4Y7NK

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y7nK00
1SMYA 3GTPC 2PMZL 2JA6C 2A69A 4AYBL 3S1MK 5C4JC 1I50C 4LLGA 3GTKK 3GTJC 4KN4A 4YFNA 5C4XK 4A3MC 5TMFA 5C3EK 2BE5A 4NOIA 1TWHC 3CQZK 2NVYC 4LK0A 5M3FK 4MQ9A 5FLMC 3GTJK 4A3IK 3S1RK 3HOXC 1SFOK 1TWFK 5C3EC 4XLPA 1I6VA 3RZDK 1TWHK 3CQZC 4A93K 4A3CC 1WCMC 3S1NK 4A3FK 4C3IK 2Y0SL 2JA6K 3GTGC 2PA8L 1TWFC 3H3VD 3HOZC 1WCMK 4A3JK 2WAQD 4A3FC 3S14C 3S1NC 4A3MK 2JA5C 1HQMA 2NVTK 3PO2K 5C4XC 2NVYK 4KN7A 5FLMK 4Y52C 4A3IC 3S1RC 2YU9K 1Y1VC 2A6HA 3RZDC 2JA8C 4A3CK 3HOWK 4Y52K 3GTGK 3PO3C 3HKZD 1IW7A 4BBSC 4A3EK 1Y1VK 3H0GK 4OIRA 4LK1A 2JA8K 2VUMK 3HOZK 3I4MK 4A3JC 3RZOK 3S14K 4Q5SA 4BBRK 3PO3K 2JA5K 2NVTC 2R7ZC 3PO2C 4A3BC 4BBSK 4A3EC 1TWGK 4BY7K 4QIWL 2JA7K 1ZYRA 5IP9K 1YNNA 3EQLA 2YU9C 1TWGC 4XSZA 4BY7C 5M5WK 3HOWC 2JA7C 2O5JA 4AYBD 4QJVA 5IYDC 1TWCK 5M3MK 5IYCC 4A3KK 4C3JK 3HOUC 3S15C 3H0GC 2VUMC 4YG2A 3I4MC 3RZOC 4BBRC 3HOUK 2R7ZK 4A3BK 1TWCC 2WB1L 5IYCK 4YFKA 4A3KC 3S15K 2R93C 3HOYC 2NVXC 3S2HK 3GTOK 4G7ZA 4OIQA 3FKIC 5IP9C 2R93K 4QIWD 4C3HK 2NVQK 4KMUA 2NVXK 5IYBK 5FJ8K 4Q4ZA 3GTOC 3FKIK 1TWAK 4G7HA 4QJVB 5IYDK 1Y1WC 2NVQC 4GZYA 1I3QC 4MEYA 5M5XK 5IYBC 3GTMK 4Y7NK 3DXJA 4ZH4A 4BXXK 4BY1K 2R92K 3WODA 3HOYK 3S2HC 4C2MK 2O5IA 3GTMC 3GTLC 4Y7NC 5TMCA 1I6HC 4BY1C 4X6AK 4A3DK 3HKZL 2A6EA 3GTQC 1TWAC 3S1QC 2A68A 3M4OK 1Y1WK 4A3DC 1I3QK 2PA8D 2PPBA 2Y0SD 4JK1A 3I4NC 4BXXC 4OIPA 2R92C 3S16C 1I6HK 2WAQL 3GTLK 5IP7C 4A3GK 4XLNA 4A3LK 1YNJA 3M3YK 4X6AC 4MEXA 3H3VL 3S2DK 5D4DA 1K83K 3GTQK 3S1QK 3S17C 4OINA 3M4OC 2E2JC 2E2IK 3K7AK 4OIOA 3S1MC 5C4JK 2WB1D 3HOVK 2CW0A 2B63C 4G7OA 3GTKC 1R9TK 3I4NK 2PMZD 3S17K 2E2JK 1BDFA 1XPPA 3K7AC 2E2IC 3S16K 3HOVC 4XSXA 2B63K 5C44C 1R9TC 2E2HK 4YFXA 3GTPK 5IP7K 4A93C 4A3GC 4A3LC 3HOXK 1SFOC 5M5YK 3M3YC 3S2DC 4LJZA 1K83C 1I50K 5C44K 2E2HC
chains in the Genus database with same CATH superfamily
4C3IC 2A69A 4AYBL 1DCPA 3IPJA 3S1MK 4LLGA 3VA7A 3GTJC 4KN4A 5TMFA 5C3EK 1IL2A 4NOIA 1BGWA 2FQTA 3CQZK 2NVYC 4LK0A 4RMFA 3GTJK 3S1RK 3HOXC 4XLPA 3CQZC 4A3CC 2PA8L 1WQFA 3N0CA 1PJ6A 3S14C 4FM9A 1HQMA 2NVTK 4KC6A 4GTAA 3RZDC 2JA8C 1EK8A 1RU0A 1IW7A 2XCRB 4BBSC 4OIRA 3H0GK 4LK1A 4GTLA 2JA8K 4Q5SA 4FZBA 4BBRK 3GEHA 2ZFZA 1TWGK 1VH2A 1Y1WA 4KB4A 2GAHC 2ZUEA 5M5WK 4BKWA 5IYDC 4A3KK 5M3MK 1EH1A 4C3JK 4LR2A 1O2AA 3AD7C 2R7ZK 4A3BK 5IYCK 2R93C 1JOEA 4P5AA 1J6XA 1O28A 2ZUFA 4GTCA 2R93K 2V6UA 4QIWD 4C3HK 1WCMA 4WILA 2NVQK 3FKIA 2NVXK 3FKIK 1TWAK 4GT9A 2JA6A 4GZYA 2NVQC 4DDQA 3GTMK 4KARA 4Y7NK 1WSRA 4BXXK 1I50A 3S2HC 3GTMC 5IOQA 5TMCA 4J3NA 2RGRA 2A6EA 3T01A 3LPXA 1F7VA 3G4CA 3M4OK 1Y1WK 1I3QK 2PA8D 1O2BA 1VGXA 1TWGA 3I4NC 2GAGC 2R92C 3FOFA 3GTLK 3H0GA 1C0AA 4KASA 2PHCB 4M1XA 4X6AC 1AB4A 1VJEA 1K83K 2JA7A 3S1QK 4WJ3M 4LOWA 4OINA 2E2JC 3K7AK 4KMHA 5IOTA 3HOVK 4G7OA 3HXAA 2V6SA 1BDFA 3K7AC 4C45A 3HOVC 3GTLA 3OREA 2B63K 1R9TC 1EFWA 1G51A 3OEPA 5EGHA 2CFAA 5M5YK 2YU9A 1JVIA 2E2HC 1I3QA 3BUEA 1IQ0A 3GTJA 5C4JC 3AH5A 4YFNA 4A93C 2JH3A 4KMAA 1TWFK 1I6VA 3RZDK 1XZQB 4A93K 1DCOA 1WCMC 2JA6K 2Y0SL 1DCHA 1TWFC 2XCOA 1O24A 3H3VD 1WCMK 4A3MK 1VRQC 4BLBA 2EBBA 5FLMK 4Y52C 4A3IC 4O2DA 4LQYA 2A6HA 5CHPA 3GTPA 3HOWK 4Y52K 1Y1VK 3HOZK 3GTGA 4A3JC 3RZOK 2JA5K 3PO2C 1XZQA 3SZYA 4BY7K 4G0UA 3A8IA 4XSZA 4BY7C 5L46A 5IYCC 4GTEA 3S15C 2VUMC 1BS2A 3I4MC 3Q3QA 1TWHA 1TWCC 4YFKA 1KQ4A 2WB1L 3V4GA 4C3HC 3S15K 2NVXC 3A8JA 3FKIC 1J6WA 5IP9C 3BP3A 4KMUA 4G7HA 1I3QC 4MEYA 4P5BA 3GTOA 3TTGA 4ZH4A 1WSVA 1IS1A 2R92K 2GSUA 2Y3PA 3HOYK 1I6HC 2O5IA 4BY1C 4X6AK 3HKZL 3GTQC 3S1QC 1O29A 3NUHA 4JK1A 5HL8A 5TJ3A 3OPFA 3S0XA 4C2MC 1EI6A 4G0VA 5IP7C 3TFJA 4A3GK 4XLNA 4GFQA 4P9SA 1WIHA 5E68A 2E2IA 5JVOA 1DD5A 3S1MC 4KB2A 3GTQA 2NVYA 2B63C 1R9TK 2PMZD 3S17K 3S16K 1O26A 2E2HK 3GSIA 4YFXA 1VLOA 3HOXK 4A3LC 3GIRA 1XXCA 3M3YC 2PPBA 1SMYA 2PMZL 2JA6C 1PJ5A 4GTFA 1I50C 3GTKK 4A3MC 2XCQA 2KWAA 1B4BA 1L0WA 1TWHC 5M3FK 1B4AA 3T02A 4BLAA 1SFOK 2V6TA 1UV7A 4KMDA 1IBAA 1TWHK 3S1NK 3ADAC 3MMLB 3S1NC 1YCLA 2WAQD 4A3FC 5C4XC 3PO2K 3LAJA 1BJTA 1WQHA 3CAGA 1Y1VC 4KDDA 3GTGK 5IOSA 4C3JC 2VUMK 3AQOA 1WORA 3LAPA 3I4MK 3S14K 1ZXOA 3L4KA 3PO3K 2NVTC 2R7ZC 4A3BC 3ERED 1ZYRA 3EQLA 2YU9C 3JSTA 1ZVUA 2O5JA 3HOUC 3SZZA 1TWCK 1HI9A 1PJ7A 4YG2A 3HOUK 1GE9A 3HOYC 1TWFA 3S2HK 4G7ZA 4OIQA 1ISEA 4PABA 2P5MA 5IYBK 5FJ8K 3GTOC 5IYDK 1Y1WC 1ZQ1C 2R92A 5M5XK 5IYBC 1XXBA 4BY1K 3GTLC 4A3DK 1ZBSA 5IORA 1F9NA 1TWAC 2A68A 3GEIA 4A3DC 1WOOA 2Y0SD 3FHZA 4BXXC 4OIPA 2GSOA 3S16C 1O25A 5EGEA 3BP8C 2VUMA 4A3LK 1YNJA 1YX2A 1X31C 5D4DA 3S17C 2P8TA 4OIOA 5C4JK 3I4NK 1IE0A 2E2IC 1XPPA 1Y1VA 2CFAB 5C44C 3GTPK 3S2DC 4LJZA 3N3YA 1I50K 5C44K 3GTPC 1INNA 1SFOA 4XCHA 3AQPA 1USMA 5C4XK 4KATA 2BE5A 2FQOA 1XXAA 2R93A 1J6VA 4MQ9A 5FLMC 4A3IK 5C3EC 1V5VA 5JFEA 3T00A 1WQGA 4C3IK 4A3FK 3GTGC 1WOPA 3AD9C 2E2HA 4WJ4A 1JQWA 3HOZC 4A3JK 1XZPB 2JA5C 4G0WA 3GEEA 1R9TA 4ILDA 2NVYK 4KN7A 3S1RC 1USOA 2YU9K 1O2FB 4A3CK 2GSNA 1TWCA 3PO3C 2B63A 3HKZD 4A3EK 4KAWX 1O27A 4BBSK 1J98A 4A3EC 1F93A 4QIWL 2JA7K 1K83A 5IP9K 1YNNA 3G4AA 1TWGC 1EQRA 1F7UA 3HOWC 2JA7C 4AYBD 4QJVA 3H0GC 3RZOC 4BBRC 4A3KC 3GTOK 4GTDA 3CQZA 4Q4ZA 2RH6A 4AH6A 4QJVB 3DXJA 3GTMA 4GTBA 3WODA 4C2MK 4Y7NC 1TWAA 2NVXA 3FOEA 3GTKA 5CJ9A 3TFIA 4KM8A 3N0BA 2R7ZA 2JA5A 3L4JA 1I6HK 3GDZA 2WAQL 1WOSA 3AD8C 3M3YK 4MEXA 3H3VL 3S2DK 3GTQK 3M4OC 2E2IK 4PAAA 2WB1D 3A8KA 2CW0A 2D6FC 3GTKC 2W7VA 2E2JK 4XSXA 5IP7K 4A3GC 1XZPA 3QX3A 1SFOC 1K83C 3TFHA 4KM9A
chains in the Genus database with same CATH topology
1SMYA 3GTPC 2PMZL 2JA6C 2A69A 4AYBL 3S1MK 5C4JC 1I50C 4LLGA 3GTKK 3GTJC 4KN4A 4YFNA 5C4XK 4A3MC 5TMFA 5C3EK 2BE5A 4NOIA 1TWHC 3CQZK 2NVYC 4LK0A 5M3FK 4MQ9A 5FLMC 3GTJK 4A3IK 3S1RK 3HOXC 1SFOK 1TWFK 5C3EC 4XLPA 1I6VA 3RZDK 1TWHK 3CQZC 4A93K 4A3CC 1WCMC 3S1NK 4A3FK 4C3IK 2Y0SL 2JA6K 3GTGC 2PA8L 1TWFC 3H3VD 3HOZC 1WCMK 4A3JK 2WAQD 4A3FC 3S14C 3S1NC 4A3MK 2JA5C 1HQMA 2NVTK 3PO2K 5C4XC 2NVYK 4KN7A 5FLMK 4Y52C 4A3IC 3S1RC 2YU9K 1Y1VC 2A6HA 3RZDC 2JA8C 4A3CK 3HOWK 4Y52K 3GTGK 3PO3C 3HKZD 1IW7A 4BBSC 4A3EK 1Y1VK 3H0GK 4OIRA 4LK1A 2JA8K 2VUMK 3HOZK 3I4MK 4A3JC 3RZOK 3S14K 4Q5SA 4BBRK 3PO3K 2JA5K 2NVTC 2R7ZC 3PO2C 4A3BC 4BBSK 4A3EC 1TWGK 4BY7K 4QIWL 2JA7K 1ZYRA 5IP9K 1YNNA 3EQLA 2YU9C 1TWGC 4XSZA 4BY7C 5M5WK 3HOWC 2JA7C 2O5JA 4AYBD 4QJVA 5IYDC 1TWCK 5M3MK 5IYCC 4A3KK 4C3JK 3HOUC 3S15C 3H0GC 2VUMC 4YG2A 3I4MC 3RZOC 4BBRC 3HOUK 2R7ZK 4A3BK 1TWCC 2WB1L 5IYCK 4YFKA 4A3KC 3S15K 2R93C 3HOYC 2NVXC 3S2HK 3GTOK 4G7ZA 4OIQA 3FKIC 5IP9C 2R93K 4QIWD 4C3HK 2NVQK 4KMUA 2NVXK 5IYBK 5FJ8K 4Q4ZA 3GTOC 3FKIK 1TWAK 4G7HA 4QJVB 5IYDK 1Y1WC 2NVQC 4GZYA 1I3QC 4MEYA 5M5XK 5IYBC 3GTMK 4Y7NK 3DXJA 4ZH4A 4BXXK 4BY1K 2R92K 3WODA 3HOYK 3S2HC 4C2MK 2O5IA 3GTMC 3GTLC 4Y7NC 5TMCA 1I6HC 4BY1C 4X6AK 4A3DK 3HKZL 2A6EA 3GTQC 1TWAC 3S1QC 2A68A 3M4OK 1Y1WK 4A3DC 1I3QK 2PA8D 2PPBA 2Y0SD 4JK1A 3I4NC 4BXXC 4OIPA 2R92C 3S16C 1I6HK 2WAQL 3GTLK 5IP7C 4A3GK 4XLNA 4A3LK 1YNJA 3M3YK 4X6AC 4MEXA 3H3VL 3S2DK 5D4DA 1K83K 3GTQK 3S1QK 3S17C 4OINA 3M4OC 2E2JC 2E2IK 3K7AK 4OIOA 3S1MC 5C4JK 2WB1D 3HOVK 2CW0A 2B63C 4G7OA 3GTKC 1R9TK 3I4NK 2PMZD 3S17K 2E2JK 1BDFA 1XPPA 3K7AC 2E2IC 3S16K 3HOVC 4XSXA 2B63K 5C44C 1R9TC 2E2HK 4YFXA 3GTPK 5IP7K 4A93C 4A3GC 4A3LC 3HOXK 1SFOC 5M5YK 3M3YC 3S2DC 4LJZA 1K83C 1I50K 5C44K 2E2HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMY A;  3GTP C;  2PMZ L;  2JA6 C;  2A69 A;  4AYB L;  3S1M K;  5C4J C;  1I50 C;  4LLG A;  3GTK K;  3GTJ C;  4KN4 A;  4YFN A;  5C4X K;  4A3M C;  5TMF A;  5C3E K;  2BE5 A;  4NOI A;  1TWH C;  3CQZ K;  2NVY C;  4LK0 A;  5M3F K;  4MQ9 A;  5FLM C;  3GTJ K;  4A3I K;  3S1R K;  3HOX C;  1SFO K;  1TWF K;  5C3E C;  4XLP A;  1I6V A;  3RZD K;  1TWH K;  3CQZ C;  4A93 K;  4A3C C;  1WCM C;  3S1N K;  4A3F K;  4C3I K;  2Y0S L;  2JA6 K;  3GTG C;  2PA8 L;  1TWF C;  3H3V D;  3HOZ C;  1WCM K;  4A3J K;  2WAQ D;  4A3F C;  3S14 C;  3S1N C;  4A3M K;  2JA5 C;  1HQM A;  2NVT K;  3PO2 K;  5C4X C;  2NVY K;  4KN7 A;  5FLM K;  4Y52 C;  4A3I C;  3S1R C;  2YU9 K;  1Y1V C;  2A6H A;  3RZD C;  2JA8 C;  4A3C K;  3HOW K;  4Y52 K;  3GTG K;  3PO3 C;  3HKZ D;  1IW7 A;  4BBS C;  4A3E K;  1Y1V K;  3H0G K;  4OIR A;  4LK1 A;  2JA8 K;  2VUM K;  3HOZ K;  3I4M K;  4A3J C;  3RZO K;  3S14 K;  4Q5S A;  4BBR K;  3PO3 K;  2JA5 K;  2NVT C;  2R7Z C;  3PO2 C;  4A3B C;  4BBS K;  4A3E C;  1TWG K;  4BY7 K;  4QIW L;  2JA7 K;  1ZYR A;  5IP9 K;  1YNN A;  3EQL A;  2YU9 C;  1TWG C;  4XSZ A;  4BY7 C;  5M5W K;  3HOW C;  2JA7 C;  2O5J A;  4AYB D;  4QJV A;  5IYD C;  1TWC K;  5M3M K;  5IYC C;  4A3K K;  4C3J K;  3HOU C;  3S15 C;  3H0G C;  2VUM C;  4YG2 A;  3I4M C;  3RZO C;  4BBR C;  3HOU K;  2R7Z K;  4A3B K;  1TWC C;  2WB1 L;  5IYC K;  4YFK A;  4A3K C;  3S15 K;  2R93 C;  3HOY C;  2NVX C;  3S2H K;  3GTO K;  4G7Z A;  4OIQ A;  3FKI C;  5IP9 C;  2R93 K;  4QIW D;  4C3H K;  2NVQ K;  4KMU A;  2NVX K;  5IYB K;  5FJ8 K;  4Q4Z A;  3GTO C;  3FKI K;  1TWA K;  4G7H A;  4QJV B;  5IYD K;  1Y1W C;  2NVQ C;  4GZY A;  1I3Q C;  4MEY A;  5M5X K;  5IYB C;  3GTM K;  4Y7N K;  3DXJ A;  4ZH4 A;  4BXX K;  4BY1 K;  2R92 K;  3WOD A;  3HOY K;  3S2H C;  4C2M K;  2O5I A;  3GTM C;  3GTL C;  4Y7N C;  5TMC A;  1I6H C;  4BY1 C;  4X6A K;  4A3D K;  3HKZ L;  2A6E A;  3GTQ C;  1TWA C;  3S1Q C;  2A68 A;  3M4O K;  1Y1W K;  4A3D C;  1I3Q K;  2PA8 D;  2PPB A;  2Y0S D;  4JK1 A;  3I4N C;  4BXX C;  4OIP A;  2R92 C;  3S16 C;  1I6H K;  2WAQ L;  3GTL K;  5IP7 C;  4A3G K;  4XLN A;  4A3L K;  1YNJ A;  3M3Y K;  4X6A C;  4MEX A;  3H3V L;  3S2D K;  5D4D A;  1K83 K;  3GTQ K;  3S1Q K;  3S17 C;  4OIN A;  3M4O C;  2E2J C;  2E2I K;  3K7A K;  4OIO A;  3S1M C;  5C4J K;  2WB1 D;  3HOV K;  2CW0 A;  2B63 C;  4G7O A;  3GTK C;  1R9T K;  3I4N K;  2PMZ D;  3S17 K;  2E2J K;  1BDF A;  1XPP A;  3K7A C;  2E2I C;  3S16 K;  3HOV C;  4XSX A;  2B63 K;  5C44 C;  1R9T C;  2E2H K;  4YFX A;  3GTP K;  5IP7 K;  4A93 C;  4A3G C;  4A3L C;  3HOX K;  1SFO C;  5M5Y K;  3M3Y C;  3S2D C;  4LJZ A;  1K83 C;  1I50 K;  5C44 K;  2E2H C; 
#chains in the Genus database with same CATH topology
 4C3I C;  2A69 A;  4AYB L;  1DCP A;  3IPJ A;  3S1M K;  4LLG A;  3VA7 A;  3GTJ C;  4KN4 A;  5TMF A;  5C3E K;  1IL2 A;  4NOI A;  1BGW A;  2FQT A;  3CQZ K;  2NVY C;  4LK0 A;  4RMF A;  3GTJ K;  3S1R K;  3HOX C;  4XLP A;  3CQZ C;  4A3C C;  2PA8 L;  1WQF A;  3N0C A;  1PJ6 A;  3S14 C;  4FM9 A;  1HQM A;  2NVT K;  4KC6 A;  4GTA A;  3RZD C;  2JA8 C;  1EK8 A;  1RU0 A;  1IW7 A;  2XCR B;  4BBS C;  4OIR A;  3H0G K;  4LK1 A;  4GTL A;  2JA8 K;  4Q5S A;  4FZB A;  4BBR K;  3GEH A;  2ZFZ A;  1TWG K;  1VH2 A;  1Y1W A;  4KB4 A;  2GAH C;  2ZUE A;  5M5W K;  4BKW A;  5IYD C;  4A3K K;  5M3M K;  1EH1 A;  4C3J K;  4LR2 A;  1O2A A;  3AD7 C;  2R7Z K;  4A3B K;  5IYC K;  2R93 C;  1JOE A;  4P5A A;  1J6X A;  1O28 A;  2ZUF A;  4GTC A;  2R93 K;  2V6U A;  4QIW D;  4C3H K;  1WCM A;  4WIL A;  2NVQ K;  3FKI A;  2NVX K;  3FKI K;  1TWA K;  4GT9 A;  2JA6 A;  4GZY A;  2NVQ C;  4DDQ A;  3GTM K;  4KAR A;  4Y7N K;  1WSR A;  4BXX K;  1I50 A;  3S2H C;  3GTM C;  5IOQ A;  5TMC A;  4J3N A;  2RGR A;  2A6E A;  3T01 A;  3LPX A;  1F7V A;  3G4C A;  3M4O K;  1Y1W K;  1I3Q K;  2PA8 D;  1O2B A;  1VGX A;  1TWG A;  3I4N C;  2GAG C;  2R92 C;  3FOF A;  3GTL K;  3H0G A;  1C0A A;  4KAS A;  2PHC B;  4M1X A;  4X6A C;  1AB4 A;  1VJE A;  1K83 K;  2JA7 A;  3S1Q K;  4WJ3 M;  4LOW A;  4OIN A;  2E2J C;  3K7A K;  4KMH A;  5IOT A;  3HOV K;  4G7O A;  3HXA A;  2V6S A;  1BDF A;  3K7A C;  4C45 A;  3HOV C;  3GTL A;  3ORE A;  2B63 K;  1R9T C;  1EFW A;  1G51 A;  3OEP A;  5EGH A;  2CFA A;  5M5Y K;  2YU9 A;  1JVI A;  2E2H C;  1I3Q A;  3BUE A;  1IQ0 A;  3GTJ A;  5C4J C;  3AH5 A;  4YFN A;  4A93 C;  2JH3 A;  4KMA A;  1TWF K;  1I6V A;  3RZD K;  1XZQ B;  4A93 K;  1DCO A;  1WCM C;  2JA6 K;  2Y0S L;  1DCH A;  1TWF C;  2XCO A;  1O24 A;  3H3V D;  1WCM K;  4A3M K;  1VRQ C;  4BLB A;  2EBB A;  5FLM K;  4Y52 C;  4A3I C;  4O2D A;  4LQY A;  2A6H A;  5CHP A;  3GTP A;  3HOW K;  4Y52 K;  1Y1V K;  3HOZ K;  3GTG A;  4A3J C;  3RZO K;  2JA5 K;  3PO2 C;  1XZQ A;  3SZY A;  4BY7 K;  4G0U A;  3A8I A;  4XSZ A;  4BY7 C;  5L46 A;  5IYC C;  4GTE A;  3S15 C;  2VUM C;  1BS2 A;  3I4M C;  3Q3Q A;  1TWH A;  1TWC C;  4YFK A;  1KQ4 A;  2WB1 L;  3V4G A;  4C3H C;  3S15 K;  2NVX C;  3A8J A;  3FKI C;  1J6W A;  5IP9 C;  3BP3 A;  4KMU A;  4G7H A;  1I3Q C;  4MEY A;  4P5B A;  3GTO A;  3TTG A;  4ZH4 A;  1WSV A;  1IS1 A;  2R92 K;  2GSU A;  2Y3P A;  3HOY K;  1I6H C;  2O5I A;  4BY1 C;  4X6A K;  3HKZ L;  3GTQ C;  3S1Q C;  1O29 A;  3NUH A;  4JK1 A;  5HL8 A;  5TJ3 A;  3OPF A;  3S0X A;  4C2M C;  1EI6 A;  4G0V A;  5IP7 C;  3TFJ A;  4A3G K;  4XLN A;  4GFQ A;  4P9S A;  1WIH A;  5E68 A;  2E2I A;  5JVO A;  1DD5 A;  3S1M C;  4KB2 A;  3GTQ A;  2NVY A;  2B63 C;  1R9T K;  2PMZ D;  3S17 K;  3S16 K;  1O26 A;  2E2H K;  3GSI A;  4YFX A;  1VLO A;  3HOX K;  4A3L C;  3GIR A;  1XXC A;  3M3Y C;  2PPB A;  1SMY A;  2PMZ L;  2JA6 C;  1PJ5 A;  4GTF A;  1I50 C;  3GTK K;  4A3M C;  2XCQ A;  2KWA A;  1B4B A;  1L0W A;  1TWH C;  5M3F K;  1B4A A;  3T02 A;  4BLA A;  1SFO K;  2V6T A;  1UV7 A;  4KMD A;  1IBA A;  1TWH K;  3S1N K;  3ADA C;  3MML B;  3S1N C;  1YCL A;  2WAQ D;  4A3F C;  5C4X C;  3PO2 K;  3LAJ A;  1BJT A;  1WQH A;  3CAG A;  1Y1V C;  4KDD A;  3GTG K;  5IOS A;  4C3J C;  2VUM K;  3AQO A;  1WOR A;  3LAP A;  3I4M K;  3S14 K;  1ZXO A;  3L4K A;  3PO3 K;  2NVT C;  2R7Z C;  4A3B C;  3ERE D;  1ZYR A;  3EQL A;  2YU9 C;  3JST A;  1ZVU A;  2O5J A;  3HOU C;  3SZZ A;  1TWC K;  1HI9 A;  1PJ7 A;  4YG2 A;  3HOU K;  1GE9 A;  3HOY C;  1TWF A;  3S2H K;  4G7Z A;  4OIQ A;  1ISE A;  4PAB A;  2P5M A;  5IYB K;  5FJ8 K;  3GTO C;  5IYD K;  1Y1W C;  1ZQ1 C;  2R92 A;  5M5X K;  5IYB C;  1XXB A;  4BY1 K;  3GTL C;  4A3D K;  1ZBS A;  5IOR A;  1F9N A;  1TWA C;  2A68 A;  3GEI A;  4A3D C;  1WOO A;  2Y0S D;  3FHZ A;  4BXX C;  4OIP A;  2GSO A;  3S16 C;  1O25 A;  5EGE A;  3BP8 C;  2VUM A;  4A3L K;  1YNJ A;  1YX2 A;  1X31 C;  5D4D A;  3S17 C;  2P8T A;  4OIO A;  5C4J K;  3I4N K;  1IE0 A;  2E2I C;  1XPP A;  1Y1V A;  2CFA B;  5C44 C;  3GTP K;  3S2D C;  4LJZ A;  3N3Y A;  1I50 K;  5C44 K;  3GTP C;  1INN A;  1SFO A;  4XCH A;  3AQP A;  1USM A;  5C4X K;  4KAT A;  2BE5 A;  2FQO A;  1XXA A;  2R93 A;  1J6V A;  4MQ9 A;  5FLM C;  4A3I K;  5C3E C;  1V5V A;  5JFE A;  3T00 A;  1WQG A;  4C3I K;  4A3F K;  3GTG C;  1WOP A;  3AD9 C;  2E2H A;  4WJ4 A;  1JQW A;  3HOZ C;  4A3J K;  1XZP B;  2JA5 C;  4G0W A;  3GEE A;  1R9T A;  4ILD A;  2NVY K;  4KN7 A;  3S1R C;  1USO A;  2YU9 K;  1O2F B;  4A3C K;  2GSN A;  1TWC A;  3PO3 C;  2B63 A;  3HKZ D;  4A3E K;  4KAW X;  1O27 A;  4BBS K;  1J98 A;  4A3E C;  1F93 A;  4QIW L;  2JA7 K;  1K83 A;  5IP9 K;  1YNN A;  3G4A A;  1TWG C;  1EQR A;  1F7U A;  3HOW C;  2JA7 C;  4AYB D;  4QJV A;  3H0G C;  3RZO C;  4BBR C;  4A3K C;  3GTO K;  4GTD A;  3CQZ A;  4Q4Z A;  2RH6 A;  4AH6 A;  4QJV B;  3DXJ A;  3GTM A;  4GTB A;  3WOD A;  4C2M K;  4Y7N C;  1TWA A;  2NVX A;  3FOE A;  3GTK A;  5CJ9 A;  3TFI A;  4KM8 A;  3N0B A;  2R7Z A;  2JA5 A;  3L4J A;  1I6H K;  3GDZ A;  2WAQ L;  1WOS A;  3AD8 C;  3M3Y K;  4MEX A;  3H3V L;  3S2D K;  3GTQ K;  3M4O C;  2E2I K;  4PAA A;  2WB1 D;  3A8K A;  2CW0 A;  2D6F C;  3GTK C;  2W7V A;  2E2J K;  4XSX A;  5IP7 K;  4A3G C;  1XZP A;  3QX3 A;  1SFO C;  1K83 C;  3TFH A;  4KM9 A; 
#chains in the Genus database with same CATH homology
 1SMY A;  3GTP C;  2PMZ L;  2JA6 C;  2A69 A;  4AYB L;  3S1M K;  5C4J C;  1I50 C;  4LLG A;  3GTK K;  3GTJ C;  4KN4 A;  4YFN A;  5C4X K;  4A3M C;  5TMF A;  5C3E K;  2BE5 A;  4NOI A;  1TWH C;  3CQZ K;  2NVY C;  4LK0 A;  5M3F K;  4MQ9 A;  5FLM C;  3GTJ K;  4A3I K;  3S1R K;  3HOX C;  1SFO K;  1TWF K;  5C3E C;  4XLP A;  1I6V A;  3RZD K;  1TWH K;  3CQZ C;  4A93 K;  4A3C C;  1WCM C;  3S1N K;  4A3F K;  4C3I K;  2Y0S L;  2JA6 K;  3GTG C;  2PA8 L;  1TWF C;  3H3V D;  3HOZ C;  1WCM K;  4A3J K;  2WAQ D;  4A3F C;  3S14 C;  3S1N C;  4A3M K;  2JA5 C;  1HQM A;  2NVT K;  3PO2 K;  5C4X C;  2NVY K;  4KN7 A;  5FLM K;  4Y52 C;  4A3I C;  3S1R C;  2YU9 K;  1Y1V C;  2A6H A;  3RZD C;  2JA8 C;  4A3C K;  3HOW K;  4Y52 K;  3GTG K;  3PO3 C;  3HKZ D;  1IW7 A;  4BBS C;  4A3E K;  1Y1V K;  3H0G K;  4OIR A;  4LK1 A;  2JA8 K;  2VUM K;  3HOZ K;  3I4M K;  4A3J C;  3RZO K;  3S14 K;  4Q5S A;  4BBR K;  3PO3 K;  2JA5 K;  2NVT C;  2R7Z C;  3PO2 C;  4A3B C;  4BBS K;  4A3E C;  1TWG K;  4BY7 K;  4QIW L;  2JA7 K;  1ZYR A;  5IP9 K;  1YNN A;  3EQL A;  2YU9 C;  1TWG C;  4XSZ A;  4BY7 C;  5M5W K;  3HOW C;  2JA7 C;  2O5J A;  4AYB D;  4QJV A;  5IYD C;  1TWC K;  5M3M K;  5IYC C;  4A3K K;  4C3J K;  3HOU C;  3S15 C;  3H0G C;  2VUM C;  4YG2 A;  3I4M C;  3RZO C;  4BBR C;  3HOU K;  2R7Z K;  4A3B K;  1TWC C;  2WB1 L;  5IYC K;  4YFK A;  4A3K C;  3S15 K;  2R93 C;  3HOY C;  2NVX C;  3S2H K;  3GTO K;  4G7Z A;  4OIQ A;  3FKI C;  5IP9 C;  2R93 K;  4QIW D;  4C3H K;  2NVQ K;  4KMU A;  2NVX K;  5IYB K;  5FJ8 K;  4Q4Z A;  3GTO C;  3FKI K;  1TWA K;  4G7H A;  4QJV B;  5IYD K;  1Y1W C;  2NVQ C;  4GZY A;  1I3Q C;  4MEY A;  5M5X K;  5IYB C;  3GTM K;  4Y7N K;  3DXJ A;  4ZH4 A;  4BXX K;  4BY1 K;  2R92 K;  3WOD A;  3HOY K;  3S2H C;  4C2M K;  2O5I A;  3GTM C;  3GTL C;  4Y7N C;  5TMC A;  1I6H C;  4BY1 C;  4X6A K;  4A3D K;  3HKZ L;  2A6E A;  3GTQ C;  1TWA C;  3S1Q C;  2A68 A;  3M4O K;  1Y1W K;  4A3D C;  1I3Q K;  2PA8 D;  2PPB A;  2Y0S D;  4JK1 A;  3I4N C;  4BXX C;  4OIP A;  2R92 C;  3S16 C;  1I6H K;  2WAQ L;  3GTL K;  5IP7 C;  4A3G K;  4XLN A;  4A3L K;  1YNJ A;  3M3Y K;  4X6A C;  4MEX A;  3H3V L;  3S2D K;  5D4D A;  1K83 K;  3GTQ K;  3S1Q K;  3S17 C;  4OIN A;  3M4O C;  2E2J C;  2E2I K;  3K7A K;  4OIO A;  3S1M C;  5C4J K;  2WB1 D;  3HOV K;  2CW0 A;  2B63 C;  4G7O A;  3GTK C;  1R9T K;  3I4N K;  2PMZ D;  3S17 K;  2E2J K;  1BDF A;  1XPP A;  3K7A C;  2E2I C;  3S16 K;  3HOV C;  4XSX A;  2B63 K;  5C44 C;  1R9T C;  2E2H K;  4YFX A;  3GTP K;  5IP7 K;  4A93 C;  4A3G C;  4A3L C;  3HOX K;  1SFO C;  5M5Y K;  3M3Y C;  3S2D C;  4LJZ A;  1K83 C;  1I50 K;  5C44 K;  2E2H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...