Y1V K;  2WB1 L;  1F7U A;  2O5I A;  4KC6 A;  4AH6 A;  2ZUF A;  4A3E C;  4LJZ A;  1KQ4 A;  3G4C A;  3PO2 K;  3PO3 C;  2E2I K;  2R93 C;  1WOO A;  3MML B;  3A8I A;  4JK1 A;  2JA6 C;  4A3D K;  5L46 A;  4G7O A;  4KB2 A;  5C44 C;  1TWA A;  5M3M K;  3GTM C;  4BY1 C;  4A3J K;  3BUE A;  1O26 A;  3Q3Q A;  3GTP A;  3N3Y A;  4XSZ A;  1VLO A;  1HI9 A;  2A6E A;  3L4J A;  3IPJ A;  2PPB A;  1BDF A;  4LK1 A;  1I6V A;  3FKI K;  1WOS A;  2JH3 A;  2GSU A;  3HOX C;  3GTQ C;  1TWG K;  4C3I K;  2KWA A;  2GAH C;  4KM8 A;  3CAG A;  5IYC K;  1IQ0 A;  4Q5S A;  4GT9 A;  1O2F B;  3JST A;  3M4O K;  5IOS A;  4YG2 A;  4Y7N K;  2RH6 A;  2E2I C;  2Y3P A;  2E2H K;  1J6V A;  1WCM A;  4ILD A;  1Y1W K;  3A8K A;  1ZBS A;  3AH5 A;  4KAS A;  4A3D C;  1USM A;  1TWC A;  2R92 A;  3K7A K;  1O24 A;  3GTJ K;  5C4J K;  4ZH4 A;  3TFJ A;  4A3B K;  2PHC B;  3AD8 C;  4Y52 K;  4MEX A;  3HOW K;  4P9S A;  1Y1V A;  1DD5 A;  4J3N A;  1JQW A;  5IYC C;  3GTG K;  4GTB A;  3S17 C;  1VH2 A;  3M4O C;  4KMD A;  1USO A;  4OIP A;  5IYB K;  4YFK A;  2CFA B;  2E2I A;  1O2B A;  1XZP A;  4Y7N C;  4FM9 A;  4C3J C;  3N0B A;  4A3F C;  4PAA A;  3S1M K;  4QJV A;  4C3H K;  3AD7 C;  1ZVU A;  2A6H A;  5JVO A;  4GTF A;  4C2M K;  2EBB A;  5M5W K;  4X6A C;  4OIR A;  2JA7 K;  4WIL A;  4A3C K;  4A3B C;  3FKI A;  2E2J K;  4OIN A;  5EGE A;  1TWG A;  2YU9 K;  2R7Z K;  3OPF A;  4A3G C;  2XCO A;  1O28 A;  3S2H K;  4G0U A;  4A93 K;  2FQO A;  5IP7 K;  4A3I C;  3ORE A;  2NVT K;  4PAB A;  5IYB C;  1TWH K;  1B4B A;  1R9T K;  3G4A A;  2E2H A;  3GEE A;  5C4X K;  4LK0 A;  2P5M A;  3WOD A;  3S1Q C;  1Y1W A;  3S1M C;  1L0W A;  4BKW A;  3S16 C;  2NVY C;  5FJ8 K;  4GFQ A;  3GTO K;  4G7H A;  4C2M C;  3GTJ A;  4OIQ A;  2VUM K;  3RZD C;  1GE9 A;  1I50 K;  2PA8 D;  4A3C C;  4Q4Z A;  3I4M K;  4LR2 A;  3A8J A;  1J6W A;  5M5X K;  3M3Y C;  1IW7 A;  3FOF A;  4BBS K;  4LQY A;  2R7Z C;  2YU9 C;  3TFH A;  3GTG A;  4KN4 A;  1BGW A;  2D6F C;  3ERE D;  3HOY K;  1INN A;  5IP7 C;  4MQ9 A;  3V4G A;  3FOE A;  5CJ9 A;  1WCM C;  4A3M C;  4BXX K;  4QIW D;  5C4X C;  5EGH A;  1TWC C;  2NVY A;  2R92 C;  1WQF A;  1WIH A;  2FQT A;  1O29 A;  3CQZ K;  4KAR A;  4BBR K;  4C45 A;  1SFO K;  4RMF A;  4GTL A;  3S15 K;  1Y1V C;  3TFI A;  5HL8 A;  2V6S A;  5CHP A;  5TJ3 A;  3SZY A;  2NVX K;  2YU9 A;  2R7Z A;  2O5J A;  4XLP A;  5IYD K;  2WAQ D;  2XCR B;  4LLG A;  1DCP A;  1XXA A;  1F7V A;  5IP9 K;  3PO2 C;  4YFX A;  2GSN A;  3RZO K;  2PA8 L;  3HOZ K;  1TWH A;  4KDD A;  1R9T A;  4M1X A;  3T02 A;  4BXX C;  3LPX A;  1ZYR A;  4KM9 A;  1JOE A;  3S2D K;  3TTG A;  4A3J C;  1BS2 A;  2B63 K;  1IE0 A;  1I6H K;  3HOU K;  4A3L K;  3GTO A;  2CW0 A;  4G0W A;  2A69 A;  2JA5 K;  4QIW L;  2VUM A;  3FKI C;  1YCL A;  1WOP A;  3LAP A;  4BBR C;  1I50 A;  1HQM A;  1TWG C;  4C3I C;  5M5Y K;  4MEY A;  3HKZ D;  2A68 A;  1YNJ A;  5IP9 C;  4GZY A;  2P8T A;  2E2H C;  1Y1W C;  3S14 K;  3DXJ A;  2GSO A;  1J6X A;  3GTK K;  3S2D C;  1WQH A;  3K7A C;  3GTJ C;  1J98 A;  1VJE A;  4BLB A;  5C4J C;  5TMC A;  3H0G K;  1XZQ B;  3CQZ A;  3S0X A;  1IL2 A;  5M3F K;  1SFO A;  4Y52 C;  3HOW C;  1I3Q K;  3GTG C;  1DCH A;  1PJ7 A;  3AQP A;  1EFW A;  2ZUE A;  2NVX A;  2BE5 A; 
#chains in the Genus database with same CATH homology
 3HOZ C;  1K83 K;  1TWG K;  4C3I K;  5TMF A;  2Y0S L;  4KN4 A;  5IYC K;  4Q5S A;  2WAQ L;  3HOY K;  5IP7 C;  4MQ9 A;  3H3V D;  4G7Z A;  3M4O K;  4A3G K;  4XSX A;  4YG2 A;  1WCM C;  4Y7N K;  4A3M C;  2B63 C;  3HOV C;  4BXX K;  4A3I K;  2E2I C;  1I6H C;  4QIW D;  4A3K C;  5C4X C;  2E2H K;  4BBS K;  3HOU C;  4A3L C;  4BY7 K;  4A3E K;  1TWC C;  1Y1W K;  4A3D C;  4KN7 A;  2JA5 C;  2R92 C;  3PO3 K;  4NOI A;  3S1N K;  2R93 K;  5C3E K;  2JA7 C;  1TWA K;  3S1Q K;  2JA6 K;  3I4N K;  3K7A K;  3S16 K;  3GTJ K;  2NVY K;  3CQZ K;  2WB1 D;  2E2J C;  3GTP K;  4XLN A;  4BBR K;  5C4J K;  4QJV B;  4ZH4 A;  1SFO K;  2NVQ K;  1I3Q C;  3GTM K;  2PMZ D;  1Y1V C;  4OIO A;  4BY1 K;  3S15 K;  3S2H C;  4A3B K;  4A93 C;  2NVX K;  2O5J A;  4AYB L;  4XLP A;  3S1R C;  5IYD K;  4Y52 K;  2WAQ D;  4MEX A;  3RZD K;  3HOW K;  4LLG A;  2NVT C;  5IYC C;  3GTG K;  1TWH C;  5IP9 K;  3PO2 C;  4YFX A;  1R9T C;  2JA8 K;  3M3Y K;  3RZO K;  2PA8 L;  3S14 C;  3S17 C;  3GTQ K;  3HKZ L;  1XPP A;  1TWF K;  3HOZ K;  3M4O C;  3EQL A;  3GTK C;  5IYB K;  4OIP A;  4YFK A;  5FLM K;  4Y7N C;  4KMU A;  4BXX C;  4A3F C;  1ZYR A;  3H0G C;  4BY7 C;  3S1M K;  3GTO C;  3S2D K;  3H3V L;  4A3J C;  1WCM K;  4QJV A;  4A3M K;  2B63 K;  4C3H K;  5C44 K;  2VUM C;  3S1N C;  1I6H K;  5C3E C;  2A6H A;  3GTL K;  3HOU K;  4A3L K;  1I50 C;  1TWA C;  2CW0 A;  3I4M C;  1TWC K;  2A69 A;  4C2M K;  2JA5 K;  4QIW L;  2R92 K;  3I4N C;  2Y0S D;  5M5W K;  4X6A C;  3FKI C;  4BBS C;  4OIR A;  3GTP C;  4BBR C;  2JA7 K;  1HQM A;  1K83 C;  1TWG C;  2NVQ C;  4A3C K;  5M5Y K;  4A3B C;  1SMY A;  4MEY A;  3HOY C;  2E2J K;  1YNN A;  4OIN A;  3HOX K;  2R7Z K;  2YU9 K;  4A3G C;  1Y1V K;  2WB1 L;  3HKZ D;  2A68 A;  3S2H K;  4A93 K;  1YNJ A;  5IP9 C;  5IP7 K;  2O5I A;  4GZY A;  2JA8 C;  4A3I C;  2PMZ L;  2E2H C;  1TWF C;  5D4D A;  2NVT K;  4A3E C;  4LJZ A;  5IYB C;  1TWH K;  1Y1W C;  3HOV K;  5FLM C;  3PO2 K;  1R9T K;  3PO3 C;  3S14 K;  2E2I K;  4A3K K;  3S17 K;  5C4X K;  2R93 C;  3DXJ A;  4LK0 A;  4JK1 A;  4YFN A;  3WOD A;  3GTK K;  3S1Q C;  3S1M C;  2JA6 C;  4A3D K;  3S2D C;  3K7A C;  3S16 C;  3GTJ C;  2NVY C;  3CQZ C;  5FJ8 K;  4G7O A;  4C3J K;  5C44 C;  5C4J C;  5TMC A;  1SFO C;  4A3F K;  3GTL C;  3H0G K;  4AYB D;  5M3M K;  3GTM C;  4BY1 C;  3GTO K;  4G7H A;  3S15 C;  4A3J K;  4OIQ A;  4XSZ A;  5M3F K;  2NVX C;  2VUM K;  5IYD C;  4Y52 C;  2A6E A;  3HOW C;  3RZD C;  1I3Q K;  1I50 K;  2PA8 D;  4A3C C;  4Q4Z A;  3I4M K;  2PPB A;  3GTG C;  1BDF A;  4LK1 A;  4X6A K;  5M5X K;  1I6V A;  3FKI K;  1IW7 A;  3S1R K;  3M3Y C;  3RZO C;  2BE5 A;  3HOX C;  3GTQ C;  2R7Z C;  2YU9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...