4QIWL

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 21
structure length 94
sequence length 94
chains with identical sequence U
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qiwL00
4A3GC 4KN7A 1TWHC 4AYBD 3GTKC 4C3IK 2PA8D 3GTPC 4A3BC 5C44K 1XPPA 3S15K 3FKIK 4BBRK 3FKIC 5IP9K 4BBRC 3HOZC 4A93K 4A93C 3GTJK 5TMCA 4Y7NC 2R92C 3S17C 4Y52K 4BY1C 1K83C 3S1RK 2E2HK 4OIRA 3GTLC 3HKZD 1YNJA 4OIPA 5C4JK 4C2MK 1I6HK 3GTMC 3H0GK 1Y1WK 4KMUA 5FJ8K 3CQZK 3CQZC 3S2HK 3S17K 3K7AC 4A3FK 3K7AK 2R93C 2R93K 2O5JA 4A3DC 4A3GK 4LJZA 2Y0SL 4C3JK 4Q4ZA 3HOXC 1TWFK 4YFKA 2E2IK 2YU9K 1I3QC 1I3QK 3PO2K 5TMFA 3H0GC 1I50K 4A3LK 4XSXA 5IYBK 2A6EA 5IYBC 4YG2A 4QJVB 4BXXK 5FLMC 2PMZL 5IP7C 3PO3C 4G7HA 3S2HC 5M3FK 2JA5C 2NVXC 4LLGA 3S1MC 2E2JC 2WAQD 4A3DK 4A3IK 2R7ZK 3M4OC 3EQLA 5M3MK 4A3KC 3M4OK 4YFXA 2NVYC 3GTKK 3S1NC 3GTMK 3S1NK 3DXJA 5M5WK 3GTPK 4GZYA 1TWCC 1Y1WC 5IP7K 2BE5A 1SFOK 3GTQK 5IP9C 2JA6C 2JA5K 1TWGC 3PO3K 5C4XC 5FLMK 5M5YK 4LK1A 3HOXK 3WODA 2YU9C 3GTOC 3H3VL 2NVXK 1I50C 5C44C 3HOYK 3S1MK 1TWCK 2NVYK 4A3LC 2A6HA 5IYCK 5IYCC 3RZOK 4A3KK 3S1QC 3GTJC 4OINA 3S1QK 4BXXC 4A3MK 5IYDK 4A3MC 1SFOC 2JA7C 4OIOA 3S16K 4A3BK 2JA8C 5C3EC 2WB1L 5D4DA 4OIQA 3S2DK 4X6AC 5M5XK 4QIWL 1R9TC 1TWGK 4BBSC 3GTOK 4C3HK 4A3IC 2WAQL 2O5IA 1I6VA 5C4XK 4MEXA 1YNNA 3RZDK 3HOVC 2PA8L 3PO2C 2NVTC 3HOUK 3GTQC 5C3EK 4A3EK 4MQ9A 3M3YK 3M3YC 4A3FC 2PMZD 1R9TK 5IYDC 1ZYRA 4BY1K 2VUMC 3S2DC 4A3JC 2NVQK 4A3JK 2NVQC 2JA8K 1Y1VK 1TWFC 4QIWD 2E2IC 4MEYA 4XLPA 2PPBA 1WCMK 3GTGC 1WCMC 3H3VD 1SMYA 3HOVK 1I6HC 3HOUC 4ZH4A 3RZOC 4AYBL 4Q5SA 3RZDC 2JA7K 3S16C 2A69A 2NVTK 2CW0A 1Y1VC 3GTGK 4A3CC 1BDFA 4Y7NK 1IW7A 4X6AK 2VUMK 3I4NK 4XLNA 4KN4A 4Y52C 2R92K 4BY7C 1TWAC 2Y0SD 1TWAK 3I4MK 3I4MC 4BBSK 2E2JK 3S15C 2B63K 3S14C 2B63C 4XSZA 3S14K 4G7OA 4G7ZA 1HQMA 1TWHK 4A3EC 4A3CK 3HOZK 2A68A 4JK1A 4YFNA 3I4NC 2WB1D 3GTLK 3HOWC 3HOWK 1K83K 3S1RC 2E2HC 4QJVA 2JA6K 3HKZL 5C4JC 4NOIA 3HOYC 4LK0A 2R7ZC 4BY7K
chains in the Genus database with same CATH superfamily
3GEHA 4GFQA 4A3GC 4KN7A 1TWHC 4LOWA 1BS2A 4A3BC 1XZPA 4A93K 3GTJK 3S17C 1O27A 3S1RK 2E2HK 5IORA 3GTLC 3BP3A 4C3JC 1TWHA 5C4JK 1JVIA 1I6HK 2JA7A 1VH2A 3H0GK 3GTMC 4KDDA 2EBBA 1F9NA 3GTKA 1IBAA 4PABA 2O5JA 3A8KA 4A3GK 1WOOA 3CQZA 1I3QC 1XZQB 5TMFA 3CAGA 3PO2K 4A3LK 4G0VA 3HXAA 4YG2A 4BXXK 1PJ6A 3S2HC 3S1MC 4LLGA 3T01A 1O2BA 4C3HC 4A3IK 4YFXA 3S1NC 1XZPB 1TWCC 1Y1WC 2KWAA 2JA5K 3GSIA 1J98A 3GTQA 1TWCA 5C4XC 5M5YK 2YU9C 4WJ4A 3HOYK 3S1MK 1I50C 4KASA 5C44C 1TWCK 3GTJC 1ZQ1C 5CHPA 4BXXC 5IYDK 3ERED 2B63A 4A3BK 2JA8C 2XCRB 5D4DA 4X6AC 3S2DK 1R9TC 3GTOK 2WAQL 1I3QA 5C4XK 4MEXA 4KMAA 3GTOA 3PO2C 4AH6A 4MQ9A 1I50A 1V5VA 1ZYRA 1WQHA 4G0WA 2FQTA 4XLPA 3GTMA 3RZOC 2ZUFA 3AD8C 1EH1A 5IOTA 3RZDC 2A69A 2R92A 3SZYA 4A3CC 1TWAA 1IW7A 2VUMK 3I4NK 4XLNA 2NVXA 4KN4A 3NUHA 3I4MC 4KM9A 1VGXA 5TJ3A 4XSZA 1JQWA 1TWHK 3N0CA 3A8JA 4JK1A 3I4NC 3GTLK 1XXAA 4QJVA 1WOSA 5C4JC 4NOIA 4LK0A 2JA6A 3GTKC 4GTFA 3GTPC 4BKWA 5C44K 1XPPA 3FKIK 3TTGA 2CFAA 4Y7NC 2R92C 1WOPA 1O24A 3H0GA 4OIPA 1WORA 1J6XA 1WSRA 1AB4A 3L4JA 3GTGA 1JOEA 4KMUA 1ZBSA 1Y1WA 4KATA 4LJZA 1O2AA 4C3JK 3HOXC 1B4BA 1I3QK 4GTAA 4XSXA 5IOSA 4P9SA 4M1XA 3PO3C 1C0AA 4G7HA 3V4GA 2JA5C 5EGEA 3SZZA 2FQOA 4A3DK 2R7ZK 5M3MK 3GTKK 1WCMA 3S1NK 2RH6A 3DXJA 3GTPK 1WQGA 2BE5A 1SFOK 3AD9C 3GTQK 2VUMA 1GE9A 3JSTA 1PJ7A 2YU9A 5FLMK 4PAAA 1ZXOA 3OREA 3WODA 3FOEA 4A3LC 2NVYK 1J6VA 3RZOK 3GTLA 4A3MK 4A3MC 2V6SA 3S16K 4GT9A 4KARA 1I6VA 3TFJA 3RZDK 1YCLA 4BLBA 4XCHA 4ILDA 3S2DC 4A3JC 2NVQK 1TWFC 1XXCA 5E68A 3H3VD 4KMDA 2CFAB 1O26A 4Q5SA 2D6FC 4KB4A 2JA7K 1BDFA 3MMLB 4Y7NK 4Y52C 3Q3QA 4BY7C 1TWAC 1G51A 5EGHA 1EQRA 3FHZA 3I4MK 4KB2A 3S14C 1WIHA 3S14K 1BGWA 2Y3PA 1HQMA 4C45A 4G7ZA 4A3EC 4LQYA 4GTBA 2GSNA 2A68A 2WB1D 1K83K 3G4AA 3GTOC 5JVOA 4C3IK 4WJ3M 1O2FB 3S15K 4BBRK 1WQFA 3FKIC 5IP9K 3HOZC 5TMCA 1YNJA 3GTJA 4C2MK 2ZUEA 1RU0A 1Y1WK 3A8IA 2W7VA 5FJ8K 3IPJA 3S17K 3K7AC 4A3FK 3K7AK 2R93C 2R93K 2YU9K 1TWFK 5CJ9A 4G0UA 3H0GC 3FOFA 5IYBK 2A6EA 5IYBC 1ZVUA 4GTLA 1Y1VA 3TFIA 5FLMC 2P5MA 5M3FK 1VLOA 1EFWA 3GTPA 3EQLA 3OEPA 1YX2A 3AD7C 5IP9C 3PO3K 2GSOA 4GTCA 3VA7A 3BUEA 4LK1A 3H3VL 4KMHA 1PJ5A 2A6HA 4GTEA 3S1QC 3S1QK 1F7VA 3T00A 1SFOC 2NVYA 1O29A 4OIQA 4GTDA 1X31C 4C2MC 4FZBA 2O5IA 1XZQA 1F7UA 2PA8L 5C3EK 4BLAA 4A3EK 1DCHA 3S0XA 4A3FC 1KQ4A 3LAJA 4BY1K 1F93A 2VUMC 2R7ZA 3T02A 4A3JK 2NVQC 1Y1VK 4QIWD 2E2IC 1WCMK 1SMYA 2P8TA 3HOVK 1I6HC 3HOUC 4AYBL 1EK8A 1VJEA 3GEEA 1DCOA 2NVTK 2CW0A 1Y1VC 2Y0SD 1O25A 1TWAK 4BBSK 2E2JK 3S15C 2B63K 2B63C 1UV7A 2E2IA 2GAHC 1TWGA 4YFNA 3HOWC 2XCQA 3S1RC 2E2HC 2JA6K 4P5AA 4BY7K 4FM9A 2PHCB 5HL8A 4AYBD 2PA8D 4C3IC 3GIRA 4A93C 4BBRC 4Y52K 2V6UA 4BY1C 1K83C 3FKIA 4OIRA 3HKZD 1R9TA 1IS1A 2GSUA 3L4KA 4P5BA 3LAPA 4WILA 3CQZK 4O2DA 3CQZC 3S2HK 4A3DC 4J3NA 1BJTA 2Y0SL 4Q4ZA 4KM8A 4YFKA 2E2IK 2RGRA 3G4CA 1I50K 1K83A 4QJVB 2PMZL 5IP7C 2NVXC 2E2JC 2WAQD 3M4OC 3M4OK 4A3KC 2NVYC 1J6WA 2V6TA 3GTMK 2GAGC 5M5WK 4GZYA 2ZFZA 2R93A 5IP7K 4RMFA 1VRQC 1USOA 2JA6C 1XXBA 1TWGC 1B4AA 3LPXA 3HOXK 2NVXK 5IYCK 5IYCC 4A3KK 4LR2A 4OINA 3N0BA 2JA7C 4OIOA 1HI9A 1USMA 5C3EC 1ISEA 2WB1L 3ADAC 5M5XK 4QIWL 1TWGK 4C3HK 4A3IC 3TFHA 3GEIA 1YNNA 3HOVC 1WSVA 2NVTC 1IL2A 3GTQC 3HOUK 5JFEA 3M3YK 2E2HA 1IE0A 3M3YC 3AQPA 1EI6A 2PMZD 1R9TK 5IYDC 3AH5A 4BBSC 3GDZA 2JA8K 3OPFA 3GTGC 4MEYA 4KC6A 2PPBA 4KAWX 1WCMC 1O28A 2XCOA 4ZH4A 1L0WA 3N3YA 3S16C 3GTGK 4X6AK 1SFOA 2JA5A 2R92K 5IOQA 1DD5A 2JH3A 5L46A 4G7OA 3AQOA 1TWFA 1DCPA 4A3CK 3HOZK 1IQ0A 3HOWK 3HKZL 3BP8C 3QX3A 3HOYC 1INNA 2R7ZC 4DDQA
chains in the Genus database with same CATH topology
4A3GC 4KN7A 1TWHC 4AYBD 3GTKC 4C3IK 2PA8D 3GTPC 4A3BC 5C44K 1XPPA 3S15K 3FKIK 4BBRK 3FKIC 5IP9K 4BBRC 3HOZC 4A93K 4A93C 3GTJK 5TMCA 4Y7NC 2R92C 3S17C 4Y52K 4BY1C 1K83C 3S1RK 2E2HK 4OIRA 3GTLC 3HKZD 1YNJA 4OIPA 5C4JK 4C2MK 1I6HK 3GTMC 3H0GK 1Y1WK 4KMUA 5FJ8K 3CQZK 3CQZC 3S2HK 3S17K 3K7AC 4A3FK 3K7AK 2R93C 2R93K 2O5JA 4A3DC 4A3GK 4LJZA 2Y0SL 4C3JK 4Q4ZA 3HOXC 1TWFK 4YFKA 2E2IK 2YU9K 1I3QC 1I3QK 3PO2K 5TMFA 3H0GC 1I50K 4A3LK 4XSXA 5IYBK 2A6EA 5IYBC 4YG2A 4QJVB 4BXXK 5FLMC 2PMZL 5IP7C 3PO3C 4G7HA 3S2HC 5M3FK 2JA5C 2NVXC 4LLGA 3S1MC 2E2JC 2WAQD 4A3DK 4A3IK 2R7ZK 3M4OC 3EQLA 5M3MK 4A3KC 3M4OK 4YFXA 2NVYC 3GTKK 3S1NC 3GTMK 3S1NK 3DXJA 5M5WK 3GTPK 4GZYA 1TWCC 1Y1WC 5IP7K 2BE5A 1SFOK 3GTQK 5IP9C 2JA6C 2JA5K 1TWGC 3PO3K 5C4XC 5FLMK 5M5YK 4LK1A 3HOXK 3WODA 2YU9C 3GTOC 3H3VL 2NVXK 1I50C 5C44C 3HOYK 3S1MK 1TWCK 2NVYK 4A3LC 2A6HA 5IYCK 5IYCC 3RZOK 4A3KK 3S1QC 3GTJC 4OINA 3S1QK 4BXXC 4A3MK 5IYDK 4A3MC 1SFOC 2JA7C 4OIOA 3S16K 4A3BK 2JA8C 5C3EC 2WB1L 5D4DA 4OIQA 3S2DK 4X6AC 5M5XK 4QIWL 1R9TC 1TWGK 4BBSC 3GTOK 4C3HK 4A3IC 2WAQL 2O5IA 1I6VA 5C4XK 4MEXA 1YNNA 3RZDK 3HOVC 2PA8L 3PO2C 2NVTC 3HOUK 3GTQC 5C3EK 4A3EK 4MQ9A 3M3YK 3M3YC 4A3FC 2PMZD 1R9TK 5IYDC 1ZYRA 4BY1K 2VUMC 3S2DC 4A3JC 2NVQK 4A3JK 2NVQC 2JA8K 1Y1VK 1TWFC 4QIWD 2E2IC 4MEYA 4XLPA 2PPBA 1WCMK 3GTGC 1WCMC 3H3VD 1SMYA 3HOVK 1I6HC 3HOUC 4ZH4A 3RZOC 4AYBL 4Q5SA 3RZDC 2JA7K 3S16C 2A69A 2NVTK 2CW0A 1Y1VC 3GTGK 4A3CC 1BDFA 4Y7NK 1IW7A 4X6AK 2VUMK 3I4NK 4XLNA 4KN4A 4Y52C 2R92K 4BY7C 1TWAC 2Y0SD 1TWAK 3I4MK 3I4MC 4BBSK 2E2JK 3S15C 2B63K 3S14C 2B63C 4XSZA 3S14K 4G7OA 4G7ZA 1HQMA 1TWHK 4A3EC 4A3CK 3HOZK 2A68A 4JK1A 4YFNA 3I4NC 2WB1D 3GTLK 3HOWC 3HOWK 1K83K 3S1RC 2E2HC 4QJVA 2JA6K 3HKZL 5C4JC 4NOIA 3HOYC 4LK0A 2R7ZC 4BY7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G C;  4KN7 A;  1TWH C;  4AYB D;  3GTK C;  4C3I K;  2PA8 D;  3GTP C;  4A3B C;  5C44 K;  1XPP A;  3S15 K;  3FKI K;  4BBR K;  3FKI C;  5IP9 K;  4BBR C;  3HOZ C;  4A93 K;  4A93 C;  3GTJ K;  5TMC A;  4Y7N C;  2R92 C;  3S17 C;  4Y52 K;  4BY1 C;  1K83 C;  3S1R K;  2E2H K;  4OIR A;  3GTL C;  3HKZ D;  1YNJ A;  4OIP A;  5C4J K;  4C2M K;  1I6H K;  3GTM C;  3H0G K;  1Y1W K;  4KMU A;  5FJ8 K;  3CQZ K;  3CQZ C;  3S2H K;  3S17 K;  3K7A C;  4A3F K;  3K7A K;  2R93 C;  2R93 K;  2O5J A;  4A3D C;  4A3G K;  4LJZ A;  2Y0S L;  4C3J K;  4Q4Z A;  3HOX C;  1TWF K;  4YFK A;  2E2I K;  2YU9 K;  1I3Q C;  1I3Q K;  3PO2 K;  5TMF A;  3H0G C;  1I50 K;  4A3L K;  4XSX A;  5IYB K;  2A6E A;  5IYB C;  4YG2 A;  4QJV B;  4BXX K;  5FLM C;  2PMZ L;  5IP7 C;  3PO3 C;  4G7H A;  3S2H C;  5M3F K;  2JA5 C;  2NVX C;  4LLG A;  3S1M C;  2E2J C;  2WAQ D;  4A3D K;  4A3I K;  2R7Z K;  3M4O C;  3EQL A;  5M3M K;  4A3K C;  3M4O K;  4YFX A;  2NVY C;  3GTK K;  3S1N C;  3GTM K;  3S1N K;  3DXJ A;  5M5W K;  3GTP K;  4GZY A;  1TWC C;  1Y1W C;  5IP7 K;  2BE5 A;  1SFO K;  3GTQ K;  5IP9 C;  2JA6 C;  2JA5 K;  1TWG C;  3PO3 K;  5C4X C;  5FLM K;  5M5Y K;  4LK1 A;  3HOX K;  3WOD A;  2YU9 C;  3GTO C;  3H3V L;  2NVX K;  1I50 C;  5C44 C;  3HOY K;  3S1M K;  1TWC K;  2NVY K;  4A3L C;  2A6H A;  5IYC K;  5IYC C;  3RZO K;  4A3K K;  3S1Q C;  3GTJ C;  4OIN A;  3S1Q K;  4BXX C;  4A3M K;  5IYD K;  4A3M C;  1SFO C;  2JA7 C;  4OIO A;  3S16 K;  4A3B K;  2JA8 C;  5C3E C;  2WB1 L;  5D4D A;  4OIQ A;  3S2D K;  4X6A C;  5M5X K;  4QIW L;  1R9T C;  1TWG K;  4BBS C;  3GTO K;  4C3H K;  4A3I C;  2WAQ L;  2O5I A;  1I6V A;  5C4X K;  4MEX A;  1YNN A;  3RZD K;  3HOV C;  2PA8 L;  3PO2 C;  2NVT C;  3HOU K;  3GTQ C;  5C3E K;  4A3E K;  4MQ9 A;  3M3Y K;  3M3Y C;  4A3F C;  2PMZ D;  1R9T K;  5IYD C;  1ZYR A;  4BY1 K;  2VUM C;  3S2D C;  4A3J C;  2NVQ K;  4A3J K;  2NVQ C;  2JA8 K;  1Y1V K;  1TWF C;  4QIW D;  2E2I C;  4MEY A;  4XLP A;  2PPB A;  1WCM K;  3GTG C;  1WCM C;  3H3V D;  1SMY A;  3HOV K;  1I6H C;  3HOU C;  4ZH4 A;  3RZO C;  4AYB L;  4Q5S A;  3RZD C;  2JA7 K;  3S16 C;  2A69 A;  2NVT K;  2CW0 A;  1Y1V C;  3GTG K;  4A3C C;  1BDF A;  4Y7N K;  1IW7 A;  4X6A K;  2VUM K;  3I4N K;  4XLN A;  4KN4 A;  4Y52 C;  2R92 K;  4BY7 C;  1TWA C;  2Y0S D;  1TWA K;  3I4M K;  3I4M C;  4BBS K;  2E2J K;  3S15 C;  2B63 K;  3S14 C;  2B63 C;  4XSZ A;  3S14 K;  4G7O A;  4G7Z A;  1HQM A;  1TWH K;  4A3E C;  4A3C K;  3HOZ K;  2A68 A;  4JK1 A;  4YFN A;  3I4N C;  2WB1 D;  3GTL K;  3HOW C;  3HOW K;  1K83 K;  3S1R C;  2E2H C;  4QJV A;  2JA6 K;  3HKZ L;  5C4J C;  4NOI A;  3HOY C;  4LK0 A;  2R7Z C;  4BY7 K; 
#chains in the Genus database with same CATH topology
 3GEH A;  4GFQ A;  4A3G C;  4KN7 A;  1TWH C;  4LOW A;  1BS2 A;  4A3B C;  1XZP A;  4A93 K;  3GTJ K;  3S17 C;  1O27 A;  3S1R K;  2E2H K;  5IOR A;  3GTL C;  3BP3 A;  4C3J C;  1TWH A;  5C4J K;  1JVI A;  1I6H K;  2JA7 A;  1VH2 A;  3H0G K;  3GTM C;  4KDD A;  2EBB A;  1F9N A;  3GTK A;  1IBA A;  4PAB A;  2O5J A;  3A8K A;  4A3G K;  1WOO A;  3CQZ A;  1I3Q C;  1XZQ B;  5TMF A;  3CAG A;  3PO2 K;  4A3L K;  4G0V A;  3HXA A;  4YG2 A;  4BXX K;  1PJ6 A;  3S2H C;  3S1M C;  4LLG A;  3T01 A;  1O2B A;  4C3H C;  4A3I K;  4YFX A;  3S1N C;  1XZP B;  1TWC C;  1Y1W C;  2KWA A;  2JA5 K;  3GSI A;  1J98 A;  3GTQ A;  1TWC A;  5C4X C;  5M5Y K;  2YU9 C;  4WJ4 A;  3HOY K;  3S1M K;  1I50 C;  4KAS A;  5C44 C;  1TWC K;  3GTJ C;  1ZQ1 C;  5CHP A;  4BXX C;  5IYD K;  3ERE D;  2B63 A;  4A3B K;  2JA8 C;  2XCR B;  5D4D A;  4X6A C;  3S2D K;  1R9T C;  3GTO K;  2WAQ L;  1I3Q A;  5C4X K;  4MEX A;  4KMA A;  3GTO A;  3PO2 C;  4AH6 A;  4MQ9 A;  1I50 A;  1V5V A;  1ZYR A;  1WQH A;  4G0W A;  2FQT A;  4XLP A;  3GTM A;  3RZO C;  2ZUF A;  3AD8 C;  1EH1 A;  5IOT A;  3RZD C;  2A69 A;  2R92 A;  3SZY A;  4A3C C;  1TWA A;  1IW7 A;  2VUM K;  3I4N K;  4XLN A;  2NVX A;  4KN4 A;  3NUH A;  3I4M C;  4KM9 A;  1VGX A;  5TJ3 A;  4XSZ A;  1JQW A;  1TWH K;  3N0C A;  3A8J A;  4JK1 A;  3I4N C;  3GTL K;  1XXA A;  4QJV A;  1WOS A;  5C4J C;  4NOI A;  4LK0 A;  2JA6 A;  3GTK C;  4GTF A;  3GTP C;  4BKW A;  5C44 K;  1XPP A;  3FKI K;  3TTG A;  2CFA A;  4Y7N C;  2R92 C;  1WOP A;  1O24 A;  3H0G A;  4OIP A;  1WOR A;  1J6X A;  1WSR A;  1AB4 A;  3L4J A;  3GTG A;  1JOE A;  4KMU A;  1ZBS A;  1Y1W A;  4KAT A;  4LJZ A;  1O2A A;  4C3J K;  3HOX C;  1B4B A;  1I3Q K;  4GTA A;  4XSX A;  5IOS A;  4P9S A;  4M1X A;  3PO3 C;  1C0A A;  4G7H A;  3V4G A;  2JA5 C;  5EGE A;  3SZZ A;  2FQO A;  4A3D K;  2R7Z K;  5M3M K;  3GTK K;  1WCM A;  3S1N K;  2RH6 A;  3DXJ A;  3GTP K;  1WQG A;  2BE5 A;  1SFO K;  3AD9 C;  3GTQ K;  2VUM A;  1GE9 A;  3JST A;  1PJ7 A;  2YU9 A;  5FLM K;  4PAA A;  1ZXO A;  3ORE A;  3WOD A;  3FOE A;  4A3L C;  2NVY K;  1J6V A;  3RZO K;  3GTL A;  4A3M K;  4A3M C;  2V6S A;  3S16 K;  4GT9 A;  4KAR A;  1I6V A;  3TFJ A;  3RZD K;  1YCL A;  4BLB A;  4XCH A;  4ILD A;  3S2D C;  4A3J C;  2NVQ K;  1TWF C;  1XXC A;  5E68 A;  3H3V D;  4KMD A;  2CFA B;  1O26 A;  4Q5S A;  2D6F C;  4KB4 A;  2JA7 K;  1BDF A;  3MML B;  4Y7N K;  4Y52 C;  3Q3Q A;  4BY7 C;  1TWA C;  1G51 A;  5EGH A;  1EQR A;  3FHZ A;  3I4M K;  4KB2 A;  3S14 C;  1WIH A;  3S14 K;  1BGW A;  2Y3P A;  1HQM A;  4C45 A;  4G7Z A;  4A3E C;  4LQY A;  4GTB A;  2GSN A;  2A68 A;  2WB1 D;  1K83 K;  3G4A A;  3GTO C;  5JVO A;  4C3I K;  4WJ3 M;  1O2F B;  3S15 K;  4BBR K;  1WQF A;  3FKI C;  5IP9 K;  3HOZ C;  5TMC A;  1YNJ A;  3GTJ A;  4C2M K;  2ZUE A;  1RU0 A;  1Y1W K;  3A8I A;  2W7V A;  5FJ8 K;  3IPJ A;  3S17 K;  3K7A C;  4A3F K;  3K7A K;  2R93 C;  2R93 K;  2YU9 K;  1TWF K;  5CJ9 A;  4G0U A;  3H0G C;  3FOF A;  5IYB K;  2A6E A;  5IYB C;  1ZVU A;  4GTL A;  1Y1V A;  3TFI A;  5FLM C;  2P5M A;  5M3F K;  1VLO A;  1EFW A;  3GTP A;  3EQL A;  3OEP A;  1YX2 A;  3AD7 C;  5IP9 C;  3PO3 K;  2GSO A;  4GTC A;  3VA7 A;  3BUE A;  4LK1 A;  3H3V L;  4KMH A;  1PJ5 A;  2A6H A;  4GTE A;  3S1Q C;  3S1Q K;  1F7V A;  3T00 A;  1SFO C;  2NVY A;  1O29 A;  4OIQ A;  4GTD A;  1X31 C;  4C2M C;  4FZB A;  2O5I A;  1XZQ A;  1F7U A;  2PA8 L;  5C3E K;  4BLA A;  4A3E K;  1DCH A;  3S0X A;  4A3F C;  1KQ4 A;  3LAJ A;  4BY1 K;  1F93 A;  2VUM C;  2R7Z A;  3T02 A;  4A3J K;  2NVQ C;  1Y1V K;  4QIW D;  2E2I C;  1WCM K;  1SMY A;  2P8T A;  3HOV K;  1I6H C;  3HOU C;  4AYB L;  1EK8 A;  1VJE A;  3GEE A;  1DCO A;  2NVT K;  2CW0 A;  1Y1V C;  2Y0S D;  1O25 A;  1TWA K;  4BBS K;  2E2J K;  3S15 C;  2B63 K;  2B63 C;  1UV7 A;  2E2I A;  2GAH C;  1TWG A;  4YFN A;  3HOW C;  2XCQ A;  3S1R C;  2E2H C;  2JA6 K;  4P5A A;  4BY7 K;  4FM9 A;  2PHC B;  5HL8 A;  4AYB D;  2PA8 D;  4C3I C;  3GIR A;  4A93 C;  4BBR C;  4Y52 K;  2V6U A;  4BY1 C;  1K83 C;  3FKI A;  4OIR A;  3HKZ D;  1R9T A;  1IS1 A;  2GSU A;  3L4K A;  4P5B A;  3LAP A;  4WIL A;  3CQZ K;  4O2D A;  3CQZ C;  3S2H K;  4A3D C;  4J3N A;  1BJT A;  2Y0S L;  4Q4Z A;  4KM8 A;  4YFK A;  2E2I K;  2RGR A;  3G4C A;  1I50 K;  1K83 A;  4QJV B;  2PMZ L;  5IP7 C;  2NVX C;  2E2J C;  2WAQ D;  3M4O C;  3M4O K;  4A3K C;  2NVY C;  1J6W A;  2V6T A;  3GTM K;  2GAG C;  5M5W K;  4GZY A;  2ZFZ A;  2R93 A;  5IP7 K;  4RMF A;  1VRQ C;  1USO A;  2JA6 C;  1XXB A;  1TWG C;  1B4A A;  3LPX A;  3HOX K;  2NVX K;  5IYC K;  5IYC C;  4A3K K;  4LR2 A;  4OIN A;  3N0B A;  2JA7 C;  4OIO A;  1HI9 A;  1USM A;  5C3E C;  1ISE A;  2WB1 L;  3ADA C;  5M5X K;  4QIW L;  1TWG K;  4C3H K;  4A3I C;  3TFH A;  3GEI A;  1YNN A;  3HOV C;  1WSV A;  2NVT C;  1IL2 A;  3GTQ C;  3HOU K;  5JFE A;  3M3Y K;  2E2H A;  1IE0 A;  3M3Y C;  3AQP A;  1EI6 A;  2PMZ D;  1R9T K;  5IYD C;  3AH5 A;  4BBS C;  3GDZ A;  2JA8 K;  3OPF A;  3GTG C;  4MEY A;  4KC6 A;  2PPB A;  4KAW X;  1WCM C;  1O28 A;  2XCO A;  4ZH4 A;  1L0W A;  3N3Y A;  3S16 C;  3GTG K;  4X6A K;  1SFO A;  2JA5 A;  2R92 K;  5IOQ A;  1DD5 A;  2JH3 A;  5L46 A;  4G7O A;  3AQO A;  1TWF A;  1DCP A;  4A3C K;  3HOZ K;  1IQ0 A;  3HOW K;  3HKZ L;  3BP8 C;  3QX3 A;  3HOY C;  1INN A;  2R7Z C;  4DDQ A; 
#chains in the Genus database with same CATH homology
 4A3G C;  4KN7 A;  1TWH C;  4AYB D;  3GTK C;  4C3I K;  2PA8 D;  3GTP C;  4A3B C;  5C44 K;  1XPP A;  3S15 K;  3FKI K;  4BBR K;  3FKI C;  5IP9 K;  4BBR C;  3HOZ C;  4A93 K;  4A93 C;  3GTJ K;  5TMC A;  4Y7N C;  2R92 C;  3S17 C;  4Y52 K;  4BY1 C;  1K83 C;  3S1R K;  2E2H K;  4OIR A;  3GTL C;  3HKZ D;  1YNJ A;  4OIP A;  5C4J K;  4C2M K;  1I6H K;  3GTM C;  3H0G K;  1Y1W K;  4KMU A;  5FJ8 K;  3CQZ K;  3CQZ C;  3S2H K;  3S17 K;  3K7A C;  4A3F K;  3K7A K;  2R93 C;  2R93 K;  2O5J A;  4A3D C;  4A3G K;  4LJZ A;  2Y0S L;  4C3J K;  4Q4Z A;  3HOX C;  1TWF K;  4YFK A;  2E2I K;  2YU9 K;  1I3Q C;  1I3Q K;  3PO2 K;  5TMF A;  3H0G C;  1I50 K;  4A3L K;  4XSX A;  5IYB K;  2A6E A;  5IYB C;  4YG2 A;  4QJV B;  4BXX K;  5FLM C;  2PMZ L;  5IP7 C;  3PO3 C;  4G7H A;  3S2H C;  5M3F K;  2JA5 C;  2NVX C;  4LLG A;  3S1M C;  2E2J C;  2WAQ D;  4A3D K;  4A3I K;  2R7Z K;  3M4O C;  3EQL A;  5M3M K;  4A3K C;  3M4O K;  4YFX A;  2NVY C;  3GTK K;  3S1N C;  3GTM K;  3S1N K;  3DXJ A;  5M5W K;  3GTP K;  4GZY A;  1TWC C;  1Y1W C;  5IP7 K;  2BE5 A;  1SFO K;  3GTQ K;  5IP9 C;  2JA6 C;  2JA5 K;  1TWG C;  3PO3 K;  5C4X C;  5FLM K;  5M5Y K;  4LK1 A;  3HOX K;  3WOD A;  2YU9 C;  3GTO C;  3H3V L;  2NVX K;  1I50 C;  5C44 C;  3HOY K;  3S1M K;  1TWC K;  2NVY K;  4A3L C;  2A6H A;  5IYC K;  5IYC C;  3RZO K;  4A3K K;  3S1Q C;  3GTJ C;  4OIN A;  3S1Q K;  4BXX C;  4A3M K;  5IYD K;  4A3M C;  1SFO C;  2JA7 C;  4OIO A;  3S16 K;  4A3B K;  2JA8 C;  5C3E C;  2WB1 L;  5D4D A;  4OIQ A;  3S2D K;  4X6A C;  5M5X K;  4QIW L;  1R9T C;  1TWG K;  4BBS C;  3GTO K;  4C3H K;  4A3I C;  2WAQ L;  2O5I A;  1I6V A;  5C4X K;  4MEX A;  1YNN A;  3RZD K;  3HOV C;  2PA8 L;  3PO2 C;  2NVT C;  3HOU K;  3GTQ C;  5C3E K;  4A3E K;  4MQ9 A;  3M3Y K;  3M3Y C;  4A3F C;  2PMZ D;  1R9T K;  5IYD C;  1ZYR A;  4BY1 K;  2VUM C;  3S2D C;  4A3J C;  2NVQ K;  4A3J K;  2NVQ C;  2JA8 K;  1Y1V K;  1TWF C;  4QIW D;  2E2I C;  4MEY A;  4XLP A;  2PPB A;  1WCM K;  3GTG C;  1WCM C;  3H3V D;  1SMY A;  3HOV K;  1I6H C;  3HOU C;  4ZH4 A;  3RZO C;  4AYB L;  4Q5S A;  3RZD C;  2JA7 K;  3S16 C;  2A69 A;  2NVT K;  2CW0 A;  1Y1V C;  3GTG K;  4A3C C;  1BDF A;  4Y7N K;  1IW7 A;  4X6A K;  2VUM K;  3I4N K;  4XLN A;  4KN4 A;  4Y52 C;  2R92 K;  4BY7 C;  1TWA C;  2Y0S D;  1TWA K;  3I4M K;  3I4M C;  4BBS K;  2E2J K;  3S15 C;  2B63 K;  3S14 C;  2B63 C;  4XSZ A;  3S14 K;  4G7O A;  4G7Z A;  1HQM A;  1TWH K;  4A3E C;  4A3C K;  3HOZ K;  2A68 A;  4JK1 A;  4YFN A;  3I4N C;  2WB1 D;  3GTL K;  3HOW C;  3HOW K;  1K83 K;  3S1R C;  2E2H C;  4QJV A;  2JA6 K;  3HKZ L;  5C4J C;  4NOI A;  3HOY C;  4LK0 A;  2R7Z C;  4BY7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...