4QIWL

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 21
structure length 94
sequence length 94
chains with identical sequence U
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qiwL00
5FJ8K 3GTOK 2PPBA 3S17C 2PMZL 1TWGC 2A69A 4C3HK 1TWFC 4A3BC 2JA5C 3FKIC 3HOYK 3CQZC 3S15C 5C3EK 3H3VD 2NVYC 2YU9K 3M4OK 5C4XC 2PA8L 2R93K 1TWFK 4BY1K 4A93K 4KN4A 5IP9K 2NVXK 5C3EC 1TWCC 2O5JA 2PMZD 1Y1VC 2WAQD 4A3EC 4BY1C 4OINA 3I4MK 4YG2A 5IP7C 4A3DK 1TWCK 2CW0A 1TWHK 2WB1D 4LLGA 4A3EK 1SMYA 3GTPC 3I4MC 4C3IK 4OIQA 1I3QK 4Y7NC 1Y1WC 3S1MK 2R92C 4MEXA 4A3LK 5IYBK 4G7ZA 4A3GK 4JK1A 3GTPK 3HKZD 4Y52C 4G7OA 3EQLA 1I3QC 4C2MK 4BBRK 4Y7NK 4A3MC 4MQ9A 3HOYC 4OIOA 3M4OC 4QJVA 2NVTC 4XLPA 2NVQK 2O5IA 4BY7C 4LJZA 1WCMC 3H0GC 1I50K 1SFOC 3HOWK 3S1NC 4BY7K 5IYDC 4YFKA 2E2HK 3S14C 4A3KK 3RZOC 4A3DC 3HOWC 3HOZC 3S1QC 4A3CK 3M3YK 5M5YK 3PO3C 2E2HC 1YNJA 3HOXC 5IYDK 5M5WK 4Q4ZA 3FKIK 5IYCK 2JA7K 3S15K 4A3BK 2JA8C 3HOUK 4QIWD 5FLMC 1I6HK 5IYBC 2R93C 3S17K 3HOXK 1BDFA 4Y52K 5IP9C 2Y0SL 2JA8K 1TWAC 4XSZA 3GTKK 3S1RC 5C4XK 3PO2K 2BE5A 5TMCA 1TWAK 5C4JC 3RZDC 4A93C 4LK1A 1WCMK 3H0GK 1I50C 4QIWL 3HKZL 4AYBD 3DXJA 2A68A 5D4DA 3GTJC 3GTLK 1YNNA 1IW7A 4C3JK 3S1NK 4QJVB 4ZH4A 4X6AK 2R92K 4A3IK 3K7AK 3WODA 4A3JK 2JA6K 2B63K 3H3VL 3M3YC 3PO3K 1TWHC 2A6HA 5C44C 2PA8D 2VUMC 3GTMC 3S2HC 4X6AC 4OIRA 3GTQK 4BBSK 4AYBL 3S1MC 4A3LC 5FLMK 3HOVC 1I6HC 4A3GC 5C44K 2VUMK 4YFXA 5M5XK 3GTQC 4BBSC 2NVYK 4BBRC 4G7HA 4A3MK 2YU9C 3S1RK 3S16C 2NVTK 4A3KC 1TWGK 2A6EA 2WB1L 3RZOK 1ZYRA 4XSXA 5M3FK 2JA5K 1K83C 2E2JK 4OIPA 5IYCC 2JA7C 3S14K 1SFOK 1R9TC 3K7AC 4A3JC 2JA6C 1HQMA 2Y0SD 2R7ZC 2B63C 4A3FK 4BXXC 2R7ZK 2WAQL 1Y1WK 5IP7K 3GTOC 3HOUC 3HOVK 4YFNA 4MEYA 3PO2C 4A3FC 2E2IK 3S2DK 4BXXK 5TMFA 3CQZK 3GTKC 3S16K 4NOIA 2NVQC 2E2IC 3GTGK 3S2DC 3I4NC 4KN7A 4A3IC 2NVXC 5C4JK 3RZDK 1Y1VK 1K83K 5M3MK 2E2JC 3GTJK 3GTGC 3GTLC 3I4NK 3GTMK 1XPPA 3S2HK 4GZYA 4KMUA 3HOZK 4LK0A 3S1QK 4A3CC 4Q5SA 4XLNA 1R9TK 1I6VA
chains in the Genus database with same CATH superfamily
2CFAB 1R9TA 1INNA 4GTAA 2PPBA 1JVIA 5L46A 4FZBA 1TWFC 1O2FB 1TWGA 4ILDA 2JA5C 3CAGA 3HOYK 3M4OK 3LPXA 3H3VD 2JA5A 4P5BA 5C4XC 4KATA 1ZQ1C 3S0XA 2NVXK 2PMZD 1Y1VC 5IP7C 4XCHA 2CW0A 3HXAA 2WB1D 3GTPC 1SMYA 4C3JC 4OIQA 1I3QK 3NUHA 3LAPA 2ZUEA 4G7ZA 4A3GK 2P5MA 3BP3A 4C3IC 4MQ9A 3HOYC 4OIOA 3M4OC 2NVTC 4XLPA 2NVQK 4C2MC 4LJZA 1I50K 1DCPA 1DD5A 3FKIA 3GTPA 3S1NC 4YFKA 3S14C 4A3KK 3HOWC 4BLAA 3M3YK 5M5YK 2E2HC 3AD9C 4GTFA 2JA8C 3AH5A 1I6HK 3S17K 3HOXK 1BDFA 1V5VA 3A8JA 4Y52K 3GTLA 4KMDA 3S1RC 1VGXA 5IOTA 4GTDA 3PO2K 1XXBA 1WCMK 4QIWL 3GTJC 3GTLK 2XCRB 3TFHA 4ZH4A 4X6AK 4KDDA 2R92K 3K7AK 3WODA 1WQGA 2JA6K 2B63K 1ISEA 3M3YC 1HI9A 1TWHC 2VUMC 3S2HC 1IQ0A 3ADAC 4AYBL 4A3LC 3GSIA 1USOA 4YFXA 2NVYK 4G7HA 3G4CA 1O24A 4GTCA 2NVTK 5E68A 3IPJA 2KWAA 1XXCA 4GTLA 3ERED 5IYCC 1BJTA 1R9TC 3K7AC 2JA6C 2Y0SD 4FM9A 2XCQA 4C45A 5IP7K 3GTOC 4YFNA 4A3FC 2E2IK 4BXXK 1IS1A 5IOQA 2NVQC 1EK8A 4BKWA 4A3IC 2NVXC 1EQRA 3N0BA 5C4JK 1YCLA 3GTQA 1K83K 5EGHA 5M3MK 2RGRA 3S2HK 1XPPA 4GZYA 4KMUA 3HOZK 1SFOC 3L4KA 1I6VA 2R92A 3SZZA 4C3HC 2R7ZA 1XZPB 1DCHA 3FKIC 1DCOA 3S15C 2YU9K 2NVYA 4KARA 1B4AA 1TWCC 2O5JA 1J6XA 1F9NA 3A8IA 4A3EC 1J98A 4KMHA 1BS2A 4YG2A 1G51A 1WQFA 2B63A 3TTGA 1YX2A 1XZPA 4GTBA 4LR2A 4MEXA 5IYBK 3EQLA 4C2MK 3LAJA 1WSRA 1PJ5A 2O5IA 4BY7C 4GT9A 4BLBA 5IYDC 3S1QC 4RMFA 1X31C 5JFEA 4LQYA 2JA7A 1YNJA 2ZUFA 4Q4ZA 3FKIK 3S15K 1C0AA 1I50A 4QIWD 2GSUA 4GFQA 1J6WA 2Y0SL 2JA8K 5C4XK 5TMCA 1TWAK 3AQOA 3BP8C 4WJ3M 3S1NK 1YNNA 3GTOA 2XCOA 4A3IK 5IORA 3OREA 3PO3K 3T01A 2A6HA 5C44C 2JH3A 2PA8D 1O29A 1O2AA 1Y1VA 4A3GC 2VUMK 2E2IA 1TWFA 3GTQC 4GTEA 4BBSC 3S1RK 1TWGK 2WB1L 3GEHA 2E2JK 1SFOA 3QX3A 4A3JC 1PJ7A 2GSNA 3BUEA 1WIHA 1PJ6A 3GTJA 3OPFA 4KMAA 1Y1WK 2Y3PA 5EGEA 2EBBA 1VRQC 4KC6A 3GTKC 4KASA 5CJ9A 2PHCB 3GTJK 3GTLC 1Y1WA 3A8KA 3SZYA 4Q5SA 5FJ8K 3FOEA 3JSTA 3GTOK 3S17C 2PMZL 4WILA 1EFWA 1TWGC 3H0GA 4C3HK 2V6SA 1O28A 3CQZC 1F93A 5C3EK 1WOOA 1TWFK 4A93K 4KN4A 3FOFA 5IP9K 3I4MK 1O26A 3GEEA 1TWHK 4LLGA 3I4MC 4C3IK 4A3LK 2R92C 3T02A 3HKZD 5CHPA 1I3QC 4BBRK 4A3MC 1ZXOA 4DDQA 3TFIA 5HL8A 3T00A 3OEPA 1WCMC 1EH1A 1XZQB 3V4GA 4A3CK 1WOSA 5IYDK 3HOXC 5IYCK 3HOUK 3GTGA 3CQZA 4XSZA 4LOWA 5C4JC 4KB4A 2P8TA 4LK1A 1L0WA 4AYBD 1I50C 3HKZL 2GSOA 2A68A 5D4DA 1IW7A 4KM8A 1VJEA 4QJVB 2GAHC 3H3VL 4KAWX 4X6AC 3GTMC 1TWHA 4O2DA 4OIRA 3GTQK 1EI6A 4BBSK 1I6HC 5M5XK 2YU9C 2R93A 3S16C 1KQ4A 4A3KC 2A6EA 3TFJA 4XSXA 5JVOA 4PAAA 5M3FK 2JA5K 1O2BA 4J3NA 4KB2A 3GIRA 1SFOK 1HQMA 2B63C 4PABA 2WAQL 3AD7C 3GEIA 3HOUC 1USMA 3HOVK 4MEYA 5TMFA 1VLOA 3S16K 3N0CA 2E2IC 3I4NC 2FQOA 3Q3QA 2E2JC 3GTGC 1F7UA 3GTMK 3S1QK 4LK0A 4A3CC 1R9TK 2D6FC 3N3YA 2A69A 5TJ3A 1WCMA 4A3BC 2NVYC 1WOPA 2PA8L 2R93K 4BY1K 2CFAA 4G0VA 4M1XA 5C3EC 1F7VA 2WAQD 1JOEA 3FHZA 4BY1C 4OINA 1ZBSA 4A3DK 2E2HA 1TWCK 2JA6A 4A3EK 4Y7NC 1Y1WC 3S1MK 1XZQA 4JK1A 3GTPK 4Y52C 4G7OA 4Y7NK 1WSVA 1VH2A 4QJVA 3H0GC 3AQPA 3HOWK 3MMLB 1WORA 2VUMA 4WJ4A 4BY7K 5IOSA 2E2HK 3RZOC 2GAGC 4A3DC 1GE9A 3HOZC 3GTMA 2V6TA 3L4JA 3PO3C 1JQWA 1BGWA 1O25A 5M5WK 4A3BK 2JA7K 4G0UA 2ZFZA 1AB4A 5FLMC 4G0WA 1IBAA 5IYBC 2YU9A 2R93C 3G4AA 2FQTA 5IP9C 1O27A 1TWAC 3GTKK 1TWAA 1B4BA 2BE5A 3RZDC 4A93C 3GTKA 3H0GK 1I3QA 3DXJA 4C3JK 4A3JK 1IL2A 1ZVUA 3S1MC 5FLMK 3HOVC 1TWCA 5C44K 2NVXA 2V6UA 3GDZA 4BBRC 4A3MK 2W7VA 3RZOK 4AH6A 1XXAA 1ZYRA 1K83C 1IE0A 2RH6A 4OIPA 2JA7C 3S14K 2R7ZC 1J6VA 4A3FK 4BXXC 1WQHA 3PO2C 3S2DK 4KM9A 3VA7A 3CQZK 3AD8C 1K83A 4P9SA 4NOIA 1RU0A 3S2DC 3GTGK 4KN7A 3RZDK 1Y1VK 3I4NK 4P5AA 4XLNA 2R7ZK 1UV7A
chains in the Genus database with same CATH topology
5FJ8K 3GTOK 2PPBA 3S17C 2PMZL 1TWGC 2A69A 4C3HK 1TWFC 4A3BC 2JA5C 3FKIC 3HOYK 3CQZC 3S15C 5C3EK 3H3VD 2NVYC 2YU9K 3M4OK 5C4XC 2PA8L 2R93K 1TWFK 4BY1K 4A93K 4KN4A 5IP9K 2NVXK 5C3EC 1TWCC 2O5JA 2PMZD 1Y1VC 2WAQD 4A3EC 4BY1C 4OINA 3I4MK 4YG2A 5IP7C 4A3DK 1TWCK 2CW0A 1TWHK 2WB1D 4LLGA 4A3EK 1SMYA 3GTPC 3I4MC 4C3IK 4OIQA 1I3QK 4Y7NC 1Y1WC 3S1MK 2R92C 4MEXA 4A3LK 5IYBK 4G7ZA 4A3GK 4JK1A 3GTPK 3HKZD 4Y52C 4G7OA 3EQLA 1I3QC 4C2MK 4BBRK 4Y7NK 4A3MC 4MQ9A 3HOYC 4OIOA 3M4OC 4QJVA 2NVTC 4XLPA 2NVQK 2O5IA 4BY7C 4LJZA 1WCMC 3H0GC 1I50K 1SFOC 3HOWK 3S1NC 4BY7K 5IYDC 4YFKA 2E2HK 3S14C 4A3KK 3RZOC 4A3DC 3HOWC 3HOZC 3S1QC 4A3CK 3M3YK 5M5YK 3PO3C 2E2HC 1YNJA 3HOXC 5IYDK 5M5WK 4Q4ZA 3FKIK 5IYCK 2JA7K 3S15K 4A3BK 2JA8C 3HOUK 4QIWD 5FLMC 1I6HK 5IYBC 2R93C 3S17K 3HOXK 1BDFA 4Y52K 5IP9C 2Y0SL 2JA8K 1TWAC 4XSZA 3GTKK 3S1RC 5C4XK 3PO2K 2BE5A 5TMCA 1TWAK 5C4JC 3RZDC 4A93C 4LK1A 1WCMK 3H0GK 1I50C 4QIWL 3HKZL 4AYBD 3DXJA 2A68A 5D4DA 3GTJC 3GTLK 1YNNA 1IW7A 4C3JK 3S1NK 4QJVB 4ZH4A 4X6AK 2R92K 4A3IK 3K7AK 3WODA 4A3JK 2JA6K 2B63K 3H3VL 3M3YC 3PO3K 1TWHC 2A6HA 5C44C 2PA8D 2VUMC 3GTMC 3S2HC 4X6AC 4OIRA 3GTQK 4BBSK 4AYBL 3S1MC 4A3LC 5FLMK 3HOVC 1I6HC 4A3GC 5C44K 2VUMK 4YFXA 5M5XK 3GTQC 4BBSC 2NVYK 4BBRC 4G7HA 4A3MK 2YU9C 3S1RK 3S16C 2NVTK 4A3KC 1TWGK 2A6EA 2WB1L 3RZOK 1ZYRA 4XSXA 5M3FK 2JA5K 1K83C 2E2JK 4OIPA 5IYCC 2JA7C 3S14K 1SFOK 1R9TC 3K7AC 4A3JC 2JA6C 1HQMA 2Y0SD 2R7ZC 2B63C 4A3FK 4BXXC 2R7ZK 2WAQL 1Y1WK 5IP7K 3GTOC 3HOUC 3HOVK 4YFNA 4MEYA 3PO2C 4A3FC 2E2IK 3S2DK 4BXXK 5TMFA 3CQZK 3GTKC 3S16K 4NOIA 2NVQC 2E2IC 3GTGK 3S2DC 3I4NC 4KN7A 4A3IC 2NVXC 5C4JK 3RZDK 1Y1VK 1K83K 5M3MK 2E2JC 3GTJK 3GTGC 3GTLC 3I4NK 3GTMK 1XPPA 3S2HK 4GZYA 4KMUA 3HOZK 4LK0A 3S1QK 4A3CC 4Q5SA 4XLNA 1R9TK 1I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 K;  3GTO K;  2PPB A;  3S17 C;  2PMZ L;  1TWG C;  2A69 A;  4C3H K;  1TWF C;  4A3B C;  2JA5 C;  3FKI C;  3HOY K;  3CQZ C;  3S15 C;  5C3E K;  3H3V D;  2NVY C;  2YU9 K;  3M4O K;  5C4X C;  2PA8 L;  2R93 K;  1TWF K;  4BY1 K;  4A93 K;  4KN4 A;  5IP9 K;  2NVX K;  5C3E C;  1TWC C;  2O5J A;  2PMZ D;  1Y1V C;  2WAQ D;  4A3E C;  4BY1 C;  4OIN A;  3I4M K;  4YG2 A;  5IP7 C;  4A3D K;  1TWC K;  2CW0 A;  1TWH K;  2WB1 D;  4LLG A;  4A3E K;  1SMY A;  3GTP C;  3I4M C;  4C3I K;  4OIQ A;  1I3Q K;  4Y7N C;  1Y1W C;  3S1M K;  2R92 C;  4MEX A;  4A3L K;  5IYB K;  4G7Z A;  4A3G K;  4JK1 A;  3GTP K;  3HKZ D;  4Y52 C;  4G7O A;  3EQL A;  1I3Q C;  4C2M K;  4BBR K;  4Y7N K;  4A3M C;  4MQ9 A;  3HOY C;  4OIO A;  3M4O C;  4QJV A;  2NVT C;  4XLP A;  2NVQ K;  2O5I A;  4BY7 C;  4LJZ A;  1WCM C;  3H0G C;  1I50 K;  1SFO C;  3HOW K;  3S1N C;  4BY7 K;  5IYD C;  4YFK A;  2E2H K;  3S14 C;  4A3K K;  3RZO C;  4A3D C;  3HOW C;  3HOZ C;  3S1Q C;  4A3C K;  3M3Y K;  5M5Y K;  3PO3 C;  2E2H C;  1YNJ A;  3HOX C;  5IYD K;  5M5W K;  4Q4Z A;  3FKI K;  5IYC K;  2JA7 K;  3S15 K;  4A3B K;  2JA8 C;  3HOU K;  4QIW D;  5FLM C;  1I6H K;  5IYB C;  2R93 C;  3S17 K;  3HOX K;  1BDF A;  4Y52 K;  5IP9 C;  2Y0S L;  2JA8 K;  1TWA C;  4XSZ A;  3GTK K;  3S1R C;  5C4X K;  3PO2 K;  2BE5 A;  5TMC A;  1TWA K;  5C4J C;  3RZD C;  4A93 C;  4LK1 A;  1WCM K;  3H0G K;  1I50 C;  4QIW L;  3HKZ L;  4AYB D;  3DXJ A;  2A68 A;  5D4D A;  3GTJ C;  3GTL K;  1YNN A;  1IW7 A;  4C3J K;  3S1N K;  4QJV B;  4ZH4 A;  4X6A K;  2R92 K;  4A3I K;  3K7A K;  3WOD A;  4A3J K;  2JA6 K;  2B63 K;  3H3V L;  3M3Y C;  3PO3 K;  1TWH C;  2A6H A;  5C44 C;  2PA8 D;  2VUM C;  3GTM C;  3S2H C;  4X6A C;  4OIR A;  3GTQ K;  4BBS K;  4AYB L;  3S1M C;  4A3L C;  5FLM K;  3HOV C;  1I6H C;  4A3G C;  5C44 K;  2VUM K;  4YFX A;  5M5X K;  3GTQ C;  4BBS C;  2NVY K;  4BBR C;  4G7H A;  4A3M K;  2YU9 C;  3S1R K;  3S16 C;  2NVT K;  4A3K C;  1TWG K;  2A6E A;  2WB1 L;  3RZO K;  1ZYR A;  4XSX A;  5M3F K;  2JA5 K;  1K83 C;  2E2J K;  4OIP A;  5IYC C;  2JA7 C;  3S14 K;  1SFO K;  1R9T C;  3K7A C;  4A3J C;  2JA6 C;  1HQM A;  2Y0S D;  2R7Z C;  2B63 C;  4A3F K;  4BXX C;  2R7Z K;  2WAQ L;  1Y1W K;  5IP7 K;  3GTO C;  3HOU C;  3HOV K;  4YFN A;  4MEY A;  3PO2 C;  4A3F C;  2E2I K;  3S2D K;  4BXX K;  5TMF A;  3CQZ K;  3GTK C;  3S16 K;  4NOI A;  2NVQ C;  2E2I C;  3GTG K;  3S2D C;  3I4N C;  4KN7 A;  4A3I C;  2NVX C;  5C4J K;  3RZD K;  1Y1V K;  1K83 K;  5M3M K;  2E2J C;  3GTJ K;  3GTG C;  3GTL C;  3I4N K;  3GTM K;  1XPP A;  3S2H K;  4GZY A;  4KMU A;  3HOZ K;  4LK0 A;  3S1Q K;  4A3C C;  4Q5S A;  4XLN A;  1R9T K;  1I6V A; 
#chains in the Genus database with same CATH topology
 2CFA B;  1R9T A;  1INN A;  4GTA A;  2PPB A;  1JVI A;  5L46 A;  4FZB A;  1TWF C;  1O2F B;  1TWG A;  4ILD A;  2JA5 C;  3CAG A;  3HOY K;  3M4O K;  3LPX A;  3H3V D;  2JA5 A;  4P5B A;  5C4X C;  4KAT A;  1ZQ1 C;  3S0X A;  2NVX K;  2PMZ D;  1Y1V C;  5IP7 C;  4XCH A;  2CW0 A;  3HXA A;  2WB1 D;  3GTP C;  1SMY A;  4C3J C;  4OIQ A;  1I3Q K;  3NUH A;  3LAP A;  2ZUE A;  4G7Z A;  4A3G K;  2P5M A;  3BP3 A;  4C3I C;  4MQ9 A;  3HOY C;  4OIO A;  3M4O C;  2NVT C;  4XLP A;  2NVQ K;  4C2M C;  4LJZ A;  1I50 K;  1DCP A;  1DD5 A;  3FKI A;  3GTP A;  3S1N C;  4YFK A;  3S14 C;  4A3K K;  3HOW C;  4BLA A;  3M3Y K;  5M5Y K;  2E2H C;  3AD9 C;  4GTF A;  2JA8 C;  3AH5 A;  1I6H K;  3S17 K;  3HOX K;  1BDF A;  1V5V A;  3A8J A;  4Y52 K;  3GTL A;  4KMD A;  3S1R C;  1VGX A;  5IOT A;  4GTD A;  3PO2 K;  1XXB A;  1WCM K;  4QIW L;  3GTJ C;  3GTL K;  2XCR B;  3TFH A;  4ZH4 A;  4X6A K;  4KDD A;  2R92 K;  3K7A K;  3WOD A;  1WQG A;  2JA6 K;  2B63 K;  1ISE A;  3M3Y C;  1HI9 A;  1TWH C;  2VUM C;  3S2H C;  1IQ0 A;  3ADA C;  4AYB L;  4A3L C;  3GSI A;  1USO A;  4YFX A;  2NVY K;  4G7H A;  3G4C A;  1O24 A;  4GTC A;  2NVT K;  5E68 A;  3IPJ A;  2KWA A;  1XXC A;  4GTL A;  3ERE D;  5IYC C;  1BJT A;  1R9T C;  3K7A C;  2JA6 C;  2Y0S D;  4FM9 A;  2XCQ A;  4C45 A;  5IP7 K;  3GTO C;  4YFN A;  4A3F C;  2E2I K;  4BXX K;  1IS1 A;  5IOQ A;  2NVQ C;  1EK8 A;  4BKW A;  4A3I C;  2NVX C;  1EQR A;  3N0B A;  5C4J K;  1YCL A;  3GTQ A;  1K83 K;  5EGH A;  5M3M K;  2RGR A;  3S2H K;  1XPP A;  4GZY A;  4KMU A;  3HOZ K;  1SFO C;  3L4K A;  1I6V A;  2R92 A;  3SZZ A;  4C3H C;  2R7Z A;  1XZP B;  1DCH A;  3FKI C;  1DCO A;  3S15 C;  2YU9 K;  2NVY A;  4KAR A;  1B4A A;  1TWC C;  2O5J A;  1J6X A;  1F9N A;  3A8I A;  4A3E C;  1J98 A;  4KMH A;  1BS2 A;  4YG2 A;  1G51 A;  1WQF A;  2B63 A;  3TTG A;  1YX2 A;  1XZP A;  4GTB A;  4LR2 A;  4MEX A;  5IYB K;  3EQL A;  4C2M K;  3LAJ A;  1WSR A;  1PJ5 A;  2O5I A;  4BY7 C;  4GT9 A;  4BLB A;  5IYD C;  3S1Q C;  4RMF A;  1X31 C;  5JFE A;  4LQY A;  2JA7 A;  1YNJ A;  2ZUF A;  4Q4Z A;  3FKI K;  3S15 K;  1C0A A;  1I50 A;  4QIW D;  2GSU A;  4GFQ A;  1J6W A;  2Y0S L;  2JA8 K;  5C4X K;  5TMC A;  1TWA K;  3AQO A;  3BP8 C;  4WJ3 M;  3S1N K;  1YNN A;  3GTO A;  2XCO A;  4A3I K;  5IOR A;  3ORE A;  3PO3 K;  3T01 A;  2A6H A;  5C44 C;  2JH3 A;  2PA8 D;  1O29 A;  1O2A A;  1Y1V A;  4A3G C;  2VUM K;  2E2I A;  1TWF A;  3GTQ C;  4GTE A;  4BBS C;  3S1R K;  1TWG K;  2WB1 L;  3GEH A;  2E2J K;  1SFO A;  3QX3 A;  4A3J C;  1PJ7 A;  2GSN A;  3BUE A;  1WIH A;  1PJ6 A;  3GTJ A;  3OPF A;  4KMA A;  1Y1W K;  2Y3P A;  5EGE A;  2EBB A;  1VRQ C;  4KC6 A;  3GTK C;  4KAS A;  5CJ9 A;  2PHC B;  3GTJ K;  3GTL C;  1Y1W A;  3A8K A;  3SZY A;  4Q5S A;  5FJ8 K;  3FOE A;  3JST A;  3GTO K;  3S17 C;  2PMZ L;  4WIL A;  1EFW A;  1TWG C;  3H0G A;  4C3H K;  2V6S A;  1O28 A;  3CQZ C;  1F93 A;  5C3E K;  1WOO A;  1TWF K;  4A93 K;  4KN4 A;  3FOF A;  5IP9 K;  3I4M K;  1O26 A;  3GEE A;  1TWH K;  4LLG A;  3I4M C;  4C3I K;  4A3L K;  2R92 C;  3T02 A;  3HKZ D;  5CHP A;  1I3Q C;  4BBR K;  4A3M C;  1ZXO A;  4DDQ A;  3TFI A;  5HL8 A;  3T00 A;  3OEP A;  1WCM C;  1EH1 A;  1XZQ B;  3V4G A;  4A3C K;  1WOS A;  5IYD K;  3HOX C;  5IYC K;  3HOU K;  3GTG A;  3CQZ A;  4XSZ A;  4LOW A;  5C4J C;  4KB4 A;  2P8T A;  4LK1 A;  1L0W A;  4AYB D;  1I50 C;  3HKZ L;  2GSO A;  2A68 A;  5D4D A;  1IW7 A;  4KM8 A;  1VJE A;  4QJV B;  2GAH C;  3H3V L;  4KAW X;  4X6A C;  3GTM C;  1TWH A;  4O2D A;  4OIR A;  3GTQ K;  1EI6 A;  4BBS K;  1I6H C;  5M5X K;  2YU9 C;  2R93 A;  3S16 C;  1KQ4 A;  4A3K C;  2A6E A;  3TFJ A;  4XSX A;  5JVO A;  4PAA A;  5M3F K;  2JA5 K;  1O2B A;  4J3N A;  4KB2 A;  3GIR A;  1SFO K;  1HQM A;  2B63 C;  4PAB A;  2WAQ L;  3AD7 C;  3GEI A;  3HOU C;  1USM A;  3HOV K;  4MEY A;  5TMF A;  1VLO A;  3S16 K;  3N0C A;  2E2I C;  3I4N C;  2FQO A;  3Q3Q A;  2E2J C;  3GTG C;  1F7U A;  3GTM K;  3S1Q K;  4LK0 A;  4A3C C;  1R9T K;  2D6F C;  3N3Y A;  2A69 A;  5TJ3 A;  1WCM A;  4A3B C;  2NVY C;  1WOP A;  2PA8 L;  2R93 K;  4BY1 K;  2CFA A;  4G0V A;  4M1X A;  5C3E C;  1F7V A;  2WAQ D;  1JOE A;  3FHZ A;  4BY1 C;  4OIN A;  1ZBS A;  4A3D K;  2E2H A;  1TWC K;  2JA6 A;  4A3E K;  4Y7N C;  1Y1W C;  3S1M K;  1XZQ A;  4JK1 A;  3GTP K;  4Y52 C;  4G7O A;  4Y7N K;  1WSV A;  1VH2 A;  4QJV A;  3H0G C;  3AQP A;  3HOW K;  3MML B;  1WOR A;  2VUM A;  4WJ4 A;  4BY7 K;  5IOS A;  2E2H K;  3RZO C;  2GAG C;  4A3D C;  1GE9 A;  3HOZ C;  3GTM A;  2V6T A;  3L4J A;  3PO3 C;  1JQW A;  1BGW A;  1O25 A;  5M5W K;  4A3B K;  2JA7 K;  4G0U A;  2ZFZ A;  1AB4 A;  5FLM C;  4G0W A;  1IBA A;  5IYB C;  2YU9 A;  2R93 C;  3G4A A;  2FQT A;  5IP9 C;  1O27 A;  1TWA C;  3GTK K;  1TWA A;  1B4B A;  2BE5 A;  3RZD C;  4A93 C;  3GTK A;  3H0G K;  1I3Q A;  3DXJ A;  4C3J K;  4A3J K;  1IL2 A;  1ZVU A;  3S1M C;  5FLM K;  3HOV C;  1TWC A;  5C44 K;  2NVX A;  2V6U A;  3GDZ A;  4BBR C;  4A3M K;  2W7V A;  3RZO K;  4AH6 A;  1XXA A;  1ZYR A;  1K83 C;  1IE0 A;  2RH6 A;  4OIP A;  2JA7 C;  3S14 K;  2R7Z C;  1J6V A;  4A3F K;  4BXX C;  1WQH A;  3PO2 C;  3S2D K;  4KM9 A;  3VA7 A;  3CQZ K;  3AD8 C;  1K83 A;  4P9S A;  4NOI A;  1RU0 A;  3S2D C;  3GTG K;  4KN7 A;  3RZD K;  1Y1V K;  3I4N K;  4P5A A;  4XLN A;  2R7Z K;  1UV7 A; 
#chains in the Genus database with same CATH homology
 5FJ8 K;  3GTO K;  2PPB A;  3S17 C;  2PMZ L;  1TWG C;  2A69 A;  4C3H K;  1TWF C;  4A3B C;  2JA5 C;  3FKI C;  3HOY K;  3CQZ C;  3S15 C;  5C3E K;  3H3V D;  2NVY C;  2YU9 K;  3M4O K;  5C4X C;  2PA8 L;  2R93 K;  1TWF K;  4BY1 K;  4A93 K;  4KN4 A;  5IP9 K;  2NVX K;  5C3E C;  1TWC C;  2O5J A;  2PMZ D;  1Y1V C;  2WAQ D;  4A3E C;  4BY1 C;  4OIN A;  3I4M K;  4YG2 A;  5IP7 C;  4A3D K;  1TWC K;  2CW0 A;  1TWH K;  2WB1 D;  4LLG A;  4A3E K;  1SMY A;  3GTP C;  3I4M C;  4C3I K;  4OIQ A;  1I3Q K;  4Y7N C;  1Y1W C;  3S1M K;  2R92 C;  4MEX A;  4A3L K;  5IYB K;  4G7Z A;  4A3G K;  4JK1 A;  3GTP K;  3HKZ D;  4Y52 C;  4G7O A;  3EQL A;  1I3Q C;  4C2M K;  4BBR K;  4Y7N K;  4A3M C;  4MQ9 A;  3HOY C;  4OIO A;  3M4O C;  4QJV A;  2NVT C;  4XLP A;  2NVQ K;  2O5I A;  4BY7 C;  4LJZ A;  1WCM C;  3H0G C;  1I50 K;  1SFO C;  3HOW K;  3S1N C;  4BY7 K;  5IYD C;  4YFK A;  2E2H K;  3S14 C;  4A3K K;  3RZO C;  4A3D C;  3HOW C;  3HOZ C;  3S1Q C;  4A3C K;  3M3Y K;  5M5Y K;  3PO3 C;  2E2H C;  1YNJ A;  3HOX C;  5IYD K;  5M5W K;  4Q4Z A;  3FKI K;  5IYC K;  2JA7 K;  3S15 K;  4A3B K;  2JA8 C;  3HOU K;  4QIW D;  5FLM C;  1I6H K;  5IYB C;  2R93 C;  3S17 K;  3HOX K;  1BDF A;  4Y52 K;  5IP9 C;  2Y0S L;  2JA8 K;  1TWA C;  4XSZ A;  3GTK K;  3S1R C;  5C4X K;  3PO2 K;  2BE5 A;  5TMC A;  1TWA K;  5C4J C;  3RZD C;  4A93 C;  4LK1 A;  1WCM K;  3H0G K;  1I50 C;  4QIW L;  3HKZ L;  4AYB D;  3DXJ A;  2A68 A;  5D4D A;  3GTJ C;  3GTL K;  1YNN A;  1IW7 A;  4C3J K;  3S1N K;  4QJV B;  4ZH4 A;  4X6A K;  2R92 K;  4A3I K;  3K7A K;  3WOD A;  4A3J K;  2JA6 K;  2B63 K;  3H3V L;  3M3Y C;  3PO3 K;  1TWH C;  2A6H A;  5C44 C;  2PA8 D;  2VUM C;  3GTM C;  3S2H C;  4X6A C;  4OIR A;  3GTQ K;  4BBS K;  4AYB L;  3S1M C;  4A3L C;  5FLM K;  3HOV C;  1I6H C;  4A3G C;  5C44 K;  2VUM K;  4YFX A;  5M5X K;  3GTQ C;  4BBS C;  2NVY K;  4BBR C;  4G7H A;  4A3M K;  2YU9 C;  3S1R K;  3S16 C;  2NVT K;  4A3K C;  1TWG K;  2A6E A;  2WB1 L;  3RZO K;  1ZYR A;  4XSX A;  5M3F K;  2JA5 K;  1K83 C;  2E2J K;  4OIP A;  5IYC C;  2JA7 C;  3S14 K;  1SFO K;  1R9T C;  3K7A C;  4A3J C;  2JA6 C;  1HQM A;  2Y0S D;  2R7Z C;  2B63 C;  4A3F K;  4BXX C;  2R7Z K;  2WAQ L;  1Y1W K;  5IP7 K;  3GTO C;  3HOU C;  3HOV K;  4YFN A;  4MEY A;  3PO2 C;  4A3F C;  2E2I K;  3S2D K;  4BXX K;  5TMF A;  3CQZ K;  3GTK C;  3S16 K;  4NOI A;  2NVQ C;  2E2I C;  3GTG K;  3S2D C;  3I4N C;  4KN7 A;  4A3I C;  2NVX C;  5C4J K;  3RZD K;  1Y1V K;  1K83 K;  5M3M K;  2E2J C;  3GTJ K;  3GTG C;  3GTL C;  3I4N K;  3GTM K;  1XPP A;  3S2H K;  4GZY A;  4KMU A;  3HOZ K;  4LK0 A;  3S1Q K;  4A3C C;  4Q5S A;  4XLN A;  1R9T K;  1I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...