4Y7NK

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/dna/rna
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y7nK00
4JK1A 3HKZL 1TWCC 1XPPA 3FKIC 3S16C 3I4NC 2PA8D 4A3JC 4A3FC 3HOZC 3PO2K 2NVXC 3RZDC 4YFNA 1SFOK 3H3VD 3S1QK 4A3KK 3HOZK 2E2HK 3GTKK 3RZDK 4ZH4A 2JA6C 4A3GK 5C4XK 4A3EK 5M5XK 2E2HC 3GTKC 4BXXC 3HOXC 4A3KC 2WAQL 4KN7A 5IP9K 4C3IK 2O5IA 1YNJA 5TMFA 1I6HC 1SMYA 2R92K 1I3QC 4MQ9A 2A6HA 1YNNA 3FKIK 4OIPA 4OIRA 3S16K 3S2HK 3S1MK 5C44C 5C4JC 3S14K 2R7ZC 5M3FK 4BBRK 5FLMK 4YFKA 2NVTK 4XLPA 4A3MC 3HOYC 3K7AC 3RZOK 4AYBL 2JA8C 2O5JA 3S17C 5D4DA 2JA5C 1TWAK 5C3EK 5IYBC 3S2DC 3K7AK 4XSXA 3GTQK 1Y1VK 5FLMC 3GTLC 3H3VL 2NVYC 3GTPK 4G7HA 2A69A 3HOWK 2E2JK 5IYBK 3S2DK 1TWFC 4MEYA 1TWAC 2R93K 4X6AC 2PA8L 5C3EC 2CW0A 3GTGK 3GTOK 3HOUK 5IP7C 4A3BC 4X6AK 4BY7C 3EQLA 3PO3K 2E2JC 1I50K 4C2MK 3HOXK 5C44K 4C3JK 3DXJA 2R7ZK 4A3CC 1WCMK 4BXXK 4Q5SA 3M4OK 4NOIA 5IP7K 4A3FK 2YU9K 3M3YC 1HQMA 1TWHC 2JA5K 2JA8K 1I6HK 4A93C 1I3QK 4Y52K 1WCMC 3HOVK 3GTMC 3CQZK 2NVYK 3GTPC 1SFOC 3S1QC 2B63K 5C4JK 5M3MK 3S1MC 4A3EC 1TWGC 4A93K 4LLGA 4XLNA 3GTOC 2BE5A 3HOUC 3S15C 3S1NC 4AYBD 1TWCK 2JA7C 5C4XC 3H0GK 2A68A 5IYCK 4C3HK 1K83C 2B63C 3RZOC 2Y0SL 1I6VA 4A3LK 1Y1VC 3PO3C 3H0GC 5IYCC 2PMZL 1K83K 1Y1WC 4XSZA 3S15K 3S1NK 2JA7K 3M3YK 1TWHK 3M4OC 2NVQK 2YU9C 2JA6K 4QIWD 1TWFK 4MEXA 4BBRC 4A3LC 5IYDK 3CQZC 4BY7K 3HOVC 2A6EA 3GTMK 3PO2C 4QIWL 4YG2A 4A3BK 2WB1L 2NVQC 4BY1C 1BDFA 4Y7NC 3I4MC 1TWGK 2R92C 2WB1D 2PPBA 4A3CK 4KMUA 5FJ8K 4BBSC 4A3IK 4LK1A 3HOWC 1ZYRA 4QJVB 3GTJK 3S1RC 4G7OA 2WAQD 2E2IK 3S14C 4A3DK 1IW7A 4Y52C 2VUMK 4GZYA 1R9TK 4BBSK 4A3JK 4Q4ZA 4KN4A 3S17K 3HKZD 2VUMC 2PMZD 1R9TC 4YFXA 2E2IC 3WODA 4A3DC 4OINA 3GTQC 4OIQA 2Y0SD 3GTLK 3S2HC 5TMCA 4LJZA 4OIOA 4BY1K 5M5WK 3GTGC 4Y7NK 3I4MK 4A3GC 2R93C 3I4NK 4A3MK 3HOYK 1Y1WK 4LK0A 2NVTC 5IP9C 4QJVA 1I50C 3GTJC 4A3IC 4G7ZA 5IYDC 3S1RK 5M5YK 2NVXK
chains in the Genus database with same CATH superfamily
1TWGA 3S16C 1XXBA 1ZQ1C 4A3JC 3HOZC 1C0AA 2NVXC 4YFNA 3AQOA 1SFOK 3RZDK 1L0WA 1F9NA 4LQYA 4GTLA 2E2HC 5L46A 4KN7A 2V6SA 1PJ7A 1EFWA 4BLAA 2A6HA 2EBBA 1YNNA 3S16K 4OIPA 4KM9A 3CQZA 1PJ5A 4G0UA 2NVTK 2ZUEA 3RZOK 2GAHC 4GTAA 2O5JA 1WSRA 3GTQK 1Y1VK 2NVYC 2CFAB 2E2JK 5IYBK 3S2DK 1TWFC 3GIRA 3OREA 3HOUK 5IP7C 4WILA 2E2JC 1O26A 4C2MK 1JOEA 4C3JK 4A3CC 4BXXK 5IP7K 4A3FK 2JA5K 1I6HK 1WCMC 3CQZK 3S1QC 1IQ0A 1ZXOA 3S1MC 1TWGC 3S1NC 4C3HK 3H0GC 5IYCC 1Y1WC 1K83K 3S1NK 3M3YK 1XXCA 2R7ZA 2NVYA 3MMLB 4BY7K 1WOPA 2WB1L 4BY1C 2XCRB 4Y7NC 3I4MC 5IOSA 1TWGK 2R92C 1GE9A 1DCOA 5TJ3A 5FJ8K 4A3IK 4LK1A 3HOWC 3S1RC 4QJVB 2E2IK 4P9SA 3S14C 4Y52C 1USOA 4GZYA 4BBSK 4KN4A 3Q3QA 4WJ3M 4DDQA 2E2IC 3GTPA 1J6XA 3CAGA 2Y0SD 2GSOA 1O2FB 1TWFA 1TWAA 4GTCA 4OIOA 1RU0A 5E68A 5M5WK 1BJTA 1F93A 3GSIA 3BP8C 2GSNA 2V6UA 3GTJC 2D6FC 4A3IC 5JFEA 3S1RK 2XCOA 2FQOA 3HKZL 1TWCC 3FKIC 4PAAA 3SZYA 4ILDA 1BGWA 3TFIA 1VLOA 3AD8C 2Y3PA 3S1QK 2JA6C 2ZFZA 3GTKC 1JQWA 1XZPB 4KASA 4P5BA 3HOXC 4BXXC 1IS1A 2O5IA 3AQPA 1Y1WA 1VH2A 3GTOA 1WORA 3FKIK 4OIRA 3S1MK 1UV7A 5C4JC 2RGRA 2B63A 2R7ZC 4KMHA 5M3FK 4BBRK 4YFKA 5JVOA 4C3HC 3K7AC 2JA8C 5D4DA 4KMAA 2JA5C 4WJ4A 5C3EK 4XSXA 3GTLC 4G7HA 3T00A 5HL8A 1EI6A 1O29A 5C3EC 3GTGA 2R93A 4X6AK 3PO3K 3T02A 3GTQA 2R7ZK 2JA6A 1WQGA 2YU9K 3M3YC 2JH3A 1HQMA 2JA8K 4A93C 4Y52K 3GTMC 1EQRA 3OPFA 5M3MK 1EH1A 1O2AA 1TWCA 4A93K 4XLNA 3GTOC 1XXAA 1ZVUA 2BE5A 2ZUFA 4G0WA 1VGXA 4C3IC 1Y1VC 3PO3C 2PMZL 4XSZA 1I3QA 2GSUA 2JA5A 1TWHK 2NVQK 2YU9C 1ZBSA 3OEPA 3GTKA 5IYDK 2A6EA 4M1XA 3GTMK 1O28A 4A3BK 2NVQC 1IBAA 2WB1D 3N0BA 3FOFA 1ZYRA 3GTJK 1WIHA 3BUEA 3VA7A 2VUMK 1R9TK 3LPXA 5CHPA 3GTMA 1VJEA 2CFAA 5CJ9A 5IOTA 1TWHA 2KWAA 3AD9C 3I4NK 2R93C 1AB4A 1J6VA 4LK0A 2NVXK 3I4NC 1IE0A 1XPPA 1B4BA 3RZDC 1X31C 3A8KA 4A3KK 1SFOA 3H3VD 3ERED 2FQTA 2W7VA 2E2HK 3HOZK 1BS2A 4A3GK 4A3EK 1INNA 1WCMA 4A3KC 4C3IK 4FM9A 3V4GA 2R92K 1I3QC 4MQ9A 3SZZA 3S14K 3GEIA 4AYBL 1B4AA 1TWAK 3A8JA 3S0XA 5IYBC 3S2DC 1I50A 4KMDA 4GFQA 3L4KA 2A69A 1WOOA 3GDZA 1XZPA 1TWAC 3N3YA 2PA8L 2CW0A 3GTOK 1HI9A 2R92A 2VUMA 4A3BC 3LAJA 3EQLA 3GTJA 3A8IA 3HOXK 1WCMK 3M4OK 3G4AA 1TWHC 3TFHA 2PHCB 3GTPC 5C4JK 3LAPA 4LLGA 5C4XC 3S15C 3H0GK 5IYCK 3L4JA 1XZQB 1K83C 2NVXA 3FHZA 3ADAC 3S15K 3M4OC 3IPJA 2E2HA 4BBRC 1V5VA 2GAGC 5EGEA 4QIWL 4YG2A 1J98A 3GEHA 4RMFA 1BDFA 4KB4A 3BP3A 3AD7C 4KMUA 4BBSC 4KARA 1IW7A 4Q4ZA 3WODA 4KC6A 3GTQC 4OIQA 4KM8A 1WSVA 1XZQA 5TMCA 4LJZA 4A3GC 1USMA 1K83A 1O25A 1J6WA 3GEEA 2NVTC 4QJVA 3NUHA 4G7ZA 5IYDC 5M5YK 3TFJA 4JK1A 4KDDA 1O27A 4O2DA 3N0CA 4XCHA 2PA8D 4A3FC 3PO2K 1DD5A 3GTKK 4J3NA 4ZH4A 5C4XK 1JVIA 5M5XK 2YU9A 1ISEA 4C3JC 2WAQL 5IP9K 3JSTA 3H0GA 1YNJA 5TMFA 1I6HC 1SMYA 3FOEA 1F7VA 4FZBA 1EK8A 3S2HK 5C44C 1WQHA 3T01A 5FLMK 1Y1VA 4XLPA 1WOSA 4A3MC 3HOYC 1VRQC 4GTBA 3S17C 4GTDA 4LR2A 3K7AK 1R9TA 3G4CA 5FLMC 3H3VL 4KAWX 3GTPK 4AH6A 3HOWK 4MEYA 4X6AC 2R93K 3FKIA 4C45A 3GTGK 2P5MA 4BY7C 2E2IA 1I50K 5C44K 3DXJA 4Q5SA 4NOIA 5EGHA 1I3QK 1KQ4A 4KB2A 2XCQA 3HOVK 1DCPA 1YX2A 2NVYK 1SFOC 1F7UA 2B63K 5IORA 4GTFA 4A3EC 3TTGA 3HOUC 4AYBD 1TWCK 2JA7C 1G51A 2A68A 3RZOC 2B63C 2Y0SL 3HXAA 1I6VA 4C2MC 4A3LK 2V6TA 4LOWA 4GTEA 2JA7K 1IL2A 2JA6K 4QIWD 1TWFK 3AH5A 4MEXA 3GTLA 4A3LC 3CQZC 1YCLA 3HOVC 3PO2C 1O2BA 4G0VA 2PPBA 4KATA 1WQFA 4A3CK 1O24A 4BLBA 4G7OA 2WAQD 4A3DK 2P8TA 4A3JK 3S17K 4GT9A 3HKZD 4PABA 2VUMC 2PMZD 1R9TC 4YFXA 4A3DC 4OINA 1PJ6A 3GTLK 3S2HC 4BY1K 3GTGC 2RH6A 4Y7NK 3I4MK 2JA7A 4A3MK 3HOYK 4BKWA 1Y1WK 1DCHA 5IP9C 1I50C 4P5AA 3QX3A 5IOQA
chains in the Genus database with same CATH topology
4JK1A 3HKZL 1TWCC 1XPPA 3FKIC 3S16C 3I4NC 2PA8D 4A3JC 4A3FC 3HOZC 3PO2K 2NVXC 3RZDC 4YFNA 1SFOK 3H3VD 3S1QK 4A3KK 3HOZK 2E2HK 3GTKK 3RZDK 4ZH4A 2JA6C 4A3GK 5C4XK 4A3EK 5M5XK 2E2HC 3GTKC 4BXXC 3HOXC 4A3KC 2WAQL 4KN7A 5IP9K 4C3IK 2O5IA 1YNJA 5TMFA 1I6HC 1SMYA 2R92K 1I3QC 4MQ9A 2A6HA 1YNNA 3FKIK 4OIPA 4OIRA 3S16K 3S2HK 3S1MK 5C44C 5C4JC 3S14K 2R7ZC 5M3FK 4BBRK 5FLMK 4YFKA 2NVTK 4XLPA 4A3MC 3HOYC 3K7AC 3RZOK 4AYBL 2JA8C 2O5JA 3S17C 5D4DA 2JA5C 1TWAK 5C3EK 5IYBC 3S2DC 3K7AK 4XSXA 3GTQK 1Y1VK 5FLMC 3GTLC 3H3VL 2NVYC 3GTPK 4G7HA 2A69A 3HOWK 2E2JK 5IYBK 3S2DK 1TWFC 4MEYA 1TWAC 2R93K 4X6AC 2PA8L 5C3EC 2CW0A 3GTGK 3GTOK 3HOUK 5IP7C 4A3BC 4X6AK 4BY7C 3EQLA 3PO3K 2E2JC 1I50K 4C2MK 3HOXK 5C44K 4C3JK 3DXJA 2R7ZK 4A3CC 1WCMK 4BXXK 4Q5SA 3M4OK 4NOIA 5IP7K 4A3FK 2YU9K 3M3YC 1HQMA 1TWHC 2JA5K 2JA8K 1I6HK 4A93C 1I3QK 4Y52K 1WCMC 3HOVK 3GTMC 3CQZK 2NVYK 3GTPC 1SFOC 3S1QC 2B63K 5C4JK 5M3MK 3S1MC 4A3EC 1TWGC 4A93K 4LLGA 4XLNA 3GTOC 2BE5A 3HOUC 3S15C 3S1NC 4AYBD 1TWCK 2JA7C 5C4XC 3H0GK 2A68A 5IYCK 4C3HK 1K83C 2B63C 3RZOC 2Y0SL 1I6VA 4A3LK 1Y1VC 3PO3C 3H0GC 5IYCC 2PMZL 1K83K 1Y1WC 4XSZA 3S15K 3S1NK 2JA7K 3M3YK 1TWHK 3M4OC 2NVQK 2YU9C 2JA6K 4QIWD 1TWFK 4MEXA 4BBRC 4A3LC 5IYDK 3CQZC 4BY7K 3HOVC 2A6EA 3GTMK 3PO2C 4QIWL 4YG2A 4A3BK 2WB1L 2NVQC 4BY1C 1BDFA 4Y7NC 3I4MC 1TWGK 2R92C 2WB1D 2PPBA 4A3CK 4KMUA 5FJ8K 4BBSC 4A3IK 4LK1A 3HOWC 1ZYRA 4QJVB 3GTJK 3S1RC 4G7OA 2WAQD 2E2IK 3S14C 4A3DK 1IW7A 4Y52C 2VUMK 4GZYA 1R9TK 4BBSK 4A3JK 4Q4ZA 4KN4A 3S17K 3HKZD 2VUMC 2PMZD 1R9TC 4YFXA 2E2IC 3WODA 4A3DC 4OINA 3GTQC 4OIQA 2Y0SD 3GTLK 3S2HC 5TMCA 4LJZA 4OIOA 4BY1K 5M5WK 3GTGC 4Y7NK 3I4MK 4A3GC 2R93C 3I4NK 4A3MK 3HOYK 1Y1WK 4LK0A 2NVTC 5IP9C 4QJVA 1I50C 3GTJC 4A3IC 4G7ZA 5IYDC 3S1RK 5M5YK 2NVXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 A;  3HKZ L;  1TWC C;  1XPP A;  3FKI C;  3S16 C;  3I4N C;  2PA8 D;  4A3J C;  4A3F C;  3HOZ C;  3PO2 K;  2NVX C;  3RZD C;  4YFN A;  1SFO K;  3H3V D;  3S1Q K;  4A3K K;  3HOZ K;  2E2H K;  3GTK K;  3RZD K;  4ZH4 A;  2JA6 C;  4A3G K;  5C4X K;  4A3E K;  5M5X K;  2E2H C;  3GTK C;  4BXX C;  3HOX C;  4A3K C;  2WAQ L;  4KN7 A;  5IP9 K;  4C3I K;  2O5I A;  1YNJ A;  5TMF A;  1I6H C;  1SMY A;  2R92 K;  1I3Q C;  4MQ9 A;  2A6H A;  1YNN A;  3FKI K;  4OIP A;  4OIR A;  3S16 K;  3S2H K;  3S1M K;  5C44 C;  5C4J C;  3S14 K;  2R7Z C;  5M3F K;  4BBR K;  5FLM K;  4YFK A;  2NVT K;  4XLP A;  4A3M C;  3HOY C;  3K7A C;  3RZO K;  4AYB L;  2JA8 C;  2O5J A;  3S17 C;  5D4D A;  2JA5 C;  1TWA K;  5C3E K;  5IYB C;  3S2D C;  3K7A K;  4XSX A;  3GTQ K;  1Y1V K;  5FLM C;  3GTL C;  3H3V L;  2NVY C;  3GTP K;  4G7H A;  2A69 A;  3HOW K;  2E2J K;  5IYB K;  3S2D K;  1TWF C;  4MEY A;  1TWA C;  2R93 K;  4X6A C;  2PA8 L;  5C3E C;  2CW0 A;  3GTG K;  3GTO K;  3HOU K;  5IP7 C;  4A3B C;  4X6A K;  4BY7 C;  3EQL A;  3PO3 K;  2E2J C;  1I50 K;  4C2M K;  3HOX K;  5C44 K;  4C3J K;  3DXJ A;  2R7Z K;  4A3C C;  1WCM K;  4BXX K;  4Q5S A;  3M4O K;  4NOI A;  5IP7 K;  4A3F K;  2YU9 K;  3M3Y C;  1HQM A;  1TWH C;  2JA5 K;  2JA8 K;  1I6H K;  4A93 C;  1I3Q K;  4Y52 K;  1WCM C;  3HOV K;  3GTM C;  3CQZ K;  2NVY K;  3GTP C;  1SFO C;  3S1Q C;  2B63 K;  5C4J K;  5M3M K;  3S1M C;  4A3E C;  1TWG C;  4A93 K;  4LLG A;  4XLN A;  3GTO C;  2BE5 A;  3HOU C;  3S15 C;  3S1N C;  4AYB D;  1TWC K;  2JA7 C;  5C4X C;  3H0G K;  2A68 A;  5IYC K;  4C3H K;  1K83 C;  2B63 C;  3RZO C;  2Y0S L;  1I6V A;  4A3L K;  1Y1V C;  3PO3 C;  3H0G C;  5IYC C;  2PMZ L;  1K83 K;  1Y1W C;  4XSZ A;  3S15 K;  3S1N K;  2JA7 K;  3M3Y K;  1TWH K;  3M4O C;  2NVQ K;  2YU9 C;  2JA6 K;  4QIW D;  1TWF K;  4MEX A;  4BBR C;  4A3L C;  5IYD K;  3CQZ C;  4BY7 K;  3HOV C;  2A6E A;  3GTM K;  3PO2 C;  4QIW L;  4YG2 A;  4A3B K;  2WB1 L;  2NVQ C;  4BY1 C;  1BDF A;  4Y7N C;  3I4M C;  1TWG K;  2R92 C;  2WB1 D;  2PPB A;  4A3C K;  4KMU A;  5FJ8 K;  4BBS C;  4A3I K;  4LK1 A;  3HOW C;  1ZYR A;  4QJV B;  3GTJ K;  3S1R C;  4G7O A;  2WAQ D;  2E2I K;  3S14 C;  4A3D K;  1IW7 A;  4Y52 C;  2VUM K;  4GZY A;  1R9T K;  4BBS K;  4A3J K;  4Q4Z A;  4KN4 A;  3S17 K;  3HKZ D;  2VUM C;  2PMZ D;  1R9T C;  4YFX A;  2E2I C;  3WOD A;  4A3D C;  4OIN A;  3GTQ C;  4OIQ A;  2Y0S D;  3GTL K;  3S2H C;  5TMC A;  4LJZ A;  4OIO A;  4BY1 K;  5M5W K;  3GTG C;  4Y7N K;  3I4M K;  4A3G C;  2R93 C;  3I4N K;  4A3M K;  3HOY K;  1Y1W K;  4LK0 A;  2NVT C;  5IP9 C;  4QJV A;  1I50 C;  3GTJ C;  4A3I C;  4G7Z A;  5IYD C;  3S1R K;  5M5Y K;  2NVX K; 
#chains in the Genus database with same CATH topology
 1TWG A;  3S16 C;  1XXB A;  1ZQ1 C;  4A3J C;  3HOZ C;  1C0A A;  2NVX C;  4YFN A;  3AQO A;  1SFO K;  3RZD K;  1L0W A;  1F9N A;  4LQY A;  4GTL A;  2E2H C;  5L46 A;  4KN7 A;  2V6S A;  1PJ7 A;  1EFW A;  4BLA A;  2A6H A;  2EBB A;  1YNN A;  3S16 K;  4OIP A;  4KM9 A;  3CQZ A;  1PJ5 A;  4G0U A;  2NVT K;  2ZUE A;  3RZO K;  2GAH C;  4GTA A;  2O5J A;  1WSR A;  3GTQ K;  1Y1V K;  2NVY C;  2CFA B;  2E2J K;  5IYB K;  3S2D K;  1TWF C;  3GIR A;  3ORE A;  3HOU K;  5IP7 C;  4WIL A;  2E2J C;  1O26 A;  4C2M K;  1JOE A;  4C3J K;  4A3C C;  4BXX K;  5IP7 K;  4A3F K;  2JA5 K;  1I6H K;  1WCM C;  3CQZ K;  3S1Q C;  1IQ0 A;  1ZXO A;  3S1M C;  1TWG C;  3S1N C;  4C3H K;  3H0G C;  5IYC C;  1Y1W C;  1K83 K;  3S1N K;  3M3Y K;  1XXC A;  2R7Z A;  2NVY A;  3MML B;  4BY7 K;  1WOP A;  2WB1 L;  4BY1 C;  2XCR B;  4Y7N C;  3I4M C;  5IOS A;  1TWG K;  2R92 C;  1GE9 A;  1DCO A;  5TJ3 A;  5FJ8 K;  4A3I K;  4LK1 A;  3HOW C;  3S1R C;  4QJV B;  2E2I K;  4P9S A;  3S14 C;  4Y52 C;  1USO A;  4GZY A;  4BBS K;  4KN4 A;  3Q3Q A;  4WJ3 M;  4DDQ A;  2E2I C;  3GTP A;  1J6X A;  3CAG A;  2Y0S D;  2GSO A;  1O2F B;  1TWF A;  1TWA A;  4GTC A;  4OIO A;  1RU0 A;  5E68 A;  5M5W K;  1BJT A;  1F93 A;  3GSI A;  3BP8 C;  2GSN A;  2V6U A;  3GTJ C;  2D6F C;  4A3I C;  5JFE A;  3S1R K;  2XCO A;  2FQO A;  3HKZ L;  1TWC C;  3FKI C;  4PAA A;  3SZY A;  4ILD A;  1BGW A;  3TFI A;  1VLO A;  3AD8 C;  2Y3P A;  3S1Q K;  2JA6 C;  2ZFZ A;  3GTK C;  1JQW A;  1XZP B;  4KAS A;  4P5B A;  3HOX C;  4BXX C;  1IS1 A;  2O5I A;  3AQP A;  1Y1W A;  1VH2 A;  3GTO A;  1WOR A;  3FKI K;  4OIR A;  3S1M K;  1UV7 A;  5C4J C;  2RGR A;  2B63 A;  2R7Z C;  4KMH A;  5M3F K;  4BBR K;  4YFK A;  5JVO A;  4C3H C;  3K7A C;  2JA8 C;  5D4D A;  4KMA A;  2JA5 C;  4WJ4 A;  5C3E K;  4XSX A;  3GTL C;  4G7H A;  3T00 A;  5HL8 A;  1EI6 A;  1O29 A;  5C3E C;  3GTG A;  2R93 A;  4X6A K;  3PO3 K;  3T02 A;  3GTQ A;  2R7Z K;  2JA6 A;  1WQG A;  2YU9 K;  3M3Y C;  2JH3 A;  1HQM A;  2JA8 K;  4A93 C;  4Y52 K;  3GTM C;  1EQR A;  3OPF A;  5M3M K;  1EH1 A;  1O2A A;  1TWC A;  4A93 K;  4XLN A;  3GTO C;  1XXA A;  1ZVU A;  2BE5 A;  2ZUF A;  4G0W A;  1VGX A;  4C3I C;  1Y1V C;  3PO3 C;  2PMZ L;  4XSZ A;  1I3Q A;  2GSU A;  2JA5 A;  1TWH K;  2NVQ K;  2YU9 C;  1ZBS A;  3OEP A;  3GTK A;  5IYD K;  2A6E A;  4M1X A;  3GTM K;  1O28 A;  4A3B K;  2NVQ C;  1IBA A;  2WB1 D;  3N0B A;  3FOF A;  1ZYR A;  3GTJ K;  1WIH A;  3BUE A;  3VA7 A;  2VUM K;  1R9T K;  3LPX A;  5CHP A;  3GTM A;  1VJE A;  2CFA A;  5CJ9 A;  5IOT A;  1TWH A;  2KWA A;  3AD9 C;  3I4N K;  2R93 C;  1AB4 A;  1J6V A;  4LK0 A;  2NVX K;  3I4N C;  1IE0 A;  1XPP A;  1B4B A;  3RZD C;  1X31 C;  3A8K A;  4A3K K;  1SFO A;  3H3V D;  3ERE D;  2FQT A;  2W7V A;  2E2H K;  3HOZ K;  1BS2 A;  4A3G K;  4A3E K;  1INN A;  1WCM A;  4A3K C;  4C3I K;  4FM9 A;  3V4G A;  2R92 K;  1I3Q C;  4MQ9 A;  3SZZ A;  3S14 K;  3GEI A;  4AYB L;  1B4A A;  1TWA K;  3A8J A;  3S0X A;  5IYB C;  3S2D C;  1I50 A;  4KMD A;  4GFQ A;  3L4K A;  2A69 A;  1WOO A;  3GDZ A;  1XZP A;  1TWA C;  3N3Y A;  2PA8 L;  2CW0 A;  3GTO K;  1HI9 A;  2R92 A;  2VUM A;  4A3B C;  3LAJ A;  3EQL A;  3GTJ A;  3A8I A;  3HOX K;  1WCM K;  3M4O K;  3G4A A;  1TWH C;  3TFH A;  2PHC B;  3GTP C;  5C4J K;  3LAP A;  4LLG A;  5C4X C;  3S15 C;  3H0G K;  5IYC K;  3L4J A;  1XZQ B;  1K83 C;  2NVX A;  3FHZ A;  3ADA C;  3S15 K;  3M4O C;  3IPJ A;  2E2H A;  4BBR C;  1V5V A;  2GAG C;  5EGE A;  4QIW L;  4YG2 A;  1J98 A;  3GEH A;  4RMF A;  1BDF A;  4KB4 A;  3BP3 A;  3AD7 C;  4KMU A;  4BBS C;  4KAR A;  1IW7 A;  4Q4Z A;  3WOD A;  4KC6 A;  3GTQ C;  4OIQ A;  4KM8 A;  1WSV A;  1XZQ A;  5TMC A;  4LJZ A;  4A3G C;  1USM A;  1K83 A;  1O25 A;  1J6W A;  3GEE A;  2NVT C;  4QJV A;  3NUH A;  4G7Z A;  5IYD C;  5M5Y K;  3TFJ A;  4JK1 A;  4KDD A;  1O27 A;  4O2D A;  3N0C A;  4XCH A;  2PA8 D;  4A3F C;  3PO2 K;  1DD5 A;  3GTK K;  4J3N A;  4ZH4 A;  5C4X K;  1JVI A;  5M5X K;  2YU9 A;  1ISE A;  4C3J C;  2WAQ L;  5IP9 K;  3JST A;  3H0G A;  1YNJ A;  5TMF A;  1I6H C;  1SMY A;  3FOE A;  1F7V A;  4FZB A;  1EK8 A;  3S2H K;  5C44 C;  1WQH A;  3T01 A;  5FLM K;  1Y1V A;  4XLP A;  1WOS A;  4A3M C;  3HOY C;  1VRQ C;  4GTB A;  3S17 C;  4GTD A;  4LR2 A;  3K7A K;  1R9T A;  3G4C A;  5FLM C;  3H3V L;  4KAW X;  3GTP K;  4AH6 A;  3HOW K;  4MEY A;  4X6A C;  2R93 K;  3FKI A;  4C45 A;  3GTG K;  2P5M A;  4BY7 C;  2E2I A;  1I50 K;  5C44 K;  3DXJ A;  4Q5S A;  4NOI A;  5EGH A;  1I3Q K;  1KQ4 A;  4KB2 A;  2XCQ A;  3HOV K;  1DCP A;  1YX2 A;  2NVY K;  1SFO C;  1F7U A;  2B63 K;  5IOR A;  4GTF A;  4A3E C;  3TTG A;  3HOU C;  4AYB D;  1TWC K;  2JA7 C;  1G51 A;  2A68 A;  3RZO C;  2B63 C;  2Y0S L;  3HXA A;  1I6V A;  4C2M C;  4A3L K;  2V6T A;  4LOW A;  4GTE A;  2JA7 K;  1IL2 A;  2JA6 K;  4QIW D;  1TWF K;  3AH5 A;  4MEX A;  3GTL A;  4A3L C;  3CQZ C;  1YCL A;  3HOV C;  3PO2 C;  1O2B A;  4G0V A;  2PPB A;  4KAT A;  1WQF A;  4A3C K;  1O24 A;  4BLB A;  4G7O A;  2WAQ D;  4A3D K;  2P8T A;  4A3J K;  3S17 K;  4GT9 A;  3HKZ D;  4PAB A;  2VUM C;  2PMZ D;  1R9T C;  4YFX A;  4A3D C;  4OIN A;  1PJ6 A;  3GTL K;  3S2H C;  4BY1 K;  3GTG C;  2RH6 A;  4Y7N K;  3I4M K;  2JA7 A;  4A3M K;  3HOY K;  4BKW A;  1Y1W K;  1DCH A;  5IP9 C;  1I50 C;  4P5A A;  3QX3 A;  5IOQ A; 
#chains in the Genus database with same CATH homology
 4JK1 A;  3HKZ L;  1TWC C;  1XPP A;  3FKI C;  3S16 C;  3I4N C;  2PA8 D;  4A3J C;  4A3F C;  3HOZ C;  3PO2 K;  2NVX C;  3RZD C;  4YFN A;  1SFO K;  3H3V D;  3S1Q K;  4A3K K;  3HOZ K;  2E2H K;  3GTK K;  3RZD K;  4ZH4 A;  2JA6 C;  4A3G K;  5C4X K;  4A3E K;  5M5X K;  2E2H C;  3GTK C;  4BXX C;  3HOX C;  4A3K C;  2WAQ L;  4KN7 A;  5IP9 K;  4C3I K;  2O5I A;  1YNJ A;  5TMF A;  1I6H C;  1SMY A;  2R92 K;  1I3Q C;  4MQ9 A;  2A6H A;  1YNN A;  3FKI K;  4OIP A;  4OIR A;  3S16 K;  3S2H K;  3S1M K;  5C44 C;  5C4J C;  3S14 K;  2R7Z C;  5M3F K;  4BBR K;  5FLM K;  4YFK A;  2NVT K;  4XLP A;  4A3M C;  3HOY C;  3K7A C;  3RZO K;  4AYB L;  2JA8 C;  2O5J A;  3S17 C;  5D4D A;  2JA5 C;  1TWA K;  5C3E K;  5IYB C;  3S2D C;  3K7A K;  4XSX A;  3GTQ K;  1Y1V K;  5FLM C;  3GTL C;  3H3V L;  2NVY C;  3GTP K;  4G7H A;  2A69 A;  3HOW K;  2E2J K;  5IYB K;  3S2D K;  1TWF C;  4MEY A;  1TWA C;  2R93 K;  4X6A C;  2PA8 L;  5C3E C;  2CW0 A;  3GTG K;  3GTO K;  3HOU K;  5IP7 C;  4A3B C;  4X6A K;  4BY7 C;  3EQL A;  3PO3 K;  2E2J C;  1I50 K;  4C2M K;  3HOX K;  5C44 K;  4C3J K;  3DXJ A;  2R7Z K;  4A3C C;  1WCM K;  4BXX K;  4Q5S A;  3M4O K;  4NOI A;  5IP7 K;  4A3F K;  2YU9 K;  3M3Y C;  1HQM A;  1TWH C;  2JA5 K;  2JA8 K;  1I6H K;  4A93 C;  1I3Q K;  4Y52 K;  1WCM C;  3HOV K;  3GTM C;  3CQZ K;  2NVY K;  3GTP C;  1SFO C;  3S1Q C;  2B63 K;  5C4J K;  5M3M K;  3S1M C;  4A3E C;  1TWG C;  4A93 K;  4LLG A;  4XLN A;  3GTO C;  2BE5 A;  3HOU C;  3S15 C;  3S1N C;  4AYB D;  1TWC K;  2JA7 C;  5C4X C;  3H0G K;  2A68 A;  5IYC K;  4C3H K;  1K83 C;  2B63 C;  3RZO C;  2Y0S L;  1I6V A;  4A3L K;  1Y1V C;  3PO3 C;  3H0G C;  5IYC C;  2PMZ L;  1K83 K;  1Y1W C;  4XSZ A;  3S15 K;  3S1N K;  2JA7 K;  3M3Y K;  1TWH K;  3M4O C;  2NVQ K;  2YU9 C;  2JA6 K;  4QIW D;  1TWF K;  4MEX A;  4BBR C;  4A3L C;  5IYD K;  3CQZ C;  4BY7 K;  3HOV C;  2A6E A;  3GTM K;  3PO2 C;  4QIW L;  4YG2 A;  4A3B K;  2WB1 L;  2NVQ C;  4BY1 C;  1BDF A;  4Y7N C;  3I4M C;  1TWG K;  2R92 C;  2WB1 D;  2PPB A;  4A3C K;  4KMU A;  5FJ8 K;  4BBS C;  4A3I K;  4LK1 A;  3HOW C;  1ZYR A;  4QJV B;  3GTJ K;  3S1R C;  4G7O A;  2WAQ D;  2E2I K;  3S14 C;  4A3D K;  1IW7 A;  4Y52 C;  2VUM K;  4GZY A;  1R9T K;  4BBS K;  4A3J K;  4Q4Z A;  4KN4 A;  3S17 K;  3HKZ D;  2VUM C;  2PMZ D;  1R9T C;  4YFX A;  2E2I C;  3WOD A;  4A3D C;  4OIN A;  3GTQ C;  4OIQ A;  2Y0S D;  3GTL K;  3S2H C;  5TMC A;  4LJZ A;  4OIO A;  4BY1 K;  5M5W K;  3GTG C;  4Y7N K;  3I4M K;  4A3G C;  2R93 C;  3I4N K;  4A3M K;  3HOY K;  1Y1W K;  4LK0 A;  2NVT C;  5IP9 C;  4QJV A;  1I50 C;  3GTJ C;  4A3I C;  4G7Z A;  5IYD C;  3S1R K;  5M5Y K;  2NVX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...