4QIWL

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
total genus 21
structure length 94
sequence length 94
chains with identical sequence U
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qiwL00
3HOWK 4AYBD 1TWAC 3S1NK 4BXXC 3S2DK 5IP9K 3FKIK 2VUMK 3H0GK 5IP9C 5M5YK 3GTQC 2CW0A 4A3IC 3M4OK 2A68A 2WB1D 3K7AC 4KMUA 5FLMC 2PMZL 5IYCK 4G7ZA 3GTLK 3GTPK 3GTOK 3M4OC 3S2HK 1K83K 4QIWL 1I50K 5FJ8K 2PPBA 4XLNA 2JA6K 3S15K 4A3BC 4QJVB 5C4JK 3HOUK 5C4JC 3HOYC 4JK1A 4OIOA 1SFOK 1I6VA 2Y0SD 1SFOC 2JA5K 2B63K 3HKZL 3S14K 2NVTK 3HOVC 2E2HC 2JA7K 3S1QK 4BY1C 2JA7C 5M3FK 3S1MK 2NVXC 3RZOK 4LJZA 1TWHK 5D4DA 1HQMA 4C2MK 1Y1VK 4MEYA 2R92K 3GTMK 2R92C 3GTJC 3GTMC 4A3FK 3H3VD 2JA8C 2BE5A 1TWAK 4OIRA 1TWCC 4BXXK 4A3KK 4A3KC 1R9TC 2NVQC 3GTQK 4MEXA 1TWGK 5IYDC 4A3IK 4NOIA 1TWGC 3K7AK 1BDFA 5FLMK 2E2IC 2A6EA 5M5WK 2PA8D 4OIQA 2A6HA 4C3JK 2Y0SL 1TWFK 4Q4ZA 3RZDC 4KN4A 1TWFC 4YFXA 3S1RC 4XSZA 3PO3C 4A3BK 4YFNA 4ZH4A 3S17C 4A3MC 3HOYK 4G7HA 1ZYRA 4A3LC 2R7ZC 2E2JK 4C3HK 4LK0A 2E2JC 3HOVK 2E2HK 3H3VL 4Q5SA 5TMCA 4BY1K 3S16C 2R93K 2NVXK 2WAQD 3CQZC 4AYBL 5TMFA 5IYBC 4Y7NC 4A3CC 4GZYA 2A69A 4A3EK 5M5XK 5C4XC 4A3EC 3I4NC 4A3DC 3GTJK 4A3JC 2WB1L 4YG2A 2JA8K 2PA8L 3I4MK 1TWCK 4A3GC 3I4MC 4C3IK 3GTKC 4LLGA 1IW7A 1R9TK 2NVQK 5IYDK 1YNJA 2O5JA 2E2IK 4OIPA 4Y52C 2YU9C 3RZDK 3GTGK 3S1RK 3PO3K 3GTGC 4XLPA 4OINA 4BBSC 5IP7C 3S17K 4A3MK 4QJVA 4A3LK 2R7ZK 3PO2C 1I6HC 5C3EK 5C3EC 4BY7C 3S16K 4X6AC 3CQZK 4Y7NK 5IYBK 4A3CK 1WCMC 3S2HC 1Y1WK 4G7OA 1Y1WC 5C4XK 5C44C 3I4NK 4KN7A 3HOWC 4A3DK 4A3JK 5M3MK 3S1NC 3S2DC 1YNNA 3FKIC 3DXJA 3H0GC 3WODA 2VUMC 3HOZC 3HOZK 4A3GK 2O5IA 4MQ9A 3GTKK 3GTPC 3GTOC 5IYCC 3GTLC 2R93C 1K83C 1I3QK 1I50C 2JA6C 3S15C 1I3QC 4Y52K 3HOXK 2YU9K 1SMYA 3HOXC 3HOUC 4BBRK 3EQLA 2PMZD 4BBRC 4QIWD 4BBSK 5IP7K 2JA5C 3M3YK 2B63C 3M3YC 3S14C 2WAQL 2NVTC 4A93K 1I6HK 2NVYK 3PO2K 4YFKA 3S1QC 2NVYC 4A93C 1XPPA 3S1MC 4LK1A 3RZOC 4BY7K 1TWHC 4X6AK 3HKZD 1Y1VC 1WCMK 4A3FC 5C44K 4XSXA
chains in the Genus database with same CATH superfamily
3HOWK 1K83A 2JA6A 3S0XA 5M5YK 3GTQC 3M4OK 2A68A 1BGWA 3S2HC 1K83K 2XCQA 3Q3QA 2JA6K 3HXAA 1IS1A 4XLNA 1RU0A 5JVOA 3LAPA 3LPXA 1TWHA 1SFOK 1I6VA 2Y0SD 3S14K 1F7UA 2JA7K 1TWAA 1TWHK 1DD5A 2R92C 3GTJC 3GTMC 1TWAK 4BXXK 1INNA 4A3KC 2ZFZA 1J6XA 4J3NA 5IOQA 5IYDC 4GTDA 5M5WK 1TWFK 1UV7A 3RZDC 4A3BK 2E2HA 4XSZA 1USOA 3S17C 4A3MC 3HOYK 4GTCA 3GSIA 4C3HK 5EGHA 4G0UA 2JH3A 2E2JC 2E2HK 3H3VL 4BY1K 4KMHA 1TWCA 1EH1A 2WAQD 1R9TA 1PJ5A 2GAGC 4A3EK 1TWGA 2E2IA 2WB1L 1VJEA 2JA8K 2XCRB 2PA8L 1TWCK 3GTKC 1O28A 1R9TK 2E2IK 3T00A 1ZVUA 4GTAA 2YU9C 3AD7C 3GTGC 1B4AA 5IP7C 4QJVA 3FOFA 4KARA 3VA7A 5JFEA 1ZBSA 3FHZA 4X6AC 4Y7NK 2V6TA 4XCHA 3G4AA 4KMDA 4KN7A 3T02A 3S1NC 1DCHA 3S2DC 3FKIC 3OREA 1WQFA 1WSRA 1XZPA 1C0AA 3BP3A 3GTOC 5IYCC 3GTLC 2R93C 1I50C 1I3QC 1SMYA 3HOUC 4BBSK 3M3YK 2NVTC 4GT9A 1Y1WA 3PO2K 4A93C 2NVYC 3OEPA 4KMAA 4BY7K 3SZZA 3GTPA 4KAWX 5C44K 4XSXA 1ZQ1C 2CW0A 4A3IC 1DCOA 5FLMC 3GTPK 2PMZL 3S2HK 3GEHA 4QIWL 3BUEA 5FJ8K 2PPBA 3S15K 1YCLA 1EK8A 3N3YA 1EQRA 4C45A 4G0VA 4OIOA 1GE9A 3CAGA 3HOVC 3S1QK 5M3FK 3S1MK 2NVXC 1ISEA 3RZOK 4BLAA 3GIRA 2R92K 3GTMK 1V5VA 4A3FK 4KATA 2BE5A 4A3KK 4C3IC 2XCOA 2NVQC 1O25A 5TJ3A 3K7AK 1JQWA 2A6HA 4C3JK 2Y0SL 1SFOA 4Q4ZA 4KN4A 4YFXA 3S1RC 3PO3C 4YFNA 2JA7A 4BLBA 4G7HA 3AQPA 2R7ZC 2E2JK 2V6UA 4M1XA 3CQZC 4AYBL 4GZYA 2A69A 2GAHC 2FQOA 4WILA 1ZXOA 4ILDA 4A3GC 3L4KA 1JOEA 1TWFA 1F93A 3IPJA 4PAAA 1EI6A 1YNJA 2GSUA 3GEIA 1WORA 2RGRA 2O5JA 3N0CA 4GTLA 4OIPA 2ZUFA 4WJ4A 1VH2A 2GSOA 3GTGK 2PHCB 2P5MA 1PJ7A 4A3LK 3S16K 4A3CK 1VLOA 5IYBK 4G7OA 5C4XK 3I4NK 3HOWC 4A3DK 4A3JK 1YNNA 1BJTA 4MQ9A 1O2FB 1K83C 1I3QK 2JA6C 4Y52K 4GTFA 1WQHA 3HOXC 3A8KA 4BBRC 2ZUEA 2GSNA 1WCMA 3S14C 4A93K 1F7VA 2NVYK 1I6HK 2KWAA 1XPPA 4LK1A 2VUMA 1TWHC 3H0GA 3HKZD 5IORA 1WCMK 4BKWA 1X31C 1TWAC 1O27A 4BXXC 1IBAA 1XZQB 2VUMK 3H0GK 5IP9C 3A8JA 2WB1D 4KMUA 4G7ZA 3T01A 2JA5A 3AD9C 2B63A 4A3BC 4DDQA 5C4JC 3HOYC 1O2BA 1B4BA 4JK1A 1DCPA 2JA5K 1Y1VA 4C3HC 2B63K 1BS2A 2E2HC 4BY1C 1EFWA 4LJZA 1HQMA 3N0BA 3GTQA 4C2MC 1Y1VK 4MEYA 3TFIA 4KDDA 2JA8C 4GTBA 1TWCC 1R9TC 3GTQK 4MEXA 4NOIA 1TWGC 1BDFA 4O2DA 2E2IC 4OIQA 2P8TA 4LK0A 1USMA 3GTJA 3GTMA 2R92A 3SZYA 4LQYA 3NUHA 4Y7NC 5TMFA 4KB4A 5M5XK 3GTJK 3V4GA 3MMLB 1L0WA 3LAJA 2CFAA 3I4MC 3QX3A 4G0WA 5IYDK 1VRQC 4RMFA 4AH6A 3RZDK 1O29A 1YX2A 4XLPA 4KM9A 4OINA 4BBSC 3S17K 1XXCA 4A3MK 3GEEA 4FM9A 3PO2C 5C3EC 4BY7C 1J6VA 1XXAA 1O26A 3GTKA 1Y1WC 3L4JA 5C44C 5L46A 5M3MK 4PABA 1IQ0A 3DXJA 2YU9A 1VGXA 3HOZC 1WQGA 3GTKK 3GTPC 3GTGA 1WIHA 3S15C 1HI9A 3HOXK 2YU9K 4BBRK 3EQLA 3TFJA 3ADAC 5IP7K 4WJ3M 2WAQL 4KB2A 3S1QC 3FOEA 2Y3PA 3RZOC 5IOTA 3S1MC 3FKIA 5CJ9A 4X6AK 1J6WA 4A3FC 3GTOA 3GTLA 3JSTA 2R93A 4AYBD 1I50A 3S1NK 1I3QA 3S2DK 3AD8C 5IP9K 3FKIK 4P9SA 3AH5A 3K7AC 3A8IA 4GTEA 3GTOK 1AB4A 5IYCK 3M4OC 3GTLK 2R93K 1I50K 4C3JC 4QJVB 2FQTA 5C4JK 3HOUK 2NVYA 1SFOC 3HKZL 5HL8A 2RH6A 2NVTK 1WOOA 3BP8C 2JA7C 5D4DA 4C2MK 1WSVA 3H3VD 1XZPB 4OIRA 1TWGK 4A3IK 5FLMK 2A6EA 1F9NA 2PA8D 1KQ4A 1WOSA 1TWFC 3AQOA 1O2AA 4ZH4A 2NVXA 1ZYRA 4A3LC 5E68A 4FZBA 3HOVK 2EBBA 4Q5SA 4KM8A 5TMCA 3S16C 2NVXK 4A3CC 5IYBC 5C4XC 4A3EC 3I4NC 4A3DC 4A3JC 4YG2A 3I4MK 4C3IK 4LLGA 1IW7A 4P5AA 2NVQK 4GFQA 4LR2A 3TFHA 4Y52C 1XZQA 2R7ZA 3ERED 3S1RK 3PO3K 3CQZA 2R7ZK 1I6HC 5C3EK 1IE0A 5IOSA 2CFAB 3CQZK 4KC6A 1WCMC 1WOPA 1Y1WK 1O24A 1PJ6A 5CHPA 4KASA 2VUMC 3HOZK 3H0GC 3WODA 4A3GK 2O5IA 4P5BA 1XXBA 1G51A 5EGEA 3OPFA 4LOWA 3TTGA 2PMZD 1J98A 2D6FC 4QIWD 2JA5C 2V6SA 2B63C 3M3YC 4YFKA 3GDZA 2W7VA 1IL2A 3G4CA 1Y1VC 1JVIA
chains in the Genus database with same CATH topology
3HOWK 4AYBD 1TWAC 3S1NK 4BXXC 3S2DK 5IP9K 3FKIK 2VUMK 3H0GK 5IP9C 5M5YK 3GTQC 2CW0A 4A3IC 3M4OK 2A68A 2WB1D 3K7AC 4KMUA 5FLMC 2PMZL 5IYCK 4G7ZA 3GTLK 3GTPK 3GTOK 3M4OC 3S2HK 1K83K 4QIWL 1I50K 5FJ8K 2PPBA 4XLNA 2JA6K 3S15K 4A3BC 4QJVB 5C4JK 3HOUK 5C4JC 3HOYC 4JK1A 4OIOA 1SFOK 1I6VA 2Y0SD 1SFOC 2JA5K 2B63K 3HKZL 3S14K 2NVTK 3HOVC 2E2HC 2JA7K 3S1QK 4BY1C 2JA7C 5M3FK 3S1MK 2NVXC 3RZOK 4LJZA 1TWHK 5D4DA 1HQMA 4C2MK 1Y1VK 4MEYA 2R92K 3GTMK 2R92C 3GTJC 3GTMC 4A3FK 3H3VD 2JA8C 2BE5A 1TWAK 4OIRA 1TWCC 4BXXK 4A3KK 4A3KC 1R9TC 2NVQC 3GTQK 4MEXA 1TWGK 5IYDC 4A3IK 4NOIA 1TWGC 3K7AK 1BDFA 5FLMK 2E2IC 2A6EA 5M5WK 2PA8D 4OIQA 2A6HA 4C3JK 2Y0SL 1TWFK 4Q4ZA 3RZDC 4KN4A 1TWFC 4YFXA 3S1RC 4XSZA 3PO3C 4A3BK 4YFNA 4ZH4A 3S17C 4A3MC 3HOYK 4G7HA 1ZYRA 4A3LC 2R7ZC 2E2JK 4C3HK 4LK0A 2E2JC 3HOVK 2E2HK 3H3VL 4Q5SA 5TMCA 4BY1K 3S16C 2R93K 2NVXK 2WAQD 3CQZC 4AYBL 5TMFA 5IYBC 4Y7NC 4A3CC 4GZYA 2A69A 4A3EK 5M5XK 5C4XC 4A3EC 3I4NC 4A3DC 3GTJK 4A3JC 2WB1L 4YG2A 2JA8K 2PA8L 3I4MK 1TWCK 4A3GC 3I4MC 4C3IK 3GTKC 4LLGA 1IW7A 1R9TK 2NVQK 5IYDK 1YNJA 2O5JA 2E2IK 4OIPA 4Y52C 2YU9C 3RZDK 3GTGK 3S1RK 3PO3K 3GTGC 4XLPA 4OINA 4BBSC 5IP7C 3S17K 4A3MK 4QJVA 4A3LK 2R7ZK 3PO2C 1I6HC 5C3EK 5C3EC 4BY7C 3S16K 4X6AC 3CQZK 4Y7NK 5IYBK 4A3CK 1WCMC 3S2HC 1Y1WK 4G7OA 1Y1WC 5C4XK 5C44C 3I4NK 4KN7A 3HOWC 4A3DK 4A3JK 5M3MK 3S1NC 3S2DC 1YNNA 3FKIC 3DXJA 3H0GC 3WODA 2VUMC 3HOZC 3HOZK 4A3GK 2O5IA 4MQ9A 3GTKK 3GTPC 3GTOC 5IYCC 3GTLC 2R93C 1K83C 1I3QK 1I50C 2JA6C 3S15C 1I3QC 4Y52K 3HOXK 2YU9K 1SMYA 3HOXC 3HOUC 4BBRK 3EQLA 2PMZD 4BBRC 4QIWD 4BBSK 5IP7K 2JA5C 3M3YK 2B63C 3M3YC 3S14C 2WAQL 2NVTC 4A93K 1I6HK 2NVYK 3PO2K 4YFKA 3S1QC 2NVYC 4A93C 1XPPA 3S1MC 4LK1A 3RZOC 4BY7K 1TWHC 4X6AK 3HKZD 1Y1VC 1WCMK 4A3FC 5C44K 4XSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW K;  4AYB D;  1TWA C;  3S1N K;  4BXX C;  3S2D K;  5IP9 K;  3FKI K;  2VUM K;  3H0G K;  5IP9 C;  5M5Y K;  3GTQ C;  2CW0 A;  4A3I C;  3M4O K;  2A68 A;  2WB1 D;  3K7A C;  4KMU A;  5FLM C;  2PMZ L;  5IYC K;  4G7Z A;  3GTL K;  3GTP K;  3GTO K;  3M4O C;  3S2H K;  1K83 K;  4QIW L;  1I50 K;  5FJ8 K;  2PPB A;  4XLN A;  2JA6 K;  3S15 K;  4A3B C;  4QJV B;  5C4J K;  3HOU K;  5C4J C;  3HOY C;  4JK1 A;  4OIO A;  1SFO K;  1I6V A;  2Y0S D;  1SFO C;  2JA5 K;  2B63 K;  3HKZ L;  3S14 K;  2NVT K;  3HOV C;  2E2H C;  2JA7 K;  3S1Q K;  4BY1 C;  2JA7 C;  5M3F K;  3S1M K;  2NVX C;  3RZO K;  4LJZ A;  1TWH K;  5D4D A;  1HQM A;  4C2M K;  1Y1V K;  4MEY A;  2R92 K;  3GTM K;  2R92 C;  3GTJ C;  3GTM C;  4A3F K;  3H3V D;  2JA8 C;  2BE5 A;  1TWA K;  4OIR A;  1TWC C;  4BXX K;  4A3K K;  4A3K C;  1R9T C;  2NVQ C;  3GTQ K;  4MEX A;  1TWG K;  5IYD C;  4A3I K;  4NOI A;  1TWG C;  3K7A K;  1BDF A;  5FLM K;  2E2I C;  2A6E A;  5M5W K;  2PA8 D;  4OIQ A;  2A6H A;  4C3J K;  2Y0S L;  1TWF K;  4Q4Z A;  3RZD C;  4KN4 A;  1TWF C;  4YFX A;  3S1R C;  4XSZ A;  3PO3 C;  4A3B K;  4YFN A;  4ZH4 A;  3S17 C;  4A3M C;  3HOY K;  4G7H A;  1ZYR A;  4A3L C;  2R7Z C;  2E2J K;  4C3H K;  4LK0 A;  2E2J C;  3HOV K;  2E2H K;  3H3V L;  4Q5S A;  5TMC A;  4BY1 K;  3S16 C;  2R93 K;  2NVX K;  2WAQ D;  3CQZ C;  4AYB L;  5TMF A;  5IYB C;  4Y7N C;  4A3C C;  4GZY A;  2A69 A;  4A3E K;  5M5X K;  5C4X C;  4A3E C;  3I4N C;  4A3D C;  3GTJ K;  4A3J C;  2WB1 L;  4YG2 A;  2JA8 K;  2PA8 L;  3I4M K;  1TWC K;  4A3G C;  3I4M C;  4C3I K;  3GTK C;  4LLG A;  1IW7 A;  1R9T K;  2NVQ K;  5IYD K;  1YNJ A;  2O5J A;  2E2I K;  4OIP A;  4Y52 C;  2YU9 C;  3RZD K;  3GTG K;  3S1R K;  3PO3 K;  3GTG C;  4XLP A;  4OIN A;  4BBS C;  5IP7 C;  3S17 K;  4A3M K;  4QJV A;  4A3L K;  2R7Z K;  3PO2 C;  1I6H C;  5C3E K;  5C3E C;  4BY7 C;  3S16 K;  4X6A C;  3CQZ K;  4Y7N K;  5IYB K;  4A3C K;  1WCM C;  3S2H C;  1Y1W K;  4G7O A;  1Y1W C;  5C4X K;  5C44 C;  3I4N K;  4KN7 A;  3HOW C;  4A3D K;  4A3J K;  5M3M K;  3S1N C;  3S2D C;  1YNN A;  3FKI C;  3DXJ A;  3H0G C;  3WOD A;  2VUM C;  3HOZ C;  3HOZ K;  4A3G K;  2O5I A;  4MQ9 A;  3GTK K;  3GTP C;  3GTO C;  5IYC C;  3GTL C;  2R93 C;  1K83 C;  1I3Q K;  1I50 C;  2JA6 C;  3S15 C;  1I3Q C;  4Y52 K;  3HOX K;  2YU9 K;  1SMY A;  3HOX C;  3HOU C;  4BBR K;  3EQL A;  2PMZ D;  4BBR C;  4QIW D;  4BBS K;  5IP7 K;  2JA5 C;  3M3Y K;  2B63 C;  3M3Y C;  3S14 C;  2WAQ L;  2NVT C;  4A93 K;  1I6H K;  2NVY K;  3PO2 K;  4YFK A;  3S1Q C;  2NVY C;  4A93 C;  1XPP A;  3S1M C;  4LK1 A;  3RZO C;  4BY7 K;  1TWH C;  4X6A K;  3HKZ D;  1Y1V C;  1WCM K;  4A3F C;  5C44 K;  4XSX A; 
#chains in the Genus database with same CATH topology
 3HOW K;  1K83 A;  2JA6 A;  3S0X A;  5M5Y K;  3GTQ C;  3M4O K;  2A68 A;  1BGW A;  3S2H C;  1K83 K;  2XCQ A;  3Q3Q A;  2JA6 K;  3HXA A;  1IS1 A;  4XLN A;  1RU0 A;  5JVO A;  3LAP A;  3LPX A;  1TWH A;  1SFO K;  1I6V A;  2Y0S D;  3S14 K;  1F7U A;  2JA7 K;  1TWA A;  1TWH K;  1DD5 A;  2R92 C;  3GTJ C;  3GTM C;  1TWA K;  4BXX K;  1INN A;  4A3K C;  2ZFZ A;  1J6X A;  4J3N A;  5IOQ A;  5IYD C;  4GTD A;  5M5W K;  1TWF K;  1UV7 A;  3RZD C;  4A3B K;  2E2H A;  4XSZ A;  1USO A;  3S17 C;  4A3M C;  3HOY K;  4GTC A;  3GSI A;  4C3H K;  5EGH A;  4G0U A;  2JH3 A;  2E2J C;  2E2H K;  3H3V L;  4BY1 K;  4KMH A;  1TWC A;  1EH1 A;  2WAQ D;  1R9T A;  1PJ5 A;  2GAG C;  4A3E K;  1TWG A;  2E2I A;  2WB1 L;  1VJE A;  2JA8 K;  2XCR B;  2PA8 L;  1TWC K;  3GTK C;  1O28 A;  1R9T K;  2E2I K;  3T00 A;  1ZVU A;  4GTA A;  2YU9 C;  3AD7 C;  3GTG C;  1B4A A;  5IP7 C;  4QJV A;  3FOF A;  4KAR A;  3VA7 A;  5JFE A;  1ZBS A;  3FHZ A;  4X6A C;  4Y7N K;  2V6T A;  4XCH A;  3G4A A;  4KMD A;  4KN7 A;  3T02 A;  3S1N C;  1DCH A;  3S2D C;  3FKI C;  3ORE A;  1WQF A;  1WSR A;  1XZP A;  1C0A A;  3BP3 A;  3GTO C;  5IYC C;  3GTL C;  2R93 C;  1I50 C;  1I3Q C;  1SMY A;  3HOU C;  4BBS K;  3M3Y K;  2NVT C;  4GT9 A;  1Y1W A;  3PO2 K;  4A93 C;  2NVY C;  3OEP A;  4KMA A;  4BY7 K;  3SZZ A;  3GTP A;  4KAW X;  5C44 K;  4XSX A;  1ZQ1 C;  2CW0 A;  4A3I C;  1DCO A;  5FLM C;  3GTP K;  2PMZ L;  3S2H K;  3GEH A;  4QIW L;  3BUE A;  5FJ8 K;  2PPB A;  3S15 K;  1YCL A;  1EK8 A;  3N3Y A;  1EQR A;  4C45 A;  4G0V A;  4OIO A;  1GE9 A;  3CAG A;  3HOV C;  3S1Q K;  5M3F K;  3S1M K;  2NVX C;  1ISE A;  3RZO K;  4BLA A;  3GIR A;  2R92 K;  3GTM K;  1V5V A;  4A3F K;  4KAT A;  2BE5 A;  4A3K K;  4C3I C;  2XCO A;  2NVQ C;  1O25 A;  5TJ3 A;  3K7A K;  1JQW A;  2A6H A;  4C3J K;  2Y0S L;  1SFO A;  4Q4Z A;  4KN4 A;  4YFX A;  3S1R C;  3PO3 C;  4YFN A;  2JA7 A;  4BLB A;  4G7H A;  3AQP A;  2R7Z C;  2E2J K;  2V6U A;  4M1X A;  3CQZ C;  4AYB L;  4GZY A;  2A69 A;  2GAH C;  2FQO A;  4WIL A;  1ZXO A;  4ILD A;  4A3G C;  3L4K A;  1JOE A;  1TWF A;  1F93 A;  3IPJ A;  4PAA A;  1EI6 A;  1YNJ A;  2GSU A;  3GEI A;  1WOR A;  2RGR A;  2O5J A;  3N0C A;  4GTL A;  4OIP A;  2ZUF A;  4WJ4 A;  1VH2 A;  2GSO A;  3GTG K;  2PHC B;  2P5M A;  1PJ7 A;  4A3L K;  3S16 K;  4A3C K;  1VLO A;  5IYB K;  4G7O A;  5C4X K;  3I4N K;  3HOW C;  4A3D K;  4A3J K;  1YNN A;  1BJT A;  4MQ9 A;  1O2F B;  1K83 C;  1I3Q K;  2JA6 C;  4Y52 K;  4GTF A;  1WQH A;  3HOX C;  3A8K A;  4BBR C;  2ZUE A;  2GSN A;  1WCM A;  3S14 C;  4A93 K;  1F7V A;  2NVY K;  1I6H K;  2KWA A;  1XPP A;  4LK1 A;  2VUM A;  1TWH C;  3H0G A;  3HKZ D;  5IOR A;  1WCM K;  4BKW A;  1X31 C;  1TWA C;  1O27 A;  4BXX C;  1IBA A;  1XZQ B;  2VUM K;  3H0G K;  5IP9 C;  3A8J A;  2WB1 D;  4KMU A;  4G7Z A;  3T01 A;  2JA5 A;  3AD9 C;  2B63 A;  4A3B C;  4DDQ A;  5C4J C;  3HOY C;  1O2B A;  1B4B A;  4JK1 A;  1DCP A;  2JA5 K;  1Y1V A;  4C3H C;  2B63 K;  1BS2 A;  2E2H C;  4BY1 C;  1EFW A;  4LJZ A;  1HQM A;  3N0B A;  3GTQ A;  4C2M C;  1Y1V K;  4MEY A;  3TFI A;  4KDD A;  2JA8 C;  4GTB A;  1TWC C;  1R9T C;  3GTQ K;  4MEX A;  4NOI A;  1TWG C;  1BDF A;  4O2D A;  2E2I C;  4OIQ A;  2P8T A;  4LK0 A;  1USM A;  3GTJ A;  3GTM A;  2R92 A;  3SZY A;  4LQY A;  3NUH A;  4Y7N C;  5TMF A;  4KB4 A;  5M5X K;  3GTJ K;  3V4G A;  3MML B;  1L0W A;  3LAJ A;  2CFA A;  3I4M C;  3QX3 A;  4G0W A;  5IYD K;  1VRQ C;  4RMF A;  4AH6 A;  3RZD K;  1O29 A;  1YX2 A;  4XLP A;  4KM9 A;  4OIN A;  4BBS C;  3S17 K;  1XXC A;  4A3M K;  3GEE A;  4FM9 A;  3PO2 C;  5C3E C;  4BY7 C;  1J6V A;  1XXA A;  1O26 A;  3GTK A;  1Y1W C;  3L4J A;  5C44 C;  5L46 A;  5M3M K;  4PAB A;  1IQ0 A;  3DXJ A;  2YU9 A;  1VGX A;  3HOZ C;  1WQG A;  3GTK K;  3GTP C;  3GTG A;  1WIH A;  3S15 C;  1HI9 A;  3HOX K;  2YU9 K;  4BBR K;  3EQL A;  3TFJ A;  3ADA C;  5IP7 K;  4WJ3 M;  2WAQ L;  4KB2 A;  3S1Q C;  3FOE A;  2Y3P A;  3RZO C;  5IOT A;  3S1M C;  3FKI A;  5CJ9 A;  4X6A K;  1J6W A;  4A3F C;  3GTO A;  3GTL A;  3JST A;  2R93 A;  4AYB D;  1I50 A;  3S1N K;  1I3Q A;  3S2D K;  3AD8 C;  5IP9 K;  3FKI K;  4P9S A;  3AH5 A;  3K7A C;  3A8I A;  4GTE A;  3GTO K;  1AB4 A;  5IYC K;  3M4O C;  3GTL K;  2R93 K;  1I50 K;  4C3J C;  4QJV B;  2FQT A;  5C4J K;  3HOU K;  2NVY A;  1SFO C;  3HKZ L;  5HL8 A;  2RH6 A;  2NVT K;  1WOO A;  3BP8 C;  2JA7 C;  5D4D A;  4C2M K;  1WSV A;  3H3V D;  1XZP B;  4OIR A;  1TWG K;  4A3I K;  5FLM K;  2A6E A;  1F9N A;  2PA8 D;  1KQ4 A;  1WOS A;  1TWF C;  3AQO A;  1O2A A;  4ZH4 A;  2NVX A;  1ZYR A;  4A3L C;  5E68 A;  4FZB A;  3HOV K;  2EBB A;  4Q5S A;  4KM8 A;  5TMC A;  3S16 C;  2NVX K;  4A3C C;  5IYB C;  5C4X C;  4A3E C;  3I4N C;  4A3D C;  4A3J C;  4YG2 A;  3I4M K;  4C3I K;  4LLG A;  1IW7 A;  4P5A A;  2NVQ K;  4GFQ A;  4LR2 A;  3TFH A;  4Y52 C;  1XZQ A;  2R7Z A;  3ERE D;  3S1R K;  3PO3 K;  3CQZ A;  2R7Z K;  1I6H C;  5C3E K;  1IE0 A;  5IOS A;  2CFA B;  3CQZ K;  4KC6 A;  1WCM C;  1WOP A;  1Y1W K;  1O24 A;  1PJ6 A;  5CHP A;  4KAS A;  2VUM C;  3HOZ K;  3H0G C;  3WOD A;  4A3G K;  2O5I A;  4P5B A;  1XXB A;  1G51 A;  5EGE A;  3OPF A;  4LOW A;  3TTG A;  2PMZ D;  1J98 A;  2D6F C;  4QIW D;  2JA5 C;  2V6S A;  2B63 C;  3M3Y C;  4YFK A;  3GDZ A;  2W7V A;  1IL2 A;  3G4C A;  1Y1V C;  1JVI A; 
#chains in the Genus database with same CATH homology
 3HOW K;  4AYB D;  1TWA C;  3S1N K;  4BXX C;  3S2D K;  5IP9 K;  3FKI K;  2VUM K;  3H0G K;  5IP9 C;  5M5Y K;  3GTQ C;  2CW0 A;  4A3I C;  3M4O K;  2A68 A;  2WB1 D;  3K7A C;  4KMU A;  5FLM C;  2PMZ L;  5IYC K;  4G7Z A;  3GTL K;  3GTP K;  3GTO K;  3M4O C;  3S2H K;  1K83 K;  4QIW L;  1I50 K;  5FJ8 K;  2PPB A;  4XLN A;  2JA6 K;  3S15 K;  4A3B C;  4QJV B;  5C4J K;  3HOU K;  5C4J C;  3HOY C;  4JK1 A;  4OIO A;  1SFO K;  1I6V A;  2Y0S D;  1SFO C;  2JA5 K;  2B63 K;  3HKZ L;  3S14 K;  2NVT K;  3HOV C;  2E2H C;  2JA7 K;  3S1Q K;  4BY1 C;  2JA7 C;  5M3F K;  3S1M K;  2NVX C;  3RZO K;  4LJZ A;  1TWH K;  5D4D A;  1HQM A;  4C2M K;  1Y1V K;  4MEY A;  2R92 K;  3GTM K;  2R92 C;  3GTJ C;  3GTM C;  4A3F K;  3H3V D;  2JA8 C;  2BE5 A;  1TWA K;  4OIR A;  1TWC C;  4BXX K;  4A3K K;  4A3K C;  1R9T C;  2NVQ C;  3GTQ K;  4MEX A;  1TWG K;  5IYD C;  4A3I K;  4NOI A;  1TWG C;  3K7A K;  1BDF A;  5FLM K;  2E2I C;  2A6E A;  5M5W K;  2PA8 D;  4OIQ A;  2A6H A;  4C3J K;  2Y0S L;  1TWF K;  4Q4Z A;  3RZD C;  4KN4 A;  1TWF C;  4YFX A;  3S1R C;  4XSZ A;  3PO3 C;  4A3B K;  4YFN A;  4ZH4 A;  3S17 C;  4A3M C;  3HOY K;  4G7H A;  1ZYR A;  4A3L C;  2R7Z C;  2E2J K;  4C3H K;  4LK0 A;  2E2J C;  3HOV K;  2E2H K;  3H3V L;  4Q5S A;  5TMC A;  4BY1 K;  3S16 C;  2R93 K;  2NVX K;  2WAQ D;  3CQZ C;  4AYB L;  5TMF A;  5IYB C;  4Y7N C;  4A3C C;  4GZY A;  2A69 A;  4A3E K;  5M5X K;  5C4X C;  4A3E C;  3I4N C;  4A3D C;  3GTJ K;  4A3J C;  2WB1 L;  4YG2 A;  2JA8 K;  2PA8 L;  3I4M K;  1TWC K;  4A3G C;  3I4M C;  4C3I K;  3GTK C;  4LLG A;  1IW7 A;  1R9T K;  2NVQ K;  5IYD K;  1YNJ A;  2O5J A;  2E2I K;  4OIP A;  4Y52 C;  2YU9 C;  3RZD K;  3GTG K;  3S1R K;  3PO3 K;  3GTG C;  4XLP A;  4OIN A;  4BBS C;  5IP7 C;  3S17 K;  4A3M K;  4QJV A;  4A3L K;  2R7Z K;  3PO2 C;  1I6H C;  5C3E K;  5C3E C;  4BY7 C;  3S16 K;  4X6A C;  3CQZ K;  4Y7N K;  5IYB K;  4A3C K;  1WCM C;  3S2H C;  1Y1W K;  4G7O A;  1Y1W C;  5C4X K;  5C44 C;  3I4N K;  4KN7 A;  3HOW C;  4A3D K;  4A3J K;  5M3M K;  3S1N C;  3S2D C;  1YNN A;  3FKI C;  3DXJ A;  3H0G C;  3WOD A;  2VUM C;  3HOZ C;  3HOZ K;  4A3G K;  2O5I A;  4MQ9 A;  3GTK K;  3GTP C;  3GTO C;  5IYC C;  3GTL C;  2R93 C;  1K83 C;  1I3Q K;  1I50 C;  2JA6 C;  3S15 C;  1I3Q C;  4Y52 K;  3HOX K;  2YU9 K;  1SMY A;  3HOX C;  3HOU C;  4BBR K;  3EQL A;  2PMZ D;  4BBR C;  4QIW D;  4BBS K;  5IP7 K;  2JA5 C;  3M3Y K;  2B63 C;  3M3Y C;  3S14 C;  2WAQ L;  2NVT C;  4A93 K;  1I6H K;  2NVY K;  3PO2 K;  4YFK A;  3S1Q C;  2NVY C;  4A93 C;  1XPP A;  3S1M C;  4LK1 A;  3RZO C;  4BY7 K;  1TWH C;  4X6A K;  3HKZ D;  1Y1V C;  1WCM K;  4A3F C;  5C44 K;  4XSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...