4QIWL

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
b'MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 94
sequence length 94
chains with identical sequence U
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qiwL00
3HOUC 5C3EK 2A6HA 3GTPK 3M4OK 4Y52C 2O5IA 1I6VA 3FKIC 4OIQA 4QJVA 3S1QC 2PMZL 4LK0A 3H3VD 4A3LK 4A3DK 5IYBK 2Y0SD 3M4OC 2JA6K 3GTQC 3PO3C 2O5JA 4A3GK 4BY1K 4YFKA 4A3DC 1I3QK 5M5YK 4XLNA 3H3VL 4LJZA 3CQZC 1TWHK 5D4DA 1I50K 5IYDC 5FLMK 3HOXC 2Y0SL 3HOWC 4GZYA 5C4JC 1TWGK 2R92K 1TWCC 3HKZD 4Q5SA 3HOZC 3S17K 1TWAK 4A3CK 1Y1WK 4A3BK 4G7HA 1WCMC 2JA5K 3GTOC 4G7ZA 2B63C 3K7AK 2NVQC 2VUMK 3M3YC 3HKZL 4A3MC 1Y1WC 4LK1A 4MEYA 4C3HK 4Y52K 2E2JC 2NVYK 1HQMA 3GTJC 2VUMC 3S16C 3S1QK 3GTLK 4YG2A 3GTQK 3PO3K 1I6HC 5IP7K 2NVYC 4A3JC 3DXJA 4QIWD 4YFNA 3GTLC 4OIOA 4XSXA 3CQZK 3S14K 3HOXK 4BBSC 5IP7C 5IYDK 3HOWK 5C4JK 4JK1A 1TWFC 4LLGA 1TWCK 4QIWL 3GTKK 5IP9C 2CW0A 3H0GK 2E2HK 2YU9C 2BE5A 1YNJA 2WB1D 3S15C 1WCMK 3GTOK 3GTKC 5M3FK 5TMFA 2B63K 5M3MK 3H0GC 4A3IC 2E2HC 2NVQK 4A3MK 2NVTK 3M3YK 4G7OA 5C4XC 2E2JK 4MQ9A 3I4MK 3HOYC 4C3IK 5M5XK 2WB1L 3GTJK 3S16K 1ZYRA 4OIRA 1SMYA 4AYBD 2NVTC 4A3EK 3I4MC 1I6HK 4BBRC 4A3JK 4OIPA 3I4NC 4BY7C 2R93C 2A6EA 4BXXK 2JA7C 3RZOC 5C44K 4MEXA 4BBSK 3S1MC 3GTGC 1BDFA 1TWFK 1XPPA 4BXXC 5C44C 5IP9K 4X6AC 2YU9K 1K83C 3S1RC 2NVXC 3S15K 4KN4A 5C4XK 4A3IK 2R7ZC 5IYCC 3GTMK 4ZH4A 4KN7A 5TMCA 3HOYK 3PO2C 1IW7A 3EQLA 2JA8C 2A68A 4C2MK 3GTMC 4Q4ZA 2E2IC 5FJ8K 3S14C 1Y1VK 4BBRK 3I4NK 3S2HC 4BY7K 4A3KC 2PA8D 4NOIA 2R93K 1SFOC 4XLPA 5M5WK 2JA7K 3RZOK 3S1NC 3S1MK 4XSZA 1Y1VC 2WAQD 4A3EC 3S2DC 3GTGK 4A93K 3WODA 5C3EC 4QJVB 3GTPC 2PA8L 3HOZK 4X6AK 4AYBL 4A93C 4A3LC 5IYBC 1K83K 2WAQL 3S1RK 4KMUA 2NVXK 4OINA 2JA6C 4A3GC 4BY1C 2R7ZK 1YNNA 5IYCK 4Y7NK 1I3QC 4C3JK 4A3FK 1TWHC 3PO2K 1I50C 2JA8K 5FLMC 3RZDK 2A69A 3HOVK 1TWGC 2E2IK 1R9TK 4Y7NC 2R92C 2PPBA 3S17C 4A3FC 3S2HK 1TWAC 4A3CC 4A3KK 3RZDC 3HOUK 1SFOK 4YFXA 3HOVC 3S1NK 2PMZD 4A3BC 1R9TC 3FKIK 2JA5C 3K7AC 3S2DK
chains in the Genus database with same CATH superfamily
5C3EK 3SZYA 1F93A 2O5IA 1WOPA 4OIQA 5IORA 1TWAA 4QJVA 3S1QC 5IYBK 4GTDA 4BLAA 1WQHA 2JA6K 3GTQC 4KM9A 1J6XA 1ZBSA 4KMDA 4KARA 5JVOA 3HOZK 5IYDC 5D4DA 1I50K 4LQYA 1DCHA 1TWGK 2R92K 4KB4A 3HOZC 1WQGA 1Y1WK 1WCMC 2JA5K 3M3YC 5TJ3A 3L4KA 1Y1WC 1VLOA 5EGEA 1O29A 3IPJA 3GDZA 4BKWA 3GTOA 1I6HC 1DD5A 4OIOA 4KDDA 5CHPA 4BBSC 1F9NA 4GT9A 1TWFC 1O28A 2V6UA 2CW0A 2NVYA 3TFIA 1HI9A 3S15C 3HXAA 2B63K 5C4XC 1XXAA 2GAHC 2RH6A 1C0AA 1PJ6A 4C3IK 3VA7A 3GTJK 3S16K 2YU9A 4BLBA 1O26A 4C3IC 3H0GA 4O2DA 1G51A 3S1MC 1BS2A 1WOSA 3TFJA 1XPPA 4X6AC 1XZPA 3V4GA 3T02A 5IYCC 4KN7A 4C3JC 3HOYK 1K83A 2E2IC 2NVXA 4BBRK 2W7VA 3S2HC 2R7ZA 4GTCA 5M5WK 3BUEA 4J3NA 3S2DC 3T01A 3GTGK 3GTMA 1USOA 3GTPC 1AB4A 1O2BA 4A3LC 3S1RK 4OINA 4A3GC 1YNNA 1I3QC 2FQOA 5FLMC 3CAGA 1JOEA 3S17C 1TWAC 4A3CC 5IOQA 4A3EK 3AQOA 2XCOA 4LK0A 1X31C 4KATA 1VH2A 2V6TA 1EI6A 4BY1K 1V5VA 3A8KA 1VJEA 3S14C 1TWHK 3FKIA 3HOWC 1IBAA 2D6FC 4A3BK 1WORA 3GTOC 3CQZA 3LAJA 4A3MC 1IE0A 1TWCA 2E2JC 2NVYK 4M1XA 1HQMA 3S1QK 1JVIA 3L4JA 2CFAB 4YG2A 2P5MA 3GTQK 5IP7K 2NVYC 4KM8A 3GEIA 4A3JC 3SZZA 5IYDK 5IP7C 3QX3A 2VUMA 2V6SA 4KAWX 5IP9C 3H0GK 2YU9C 1YNJA 3GTLA 1WCMK 5TMFA 3M3YK 4KB2A 3H0GC 4G0WA 2NVTK 4PAAA 4MQ9A 1DCPA 4GTFA 1J6VA 1ZXOA 1IQ0A 2NVTC 1I6HK 3GTKA 2CFAA 4BXXK 3RZOC 4BBSK 3BP8C 1BDFA 1TWFK 4BXXC 3MMLB 4XCHA 2R93A 1K83C 2NVXC 3S15K 2JA7A 1ZVUA 5C4XK 2R7ZC 4P9SA 3GTMK 3LPXA 4LR2A 1IW7A 3AD7C 2A68A 3GTMC 1F7VA 2PA8D 3S1MK 4XSZA 3WODA 5JFEA 2PA8L 4X6AK 3A8JA 1SFOA 1PJ7A 4KMUA 2GAGC 4RMFA 4PABA 5IYCK 4C3JK 2PHCB 3Q3QA 3RZDK 5EGHA 2E2IK 2JA6A 3S2HK 2RGRA 1VGXA 3GSIA 3RZDC 1USMA 3FKIK 1I50A 3K7AC 3S2DK 3GTPK 1TWGA 4C3HC 4C45A 4Y52C 2R92A 3FKIC 1XZQB 3GEEA 4A3LK 4A3DK 2Y0SD 4GTLA 3PO3C 2O5JA 2JA5A 4A3GK 4YFKA 4A3DC 1I3QK 5M5YK 4XLNA 4LJZA 3CQZC 3HOXC 5FLMK 2Y0SL 5C4JC 1TWCC 3S17K 5IOSA 1TWAK 1EH1A 4A3CK 5CJ9A 1EQRA 3LAPA 1O2FB 4G7ZA 2NVQC 2VUMK 4DDQA 1L0WA 2VUMC 3GTLK 3TFHA 1ZQ1C 2B63A 4YFNA 3GTLC 1EK8A 4XSXA 2EBBA 3S14K 3GTJA 3HOWK 4JK1A 3N3YA 3GTKK 1J6WA 3AD9C 4GFQA 3BP3A 3GTOK 3GTKC 5M3FK 4WJ3M 4A3IC 4A3MK 4G7OA 2E2JK 3GEHA 3I4MK 5M5XK 1ZYRA 4C2MC 3S0XA 1SMYA 4AYBD 4OIRA 3I4MC 4G0UA 3I4NC 3FOEA 4A3JK 4BY7C 2E2HA 2R93C 2JA7C 2XCQA 5C44K 4MEXA 4WJ4A 4WILA 4FM9A 5C44C 5IP9K 4P5AA 2YU9K 2GSOA 1YX2A 2P8TA 4KN4A 1B4BA 3GTGA 4ZH4A 3AH5A 1O2AA 3PO2C 2JA8C 5FJ8K 4A3KC 1SFOC 4XLPA 3S1NC 3RZOK 2WAQD 5C3EC 4LOWA 3AQPA 3G4CA 3T00A 1B4AA 1BJTA 5IYBC 1K83K 2WAQL 2NVXK 2JA6C 1IS1A 1Y1VA 4KMHA 1VRQC 2R7ZK 2GSUA 2KWAA 4A3FK 1I50C 3OEPA 2A69A 1TWGC 2R92C 2PPBA 4A3FC 3HOUK 4KASA 1O25A 2PMZD 4GTEA 2JA5C 1TWHA 3HOUC 2A6HA 3M4OK 4KMAA 1I6VA 2PMZL 3H3VD 1WQFA 3M4OC 2FQTA 1R9TA 3G4AA 5HL8A 1XXBA 3NUHA 3H3VL 1XZPB 4AH6A 4GZYA 1YCLA 3HKZD 3GTQA 4Q5SA 1WOOA 3ERED 1IL2A 4G7HA 1WSVA 1RU0A 3K7AK 3OREA 2B63C 3HKZL 3N0BA 4LK1A 4MEYA 4C3HK 4Y52K 4KC6A 3ADAC 3GTJC 2ZUFA 3S16C 1J98A 1WCMA 3PO3K 3DXJA 4QIWD 1Y1WA 3CQZK 3GIRA 3A8IA 3HOXK 5C4JK 4LLGA 1TWCK 1JQWA 4QIWL 5L46A 2XCRB 2E2HK 3FOFA 2BE5A 1O27A 2WB1D 2NVQK 5M3MK 2E2HC 2GSNA 2Y3PA 1TWFA 3HOYC 2WB1L 1WSRA 4BBRC 4OIPA 3JSTA 2A6EA 1XZQA 3GTGC 3S1RC 1ISEA 1UV7A 4A3IK 1WIHA 5TMCA 3EQLA 1INNA 4C2MK 4Q4ZA 1BGWA 1Y1VK 3OPFA 3I4NK 4BY7K 3FHZA 2ZFZA 4NOIA 5IOTA 2R93K 2JA7K 4G0VA 1Y1VC 4A3EC 4A93K 4QJVB 2E2IA 4GTAA 4GTBA 5E68A 4ILDA 4AYBL 4A93C 1DCOA 1EFWA 4BY1C 4FZBA 3GTPA 4Y7NK 1GE9A 1TWHC 3PO2K 2JA8K 4P5BA 2ZUEA 3N0CA 1XXCA 3HOVK 1R9TK 3AD8C 4Y7NC 1KQ4A 2JH3A 4A3KK 1SFOK 4YFXA 3HOVC 3S1NK 3TTGA 1O24A 1I3QA 1R9TC 4A3BC 1F7UA 1PJ5A
chains in the Genus database with same CATH topology
3HOUC 5C3EK 2A6HA 3GTPK 3M4OK 4Y52C 2O5IA 1I6VA 3FKIC 4OIQA 4QJVA 3S1QC 2PMZL 4LK0A 3H3VD 4A3LK 4A3DK 5IYBK 2Y0SD 3M4OC 2JA6K 3GTQC 3PO3C 2O5JA 4A3GK 4BY1K 4YFKA 4A3DC 1I3QK 5M5YK 4XLNA 3H3VL 4LJZA 3CQZC 1TWHK 5D4DA 1I50K 5IYDC 5FLMK 3HOXC 2Y0SL 3HOWC 4GZYA 5C4JC 1TWGK 2R92K 1TWCC 3HKZD 4Q5SA 3HOZC 3S17K 1TWAK 4A3CK 1Y1WK 4A3BK 4G7HA 1WCMC 2JA5K 3GTOC 4G7ZA 2B63C 3K7AK 2NVQC 2VUMK 3M3YC 3HKZL 4A3MC 1Y1WC 4LK1A 4MEYA 4C3HK 4Y52K 2E2JC 2NVYK 1HQMA 3GTJC 2VUMC 3S16C 3S1QK 3GTLK 4YG2A 3GTQK 3PO3K 1I6HC 5IP7K 2NVYC 4A3JC 3DXJA 4QIWD 4YFNA 3GTLC 4OIOA 4XSXA 3CQZK 3S14K 3HOXK 4BBSC 5IP7C 5IYDK 3HOWK 5C4JK 4JK1A 1TWFC 4LLGA 1TWCK 4QIWL 3GTKK 5IP9C 2CW0A 3H0GK 2E2HK 2YU9C 2BE5A 1YNJA 2WB1D 3S15C 1WCMK 3GTOK 3GTKC 5M3FK 5TMFA 2B63K 5M3MK 3H0GC 4A3IC 2E2HC 2NVQK 4A3MK 2NVTK 3M3YK 4G7OA 5C4XC 2E2JK 4MQ9A 3I4MK 3HOYC 4C3IK 5M5XK 2WB1L 3GTJK 3S16K 1ZYRA 4OIRA 1SMYA 4AYBD 2NVTC 4A3EK 3I4MC 1I6HK 4BBRC 4A3JK 4OIPA 3I4NC 4BY7C 2R93C 2A6EA 4BXXK 2JA7C 3RZOC 5C44K 4MEXA 4BBSK 3S1MC 3GTGC 1BDFA 1TWFK 1XPPA 4BXXC 5C44C 5IP9K 4X6AC 2YU9K 1K83C 3S1RC 2NVXC 3S15K 4KN4A 5C4XK 4A3IK 2R7ZC 5IYCC 3GTMK 4ZH4A 4KN7A 5TMCA 3HOYK 3PO2C 1IW7A 3EQLA 2JA8C 2A68A 4C2MK 3GTMC 4Q4ZA 2E2IC 5FJ8K 3S14C 1Y1VK 4BBRK 3I4NK 3S2HC 4BY7K 4A3KC 2PA8D 4NOIA 2R93K 1SFOC 4XLPA 5M5WK 2JA7K 3RZOK 3S1NC 3S1MK 4XSZA 1Y1VC 2WAQD 4A3EC 3S2DC 3GTGK 4A93K 3WODA 5C3EC 4QJVB 3GTPC 2PA8L 3HOZK 4X6AK 4AYBL 4A93C 4A3LC 5IYBC 1K83K 2WAQL 3S1RK 4KMUA 2NVXK 4OINA 2JA6C 4A3GC 4BY1C 2R7ZK 1YNNA 5IYCK 4Y7NK 1I3QC 4C3JK 4A3FK 1TWHC 3PO2K 1I50C 2JA8K 5FLMC 3RZDK 2A69A 3HOVK 1TWGC 2E2IK 1R9TK 4Y7NC 2R92C 2PPBA 3S17C 4A3FC 3S2HK 1TWAC 4A3CC 4A3KK 3RZDC 3HOUK 1SFOK 4YFXA 3HOVC 3S1NK 2PMZD 4A3BC 1R9TC 3FKIK 2JA5C 3K7AC 3S2DK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU C;  5C3E K;  2A6H A;  3GTP K;  3M4O K;  4Y52 C;  2O5I A;  1I6V A;  3FKI C;  4OIQ A;  4QJV A;  3S1Q C;  2PMZ L;  4LK0 A;  3H3V D;  4A3L K;  4A3D K;  5IYB K;  2Y0S D;  3M4O C;  2JA6 K;  3GTQ C;  3PO3 C;  2O5J A;  4A3G K;  4BY1 K;  4YFK A;  4A3D C;  1I3Q K;  5M5Y K;  4XLN A;  3H3V L;  4LJZ A;  3CQZ C;  1TWH K;  5D4D A;  1I50 K;  5IYD C;  5FLM K;  3HOX C;  2Y0S L;  3HOW C;  4GZY A;  5C4J C;  1TWG K;  2R92 K;  1TWC C;  3HKZ D;  4Q5S A;  3HOZ C;  3S17 K;  1TWA K;  4A3C K;  1Y1W K;  4A3B K;  4G7H A;  1WCM C;  2JA5 K;  3GTO C;  4G7Z A;  2B63 C;  3K7A K;  2NVQ C;  2VUM K;  3M3Y C;  3HKZ L;  4A3M C;  1Y1W C;  4LK1 A;  4MEY A;  4C3H K;  4Y52 K;  2E2J C;  2NVY K;  1HQM A;  3GTJ C;  2VUM C;  3S16 C;  3S1Q K;  3GTL K;  4YG2 A;  3GTQ K;  3PO3 K;  1I6H C;  5IP7 K;  2NVY C;  4A3J C;  3DXJ A;  4QIW D;  4YFN A;  3GTL C;  4OIO A;  4XSX A;  3CQZ K;  3S14 K;  3HOX K;  4BBS C;  5IP7 C;  5IYD K;  3HOW K;  5C4J K;  4JK1 A;  1TWF C;  4LLG A;  1TWC K;  4QIW L;  3GTK K;  5IP9 C;  2CW0 A;  3H0G K;  2E2H K;  2YU9 C;  2BE5 A;  1YNJ A;  2WB1 D;  3S15 C;  1WCM K;  3GTO K;  3GTK C;  5M3F K;  5TMF A;  2B63 K;  5M3M K;  3H0G C;  4A3I C;  2E2H C;  2NVQ K;  4A3M K;  2NVT K;  3M3Y K;  4G7O A;  5C4X C;  2E2J K;  4MQ9 A;  3I4M K;  3HOY C;  4C3I K;  5M5X K;  2WB1 L;  3GTJ K;  3S16 K;  1ZYR A;  4OIR A;  1SMY A;  4AYB D;  2NVT C;  4A3E K;  3I4M C;  1I6H K;  4BBR C;  4A3J K;  4OIP A;  3I4N C;  4BY7 C;  2R93 C;  2A6E A;  4BXX K;  2JA7 C;  3RZO C;  5C44 K;  4MEX A;  4BBS K;  3S1M C;  3GTG C;  1BDF A;  1TWF K;  1XPP A;  4BXX C;  5C44 C;  5IP9 K;  4X6A C;  2YU9 K;  1K83 C;  3S1R C;  2NVX C;  3S15 K;  4KN4 A;  5C4X K;  4A3I K;  2R7Z C;  5IYC C;  3GTM K;  4ZH4 A;  4KN7 A;  5TMC A;  3HOY K;  3PO2 C;  1IW7 A;  3EQL A;  2JA8 C;  2A68 A;  4C2M K;  3GTM C;  4Q4Z A;  2E2I C;  5FJ8 K;  3S14 C;  1Y1V K;  4BBR K;  3I4N K;  3S2H C;  4BY7 K;  4A3K C;  2PA8 D;  4NOI A;  2R93 K;  1SFO C;  4XLP A;  5M5W K;  2JA7 K;  3RZO K;  3S1N C;  3S1M K;  4XSZ A;  1Y1V C;  2WAQ D;  4A3E C;  3S2D C;  3GTG K;  4A93 K;  3WOD A;  5C3E C;  4QJV B;  3GTP C;  2PA8 L;  3HOZ K;  4X6A K;  4AYB L;  4A93 C;  4A3L C;  5IYB C;  1K83 K;  2WAQ L;  3S1R K;  4KMU A;  2NVX K;  4OIN A;  2JA6 C;  4A3G C;  4BY1 C;  2R7Z K;  1YNN A;  5IYC K;  4Y7N K;  1I3Q C;  4C3J K;  4A3F K;  1TWH C;  3PO2 K;  1I50 C;  2JA8 K;  5FLM C;  3RZD K;  2A69 A;  3HOV K;  1TWG C;  2E2I K;  1R9T K;  4Y7N C;  2R92 C;  2PPB A;  3S17 C;  4A3F C;  3S2H K;  1TWA C;  4A3C C;  4A3K K;  3RZD C;  3HOU K;  1SFO K;  4YFX A;  3HOV C;  3S1N K;  2PMZ D;  4A3B C;  1R9T C;  3FKI K;  2JA5 C;  3K7A C;  3S2D K; 
#chains in the Genus database with same CATH topology
 5C3E K;  3SZY A;  1F93 A;  2O5I A;  1WOP A;  4OIQ A;  5IOR A;  1TWA A;  4QJV A;  3S1Q C;  5IYB K;  4GTD A;  4BLA A;  1WQH A;  2JA6 K;  3GTQ C;  4KM9 A;  1J6X A;  1ZBS A;  4KMD A;  4KAR A;  5JVO A;  3HOZ K;  5IYD C;  5D4D A;  1I50 K;  4LQY A;  1DCH A;  1TWG K;  2R92 K;  4KB4 A;  3HOZ C;  1WQG A;  1Y1W K;  1WCM C;  2JA5 K;  3M3Y C;  5TJ3 A;  3L4K A;  1Y1W C;  1VLO A;  5EGE A;  1O29 A;  3IPJ A;  3GDZ A;  4BKW A;  3GTO A;  1I6H C;  1DD5 A;  4OIO A;  4KDD A;  5CHP A;  4BBS C;  1F9N A;  4GT9 A;  1TWF C;  1O28 A;  2V6U A;  2CW0 A;  2NVY A;  3TFI A;  1HI9 A;  3S15 C;  3HXA A;  2B63 K;  5C4X C;  1XXA A;  2GAH C;  2RH6 A;  1C0A A;  1PJ6 A;  4C3I K;  3VA7 A;  3GTJ K;  3S16 K;  2YU9 A;  4BLB A;  1O26 A;  4C3I C;  3H0G A;  4O2D A;  1G51 A;  3S1M C;  1BS2 A;  1WOS A;  3TFJ A;  1XPP A;  4X6A C;  1XZP A;  3V4G A;  3T02 A;  5IYC C;  4KN7 A;  4C3J C;  3HOY K;  1K83 A;  2E2I C;  2NVX A;  4BBR K;  2W7V A;  3S2H C;  2R7Z A;  4GTC A;  5M5W K;  3BUE A;  4J3N A;  3S2D C;  3T01 A;  3GTG K;  3GTM A;  1USO A;  3GTP C;  1AB4 A;  1O2B A;  4A3L C;  3S1R K;  4OIN A;  4A3G C;  1YNN A;  1I3Q C;  2FQO A;  5FLM C;  3CAG A;  1JOE A;  3S17 C;  1TWA C;  4A3C C;  5IOQ A;  4A3E K;  3AQO A;  2XCO A;  4LK0 A;  1X31 C;  4KAT A;  1VH2 A;  2V6T A;  1EI6 A;  4BY1 K;  1V5V A;  3A8K A;  1VJE A;  3S14 C;  1TWH K;  3FKI A;  3HOW C;  1IBA A;  2D6F C;  4A3B K;  1WOR A;  3GTO C;  3CQZ A;  3LAJ A;  4A3M C;  1IE0 A;  1TWC A;  2E2J C;  2NVY K;  4M1X A;  1HQM A;  3S1Q K;  1JVI A;  3L4J A;  2CFA B;  4YG2 A;  2P5M A;  3GTQ K;  5IP7 K;  2NVY C;  4KM8 A;  3GEI A;  4A3J C;  3SZZ A;  5IYD K;  5IP7 C;  3QX3 A;  2VUM A;  2V6S A;  4KAW X;  5IP9 C;  3H0G K;  2YU9 C;  1YNJ A;  3GTL A;  1WCM K;  5TMF A;  3M3Y K;  4KB2 A;  3H0G C;  4G0W A;  2NVT K;  4PAA A;  4MQ9 A;  1DCP A;  4GTF A;  1J6V A;  1ZXO A;  1IQ0 A;  2NVT C;  1I6H K;  3GTK A;  2CFA A;  4BXX K;  3RZO C;  4BBS K;  3BP8 C;  1BDF A;  1TWF K;  4BXX C;  3MML B;  4XCH A;  2R93 A;  1K83 C;  2NVX C;  3S15 K;  2JA7 A;  1ZVU A;  5C4X K;  2R7Z C;  4P9S A;  3GTM K;  3LPX A;  4LR2 A;  1IW7 A;  3AD7 C;  2A68 A;  3GTM C;  1F7V A;  2PA8 D;  3S1M K;  4XSZ A;  3WOD A;  5JFE A;  2PA8 L;  4X6A K;  3A8J A;  1SFO A;  1PJ7 A;  4KMU A;  2GAG C;  4RMF A;  4PAB A;  5IYC K;  4C3J K;  2PHC B;  3Q3Q A;  3RZD K;  5EGH A;  2E2I K;  2JA6 A;  3S2H K;  2RGR A;  1VGX A;  3GSI A;  3RZD C;  1USM A;  3FKI K;  1I50 A;  3K7A C;  3S2D K;  3GTP K;  1TWG A;  4C3H C;  4C45 A;  4Y52 C;  2R92 A;  3FKI C;  1XZQ B;  3GEE A;  4A3L K;  4A3D K;  2Y0S D;  4GTL A;  3PO3 C;  2O5J A;  2JA5 A;  4A3G K;  4YFK A;  4A3D C;  1I3Q K;  5M5Y K;  4XLN A;  4LJZ A;  3CQZ C;  3HOX C;  5FLM K;  2Y0S L;  5C4J C;  1TWC C;  3S17 K;  5IOS A;  1TWA K;  1EH1 A;  4A3C K;  5CJ9 A;  1EQR A;  3LAP A;  1O2F B;  4G7Z A;  2NVQ C;  2VUM K;  4DDQ A;  1L0W A;  2VUM C;  3GTL K;  3TFH A;  1ZQ1 C;  2B63 A;  4YFN A;  3GTL C;  1EK8 A;  4XSX A;  2EBB A;  3S14 K;  3GTJ A;  3HOW K;  4JK1 A;  3N3Y A;  3GTK K;  1J6W A;  3AD9 C;  4GFQ A;  3BP3 A;  3GTO K;  3GTK C;  5M3F K;  4WJ3 M;  4A3I C;  4A3M K;  4G7O A;  2E2J K;  3GEH A;  3I4M K;  5M5X K;  1ZYR A;  4C2M C;  3S0X A;  1SMY A;  4AYB D;  4OIR A;  3I4M C;  4G0U A;  3I4N C;  3FOE A;  4A3J K;  4BY7 C;  2E2H A;  2R93 C;  2JA7 C;  2XCQ A;  5C44 K;  4MEX A;  4WJ4 A;  4WIL A;  4FM9 A;  5C44 C;  5IP9 K;  4P5A A;  2YU9 K;  2GSO A;  1YX2 A;  2P8T A;  4KN4 A;  1B4B A;  3GTG A;  4ZH4 A;  3AH5 A;  1O2A A;  3PO2 C;  2JA8 C;  5FJ8 K;  4A3K C;  1SFO C;  4XLP A;  3S1N C;  3RZO K;  2WAQ D;  5C3E C;  4LOW A;  3AQP A;  3G4C A;  3T00 A;  1B4A A;  1BJT A;  5IYB C;  1K83 K;  2WAQ L;  2NVX K;  2JA6 C;  1IS1 A;  1Y1V A;  4KMH A;  1VRQ C;  2R7Z K;  2GSU A;  2KWA A;  4A3F K;  1I50 C;  3OEP A;  2A69 A;  1TWG C;  2R92 C;  2PPB A;  4A3F C;  3HOU K;  4KAS A;  1O25 A;  2PMZ D;  4GTE A;  2JA5 C;  1TWH A;  3HOU C;  2A6H A;  3M4O K;  4KMA A;  1I6V A;  2PMZ L;  3H3V D;  1WQF A;  3M4O C;  2FQT A;  1R9T A;  3G4A A;  5HL8 A;  1XXB A;  3NUH A;  3H3V L;  1XZP B;  4AH6 A;  4GZY A;  1YCL A;  3HKZ D;  3GTQ A;  4Q5S A;  1WOO A;  3ERE D;  1IL2 A;  4G7H A;  1WSV A;  1RU0 A;  3K7A K;  3ORE A;  2B63 C;  3HKZ L;  3N0B A;  4LK1 A;  4MEY A;  4C3H K;  4Y52 K;  4KC6 A;  3ADA C;  3GTJ C;  2ZUF A;  3S16 C;  1J98 A;  1WCM A;  3PO3 K;  3DXJ A;  4QIW D;  1Y1W A;  3CQZ K;  3GIR A;  3A8I A;  3HOX K;  5C4J K;  4LLG A;  1TWC K;  1JQW A;  4QIW L;  5L46 A;  2XCR B;  2E2H K;  3FOF A;  2BE5 A;  1O27 A;  2WB1 D;  2NVQ K;  5M3M K;  2E2H C;  2GSN A;  2Y3P A;  1TWF A;  3HOY C;  2WB1 L;  1WSR A;  4BBR C;  4OIP A;  3JST A;  2A6E A;  1XZQ A;  3GTG C;  3S1R C;  1ISE A;  1UV7 A;  4A3I K;  1WIH A;  5TMC A;  3EQL A;  1INN A;  4C2M K;  4Q4Z A;  1BGW A;  1Y1V K;  3OPF A;  3I4N K;  4BY7 K;  3FHZ A;  2ZFZ A;  4NOI A;  5IOT A;  2R93 K;  2JA7 K;  4G0V A;  1Y1V C;  4A3E C;  4A93 K;  4QJV B;  2E2I A;  4GTA A;  4GTB A;  5E68 A;  4ILD A;  4AYB L;  4A93 C;  1DCO A;  1EFW A;  4BY1 C;  4FZB A;  3GTP A;  4Y7N K;  1GE9 A;  1TWH C;  3PO2 K;  2JA8 K;  4P5B A;  2ZUE A;  3N0C A;  1XXC A;  3HOV K;  1R9T K;  3AD8 C;  4Y7N C;  1KQ4 A;  2JH3 A;  4A3K K;  1SFO K;  4YFX A;  3HOV C;  3S1N K;  3TTG A;  1O24 A;  1I3Q A;  1R9T C;  4A3B C;  1F7U A;  1PJ5 A; 
#chains in the Genus database with same CATH homology
 3HOU C;  5C3E K;  2A6H A;  3GTP K;  3M4O K;  4Y52 C;  2O5I A;  1I6V A;  3FKI C;  4OIQ A;  4QJV A;  3S1Q C;  2PMZ L;  4LK0 A;  3H3V D;  4A3L K;  4A3D K;  5IYB K;  2Y0S D;  3M4O C;  2JA6 K;  3GTQ C;  3PO3 C;  2O5J A;  4A3G K;  4BY1 K;  4YFK A;  4A3D C;  1I3Q K;  5M5Y K;  4XLN A;  3H3V L;  4LJZ A;  3CQZ C;  1TWH K;  5D4D A;  1I50 K;  5IYD C;  5FLM K;  3HOX C;  2Y0S L;  3HOW C;  4GZY A;  5C4J C;  1TWG K;  2R92 K;  1TWC C;  3HKZ D;  4Q5S A;  3HOZ C;  3S17 K;  1TWA K;  4A3C K;  1Y1W K;  4A3B K;  4G7H A;  1WCM C;  2JA5 K;  3GTO C;  4G7Z A;  2B63 C;  3K7A K;  2NVQ C;  2VUM K;  3M3Y C;  3HKZ L;  4A3M C;  1Y1W C;  4LK1 A;  4MEY A;  4C3H K;  4Y52 K;  2E2J C;  2NVY K;  1HQM A;  3GTJ C;  2VUM C;  3S16 C;  3S1Q K;  3GTL K;  4YG2 A;  3GTQ K;  3PO3 K;  1I6H C;  5IP7 K;  2NVY C;  4A3J C;  3DXJ A;  4QIW D;  4YFN A;  3GTL C;  4OIO A;  4XSX A;  3CQZ K;  3S14 K;  3HOX K;  4BBS C;  5IP7 C;  5IYD K;  3HOW K;  5C4J K;  4JK1 A;  1TWF C;  4LLG A;  1TWC K;  4QIW L;  3GTK K;  5IP9 C;  2CW0 A;  3H0G K;  2E2H K;  2YU9 C;  2BE5 A;  1YNJ A;  2WB1 D;  3S15 C;  1WCM K;  3GTO K;  3GTK C;  5M3F K;  5TMF A;  2B63 K;  5M3M K;  3H0G C;  4A3I C;  2E2H C;  2NVQ K;  4A3M K;  2NVT K;  3M3Y K;  4G7O A;  5C4X C;  2E2J K;  4MQ9 A;  3I4M K;  3HOY C;  4C3I K;  5M5X K;  2WB1 L;  3GTJ K;  3S16 K;  1ZYR A;  4OIR A;  1SMY A;  4AYB D;  2NVT C;  4A3E K;  3I4M C;  1I6H K;  4BBR C;  4A3J K;  4OIP A;  3I4N C;  4BY7 C;  2R93 C;  2A6E A;  4BXX K;  2JA7 C;  3RZO C;  5C44 K;  4MEX A;  4BBS K;  3S1M C;  3GTG C;  1BDF A;  1TWF K;  1XPP A;  4BXX C;  5C44 C;  5IP9 K;  4X6A C;  2YU9 K;  1K83 C;  3S1R C;  2NVX C;  3S15 K;  4KN4 A;  5C4X K;  4A3I K;  2R7Z C;  5IYC C;  3GTM K;  4ZH4 A;  4KN7 A;  5TMC A;  3HOY K;  3PO2 C;  1IW7 A;  3EQL A;  2JA8 C;  2A68 A;  4C2M K;  3GTM C;  4Q4Z A;  2E2I C;  5FJ8 K;  3S14 C;  1Y1V K;  4BBR K;  3I4N K;  3S2H C;  4BY7 K;  4A3K C;  2PA8 D;  4NOI A;  2R93 K;  1SFO C;  4XLP A;  5M5W K;  2JA7 K;  3RZO K;  3S1N C;  3S1M K;  4XSZ A;  1Y1V C;  2WAQ D;  4A3E C;  3S2D C;  3GTG K;  4A93 K;  3WOD A;  5C3E C;  4QJV B;  3GTP C;  2PA8 L;  3HOZ K;  4X6A K;  4AYB L;  4A93 C;  4A3L C;  5IYB C;  1K83 K;  2WAQ L;  3S1R K;  4KMU A;  2NVX K;  4OIN A;  2JA6 C;  4A3G C;  4BY1 C;  2R7Z K;  1YNN A;  5IYC K;  4Y7N K;  1I3Q C;  4C3J K;  4A3F K;  1TWH C;  3PO2 K;  1I50 C;  2JA8 K;  5FLM C;  3RZD K;  2A69 A;  3HOV K;  1TWG C;  2E2I K;  1R9T K;  4Y7N C;  2R92 C;  2PPB A;  3S17 C;  4A3F C;  3S2H K;  1TWA C;  4A3C C;  4A3K K;  3RZD C;  3HOU K;  1SFO K;  4YFX A;  3HOV C;  3S1N K;  2PMZ D;  4A3B C;  1R9T C;  3FKI K;  2JA5 C;  3K7A C;  3S2D K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...