4QIWL

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
MRIEVIRREENLLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKALEEAAQKIFDRAREVLEAWKAAIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 94
sequence length 94
chains with identical sequence U
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4qiwL00
1TWGK 5C3EK 5D4DA 1TWAC 4A3KC 3S2DK 3S17K 3S1MC 4KMUA 2E2HK 5M5WK 3DXJA 4YG2A 3GTKC 1R9TK 4A3BC 2NVTC 4AYBD 5C4XC 4QIWD 2A69A 4A3MK 1K83C 2WAQL 4YFKA 3GTGK 3M3YK 3GTPC 3HOXC 4Y52C 4C2MK 2WB1L 4OIRA 3S1RC 3FKIK 4A3IC 1TWCK 1TWHC 2PMZL 2VUMK 3PO2K 2Y0SD 5C44K 4G7HA 3S16K 2O5JA 2BE5A 4BBRC 4KN4A 1Y1VC 4A3DC 4X6AK 1YNJA 3K7AK 4XSZA 3EQLA 3S14K 5IYBK 1Y1WK 3GTLK 1WCMK 1TWFK 4MEYA 4XLPA 2PA8D 2PPBA 2JA5C 3HOWK 1I50C 4A3CK 1I6HC 5IP9C 3S15K 1SFOK 5C3EC 4NOIA 2NVXK 3H3VL 3RZDK 3I4MK 4OINA 5TMFA 1YNNA 2E2HC 3CQZK 5M5XK 4JK1A 4C3HK 5M3MK 1R9TC 4XLNA 4A3FK 4A3MC 2NVYC 3HKZL 4BY7K 3GTGC 3M3YC 3I4NC 3HOVC 3H0GK 4OIPA 5C4JK 5TMCA 3FKIC 2B63K 4ZH4A 3PO2C 5C44C 4QJVA 3S16C 4A3LK 5M5YK 4QIWL 4LK0A 3K7AC 4GZYA 4BY1K 5IYBC 3S2HK 2JA6C 4A3JK 1WCMC 3S1QC 1HQMA 1TWFC 4A3EK 3HOWC 2NVQK 3S15C 4A3DK 1SFOC 5IYDK 2NVXC 3I4MC 3HOYC 5M3FK 1TWGC 1ZYRA 2E2JK 2YU9K 2WB1D 5FLMK 3GTQK 3S2DC 3S17C 3S1MK 4A3FC 2PMZD 1I3QK 4Y7NK 2A6HA 4OIQA 5C4XK 2NVTK 2R7ZK 2JA8K 4G7OA 3H0GC 3HOZK 4LK1A 3GTOK 5IYCK 3GTPK 3M4OK 4A3GK 3GTJK 3H3VD 2B63C 4A3LC 4BBSK 3S1NK 1I6VA 1TWCC 2CW0A 4A93K 1IW7A 2A68A 5IP7K 2VUMC 4BY1C 4AYBL 3S2HC 4X6AC 4A3JC 2R92K 3HOUK 3HKZD 4A3EC 3S14C 4C3IK 4MQ9A 1Y1WC 4Q4ZA 5IYDC 2NVQC 5FJ8K 2JA7K 3GTLC 2WAQD 4YFXA 3GTMK 3RZOK 3PO3K 4BXXK 5IP9K 4A3CC 2E2JC 2YU9C 3GTQC 5FLMC 3RZDC 2R93K 2E2IK 3CQZC 4A3KK 1I3QC 1TWAK 2A6EA 2Y0SL 4Y7NC 1SMYA 2R7ZC 2JA8C 4XSXA 4QJVB 3GTKK 2NVYK 4BY7C 4A3BK 3HOZC 3GTOC 5IYCC 3I4NK 4G7ZA 4MEXA 3HOVK 3GTJC 2PA8L 1K83K 3M4OC 1BDFA 4A3GC 4Q5SA 4BBSC 5C4JC 3HOXK 4YFNA 4OIOA 4C3JK 3S1NC 4A93C 4LJZA 5IP7C 2O5IA 4Y52K 3S1RK 3WODA 4A3IK 1TWHK 2R92C 1XPPA 3HOUC 4BBRK 3S1QK 1Y1VK 2JA6K 3GTMC 4LLGA 3RZOC 2JA7C 3PO3C 4BXXC 4KN7A 2JA5K 2R93C 1I50K 1I6HK 3HOYK 2E2IC
chains in the Genus database with same CATH superfamily
5C3EK 1I3QA 1XZQB 4KMUA 2R7ZA 5M5WK 3DXJA 1R9TK 4AYBD 4GTCA 3NUHA 4O2DA 1J6XA 4G0VA 3AQOA 3A8JA 4A3IC 5IOSA 1IBAA 1VJEA 3EQLA 2P5MA 2CFAB 2P8TA 4BLAA 3QX3A 1TWFK 2PA8D 3G4CA 4A3CK 1SFOK 4NOIA 3RZDK 1UV7A 5M5XK 4C3HK 5M3MK 1ZVUA 1XZPA 3GSIA 4BY7K 4BLBA 3LAJA 1XXCA 5IORA 1IQ0A 1WIHA 2JH3A 2B63K 4ZH4A 5M5YK 3FOFA 2JA6C 1WCMC 2NVQK 3HOYK 1AB4A 1PJ6A 2WB1D 4OIQA 4WILA 2JA8K 5IYCK 1RU0A 4A3GK 4FM9A 3GTJK 1XZQA 1KQ4A 3V4GA 4A3LC 1I6VA 2GSUA 1J98A 4A3JC 3HOUK 3HKZD 3OREA 4A3EC 1Y1WC 4MQ9A 4A3DC 5IYDC 4BXXK 3PO3K 2WAQD 1O2BA 2RGRA 2GSOA 1TWGA 2E2JC 2YU9C 2R93K 3N3YA 1I3QC 2R7ZC 2CFAA 4XSXA 4QJVB 4KDDA 4A3BK 3HOZC 3GTOC 4KMAA 5JVOA 1K83K 1BDFA 4C3JK 3CAGA 1DCOA 1TWCA 1YCLA 1USMA 4LJZA 5IP7C 1O28A 3S1RK 1TWHK 2Y3PA 2R92C 1XPPA 3MMLB 1Y1VK 2JA6K 3GTMC 3RZOC 4P5BA 4LOWA 1I6HK 5TJ3A 3CQZA 1TWAC 3S1MC 2E2HK 3GEEA 1WOPA 2NVTC 5C4XC 3T01A 4QIWD 3BP3A 3FHZA 3GTGK 3M3YK 1BGWA 3T02A 3HOXC 4Y52C 3GDZA 3GIRA 4GTEA 3G4AA 3SZZA 3TTGA 1O24A 2Y0SD 2ZFZA 1HI9A 4BBRC 4DDQA 1YNJA 3K7AK 4XSZA 1F93A 5IYBK 1Y1WK 4MEYA 4XLPA 2FQTA 3HOWK 5IP9C 1J6VA 3S15K 2YU9A 3H3VL 2NVXK 4KAWX 3GTKA 4XLNA 1WOSA 4A3MC 1O25A 4GTBA 3GTOA 3HOVC 1F9NA 4C2MC 5IOTA 3FKIC 4GTAA 1JQWA 5C44C 4QJVA 3PO2C 3S16C 3LPXA 1INNA 2R92A 4BY1K 3S1QC 3GTMA 3I4MC 5M3FK 1TWGC 2V6UA 1TWAA 3GTQK 3S2DC 5FLMK 3S1MK 4A3FC 4Y7NK 1YX2A 2A6HA 5C4XK 2NVTK 3H0GC 3M4OK 4GTLA 1PJ5A 4BBSK 1TWCC 4C45A 3A8KA 3S2HC 1WSVA 4X6AC 4KARA 1V5VA 3S14C 4C3IK 4YFXA 2GAGC 5IP9K 1DD5A 4LR2A 3CQZC 2A6EA 3JSTA 4G0WA 5CJ9A 3HOVK 4KM9A 3AD7C 4KB2A 5E68A 5C4JC 4ILDA 1O2AA 3FKIA 4OIOA 3N0CA 3S1NC 4A93C 2VUMA 4FZBA 1J6WA 4A3IK 5HL8A 2XCRB 1EH1A 2ZUEA 3GTLA 3S1QK 2JA7C 3TFHA 1ZXOA 2E2IC 1TWGK 4GT9A 4XCHA 4A3KC 3S2DK 4M1XA 3GTKC 5L46A 1B4AA 4KM8A 1G51A 3H0GA 2WAQL 4YFKA 1JVIA 2KWAA 4AH6A 4OIRA 5CHPA 1TWCK 2PMZL 3OPFA 3GEHA 2O5JA 4G0UA 4X6AK 3AQPA 4RMFA 3S14K 1WCMK 2PPBA 5JFEA 3VA7A 2JA5C 1I50C 5C3EC 1VGXA 1BJTA 4OINA 5TMFA 1YNNA 3CQZK 3S0XA 4JK1A 1R9TC 2ZUFA 3GTPA 1GE9A 1ISEA 5C4JK 4KB4A 3FOEA 1TWHA 4A3LK 4PAAA 1DCPA 1Y1VA 4QIWL 4LK0A 3TFJA 4A3JK 1TWFC 2JA7A 3LAPA 4A3EK 2EBBA 4A3DK 5IYDK 1SFOC 1DCHA 2E2IA 1ZYRA 2E2JK 2YU9K 4C3HC 1O26A 3S17C 1WOOA 1I3QK 4GTDA 2NVYA 3AD9C 2R7ZK 1WQGA 3ERED 3HOZK 3GTOK 1JOEA 3H3VD 2B63C 2CW0A 1WQFA 5IP7K 2A68A 2VUMC 4AYBL 3HXAA 2R92K 5IOQA 3GTLC 2NVQC 3GTMK 5FJ8K 3RZOK 2JA5A 1I50A 3N0BA 4PABA 4KATA 1TWAK 2XCOA 1R9TA 2JA8C 5IYCC 4A3GC 3GTJC 2PA8L 1IE0A 4Q5SA 1ZBSA 2RH6A 3HOXK 1ZQ1C 4Y52K 2O5IA 4WJ4A 1O2FB 3T00A 3HOUC 4BBRK 4LQYA 1TWFA 4BXXC 3PO3C 4KN7A 3SZYA 1SFOA 3GTQA 1X31C 3TFIA 2R93C 3IPJA 5D4DA 1IL2A 3S17K 1C0AA 4YG2A 4A3BC 1VRQC 2W7VA 2A69A 4A3MK 1K83C 3GTPC 1EK8A 4C3JC 4C2MK 2B63A 2WB1L 4GTFA 3S1RC 3FKIK 1TWHC 2VUMK 2GSNA 3PO2K 5C44K 3BP8C 4G7HA 3S16K 2BE5A 4KN4A 1Y1VC 1VLOA 5EGHA 1USOA 3GTLK 2GAHC 1I6HC 3I4MK 4P5AA 2E2HC 3L4JA 4A3FK 1IS1A 3AH5A 1EFWA 3GEIA 2NVYC 3HKZL 3GTGC 3M3YC 3I4NC 2PHCB 3GTJA 1F7UA 3H0GK 4KMDA 4OIPA 5TMCA 2V6TA 3A8IA 3Q3QA 3ADAC 1WORA 3K7AC 4GZYA 1BS2A 3S2HK 5IYBC 1HQMA 3HOWC 3S15C 2NVXC 2R93A 5EGEA 3HOYC 4WJ3M 1XXAA 1EI6A 1XXBA 1F7VA 2PMZD 3L4KA 4G7OA 1K83A 4LK1A 3GTPK 1L0WA 3S1NK 4A93K 1IW7A 1PJ7A 4GFQA 4KASA 3OEPA 4BY1C 2JA6A 1WCMA 1XZPB 4Q4ZA 1EQRA 2JA7K 1B4BA 2XCQA 4A3CC 3GTQC 5FLMC 3RZDC 2D6FC 2E2HA 2E2IK 4A3KK 4Y7NC 2Y0SL 4KC6A 1SMYA 3GTKK 2NVYK 4BY7C 3GTGA 3I4NK 4G7ZA 4MEXA 3M4OC 1O29A 3BUEA 4BBSC 4YFNA 1VH2A 1WSRA 3WODA 1O27A 1WQHA 4KMHA 1Y1WA 4C3IC 4LLGA 2V6SA 2FQOA 4P9SA 2NVXA 3AD8C 2JA5K 1I50K 4BKWA 4J3NA
chains in the Genus database with same CATH topology
1TWGK 5C3EK 5D4DA 1TWAC 4A3KC 3S2DK 3S17K 3S1MC 4KMUA 2E2HK 5M5WK 3DXJA 4YG2A 3GTKC 1R9TK 4A3BC 2NVTC 4AYBD 5C4XC 4QIWD 2A69A 4A3MK 1K83C 2WAQL 4YFKA 3GTGK 3M3YK 3GTPC 3HOXC 4Y52C 4C2MK 2WB1L 4OIRA 3S1RC 3FKIK 4A3IC 1TWCK 1TWHC 2PMZL 2VUMK 3PO2K 2Y0SD 5C44K 4G7HA 3S16K 2O5JA 2BE5A 4BBRC 4KN4A 1Y1VC 4A3DC 4X6AK 1YNJA 3K7AK 4XSZA 3EQLA 3S14K 5IYBK 1Y1WK 3GTLK 1WCMK 1TWFK 4MEYA 4XLPA 2PA8D 2PPBA 2JA5C 3HOWK 1I50C 4A3CK 1I6HC 5IP9C 3S15K 1SFOK 5C3EC 4NOIA 2NVXK 3H3VL 3RZDK 3I4MK 4OINA 5TMFA 1YNNA 2E2HC 3CQZK 5M5XK 4JK1A 4C3HK 5M3MK 1R9TC 4XLNA 4A3FK 4A3MC 2NVYC 3HKZL 4BY7K 3GTGC 3M3YC 3I4NC 3HOVC 3H0GK 4OIPA 5C4JK 5TMCA 3FKIC 2B63K 4ZH4A 3PO2C 5C44C 4QJVA 3S16C 4A3LK 5M5YK 4QIWL 4LK0A 3K7AC 4GZYA 4BY1K 5IYBC 3S2HK 2JA6C 4A3JK 1WCMC 3S1QC 1HQMA 1TWFC 4A3EK 3HOWC 2NVQK 3S15C 4A3DK 1SFOC 5IYDK 2NVXC 3I4MC 3HOYC 5M3FK 1TWGC 1ZYRA 2E2JK 2YU9K 2WB1D 5FLMK 3GTQK 3S2DC 3S17C 3S1MK 4A3FC 2PMZD 1I3QK 4Y7NK 2A6HA 4OIQA 5C4XK 2NVTK 2R7ZK 2JA8K 4G7OA 3H0GC 3HOZK 4LK1A 3GTOK 5IYCK 3GTPK 3M4OK 4A3GK 3GTJK 3H3VD 2B63C 4A3LC 4BBSK 3S1NK 1I6VA 1TWCC 2CW0A 4A93K 1IW7A 2A68A 5IP7K 2VUMC 4BY1C 4AYBL 3S2HC 4X6AC 4A3JC 2R92K 3HOUK 3HKZD 4A3EC 3S14C 4C3IK 4MQ9A 1Y1WC 4Q4ZA 5IYDC 2NVQC 5FJ8K 2JA7K 3GTLC 2WAQD 4YFXA 3GTMK 3RZOK 3PO3K 4BXXK 5IP9K 4A3CC 2E2JC 2YU9C 3GTQC 5FLMC 3RZDC 2R93K 2E2IK 3CQZC 4A3KK 1I3QC 1TWAK 2A6EA 2Y0SL 4Y7NC 1SMYA 2R7ZC 2JA8C 4XSXA 4QJVB 3GTKK 2NVYK 4BY7C 4A3BK 3HOZC 3GTOC 5IYCC 3I4NK 4G7ZA 4MEXA 3HOVK 3GTJC 2PA8L 1K83K 3M4OC 1BDFA 4A3GC 4Q5SA 4BBSC 5C4JC 3HOXK 4YFNA 4OIOA 4C3JK 3S1NC 4A93C 4LJZA 5IP7C 2O5IA 4Y52K 3S1RK 3WODA 4A3IK 1TWHK 2R92C 1XPPA 3HOUC 4BBRK 3S1QK 1Y1VK 2JA6K 3GTMC 4LLGA 3RZOC 2JA7C 3PO3C 4BXXC 4KN7A 2JA5K 2R93C 1I50K 1I6HK 3HOYK 2E2IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG K;  5C3E K;  5D4D A;  1TWA C;  4A3K C;  3S2D K;  3S17 K;  3S1M C;  4KMU A;  2E2H K;  5M5W K;  3DXJ A;  4YG2 A;  3GTK C;  1R9T K;  4A3B C;  2NVT C;  4AYB D;  5C4X C;  4QIW D;  2A69 A;  4A3M K;  1K83 C;  2WAQ L;  4YFK A;  3GTG K;  3M3Y K;  3GTP C;  3HOX C;  4Y52 C;  4C2M K;  2WB1 L;  4OIR A;  3S1R C;  3FKI K;  4A3I C;  1TWC K;  1TWH C;  2PMZ L;  2VUM K;  3PO2 K;  2Y0S D;  5C44 K;  4G7H A;  3S16 K;  2O5J A;  2BE5 A;  4BBR C;  4KN4 A;  1Y1V C;  4A3D C;  4X6A K;  1YNJ A;  3K7A K;  4XSZ A;  3EQL A;  3S14 K;  5IYB K;  1Y1W K;  3GTL K;  1WCM K;  1TWF K;  4MEY A;  4XLP A;  2PA8 D;  2PPB A;  2JA5 C;  3HOW K;  1I50 C;  4A3C K;  1I6H C;  5IP9 C;  3S15 K;  1SFO K;  5C3E C;  4NOI A;  2NVX K;  3H3V L;  3RZD K;  3I4M K;  4OIN A;  5TMF A;  1YNN A;  2E2H C;  3CQZ K;  5M5X K;  4JK1 A;  4C3H K;  5M3M K;  1R9T C;  4XLN A;  4A3F K;  4A3M C;  2NVY C;  3HKZ L;  4BY7 K;  3GTG C;  3M3Y C;  3I4N C;  3HOV C;  3H0G K;  4OIP A;  5C4J K;  5TMC A;  3FKI C;  2B63 K;  4ZH4 A;  3PO2 C;  5C44 C;  4QJV A;  3S16 C;  4A3L K;  5M5Y K;  4QIW L;  4LK0 A;  3K7A C;  4GZY A;  4BY1 K;  5IYB C;  3S2H K;  2JA6 C;  4A3J K;  1WCM C;  3S1Q C;  1HQM A;  1TWF C;  4A3E K;  3HOW C;  2NVQ K;  3S15 C;  4A3D K;  1SFO C;  5IYD K;  2NVX C;  3I4M C;  3HOY C;  5M3F K;  1TWG C;  1ZYR A;  2E2J K;  2YU9 K;  2WB1 D;  5FLM K;  3GTQ K;  3S2D C;  3S17 C;  3S1M K;  4A3F C;  2PMZ D;  1I3Q K;  4Y7N K;  2A6H A;  4OIQ A;  5C4X K;  2NVT K;  2R7Z K;  2JA8 K;  4G7O A;  3H0G C;  3HOZ K;  4LK1 A;  3GTO K;  5IYC K;  3GTP K;  3M4O K;  4A3G K;  3GTJ K;  3H3V D;  2B63 C;  4A3L C;  4BBS K;  3S1N K;  1I6V A;  1TWC C;  2CW0 A;  4A93 K;  1IW7 A;  2A68 A;  5IP7 K;  2VUM C;  4BY1 C;  4AYB L;  3S2H C;  4X6A C;  4A3J C;  2R92 K;  3HOU K;  3HKZ D;  4A3E C;  3S14 C;  4C3I K;  4MQ9 A;  1Y1W C;  4Q4Z A;  5IYD C;  2NVQ C;  5FJ8 K;  2JA7 K;  3GTL C;  2WAQ D;  4YFX A;  3GTM K;  3RZO K;  3PO3 K;  4BXX K;  5IP9 K;  4A3C C;  2E2J C;  2YU9 C;  3GTQ C;  5FLM C;  3RZD C;  2R93 K;  2E2I K;  3CQZ C;  4A3K K;  1I3Q C;  1TWA K;  2A6E A;  2Y0S L;  4Y7N C;  1SMY A;  2R7Z C;  2JA8 C;  4XSX A;  4QJV B;  3GTK K;  2NVY K;  4BY7 C;  4A3B K;  3HOZ C;  3GTO C;  5IYC C;  3I4N K;  4G7Z A;  4MEX A;  3HOV K;  3GTJ C;  2PA8 L;  1K83 K;  3M4O C;  1BDF A;  4A3G C;  4Q5S A;  4BBS C;  5C4J C;  3HOX K;  4YFN A;  4OIO A;  4C3J K;  3S1N C;  4A93 C;  4LJZ A;  5IP7 C;  2O5I A;  4Y52 K;  3S1R K;  3WOD A;  4A3I K;  1TWH K;  2R92 C;  1XPP A;  3HOU C;  4BBR K;  3S1Q K;  1Y1V K;  2JA6 K;  3GTM C;  4LLG A;  3RZO C;  2JA7 C;  3PO3 C;  4BXX C;  4KN7 A;  2JA5 K;  2R93 C;  1I50 K;  1I6H K;  3HOY K;  2E2I C; 
#chains in the Genus database with same CATH topology
 5C3E K;  1I3Q A;  1XZQ B;  4KMU A;  2R7Z A;  5M5W K;  3DXJ A;  1R9T K;  4AYB D;  4GTC A;  3NUH A;  4O2D A;  1J6X A;  4G0V A;  3AQO A;  3A8J A;  4A3I C;  5IOS A;  1IBA A;  1VJE A;  3EQL A;  2P5M A;  2CFA B;  2P8T A;  4BLA A;  3QX3 A;  1TWF K;  2PA8 D;  3G4C A;  4A3C K;  1SFO K;  4NOI A;  3RZD K;  1UV7 A;  5M5X K;  4C3H K;  5M3M K;  1ZVU A;  1XZP A;  3GSI A;  4BY7 K;  4BLB A;  3LAJ A;  1XXC A;  5IOR A;  1IQ0 A;  1WIH A;  2JH3 A;  2B63 K;  4ZH4 A;  5M5Y K;  3FOF A;  2JA6 C;  1WCM C;  2NVQ K;  3HOY K;  1AB4 A;  1PJ6 A;  2WB1 D;  4OIQ A;  4WIL A;  2JA8 K;  5IYC K;  1RU0 A;  4A3G K;  4FM9 A;  3GTJ K;  1XZQ A;  1KQ4 A;  3V4G A;  4A3L C;  1I6V A;  2GSU A;  1J98 A;  4A3J C;  3HOU K;  3HKZ D;  3ORE A;  4A3E C;  1Y1W C;  4MQ9 A;  4A3D C;  5IYD C;  4BXX K;  3PO3 K;  2WAQ D;  1O2B A;  2RGR A;  2GSO A;  1TWG A;  2E2J C;  2YU9 C;  2R93 K;  3N3Y A;  1I3Q C;  2R7Z C;  2CFA A;  4XSX A;  4QJV B;  4KDD A;  4A3B K;  3HOZ C;  3GTO C;  4KMA A;  5JVO A;  1K83 K;  1BDF A;  4C3J K;  3CAG A;  1DCO A;  1TWC A;  1YCL A;  1USM A;  4LJZ A;  5IP7 C;  1O28 A;  3S1R K;  1TWH K;  2Y3P A;  2R92 C;  1XPP A;  3MML B;  1Y1V K;  2JA6 K;  3GTM C;  3RZO C;  4P5B A;  4LOW A;  1I6H K;  5TJ3 A;  3CQZ A;  1TWA C;  3S1M C;  2E2H K;  3GEE A;  1WOP A;  2NVT C;  5C4X C;  3T01 A;  4QIW D;  3BP3 A;  3FHZ A;  3GTG K;  3M3Y K;  1BGW A;  3T02 A;  3HOX C;  4Y52 C;  3GDZ A;  3GIR A;  4GTE A;  3G4A A;  3SZZ A;  3TTG A;  1O24 A;  2Y0S D;  2ZFZ A;  1HI9 A;  4BBR C;  4DDQ A;  1YNJ A;  3K7A K;  4XSZ A;  1F93 A;  5IYB K;  1Y1W K;  4MEY A;  4XLP A;  2FQT A;  3HOW K;  5IP9 C;  1J6V A;  3S15 K;  2YU9 A;  3H3V L;  2NVX K;  4KAW X;  3GTK A;  4XLN A;  1WOS A;  4A3M C;  1O25 A;  4GTB A;  3GTO A;  3HOV C;  1F9N A;  4C2M C;  5IOT A;  3FKI C;  4GTA A;  1JQW A;  5C44 C;  4QJV A;  3PO2 C;  3S16 C;  3LPX A;  1INN A;  2R92 A;  4BY1 K;  3S1Q C;  3GTM A;  3I4M C;  5M3F K;  1TWG C;  2V6U A;  1TWA A;  3GTQ K;  3S2D C;  5FLM K;  3S1M K;  4A3F C;  4Y7N K;  1YX2 A;  2A6H A;  5C4X K;  2NVT K;  3H0G C;  3M4O K;  4GTL A;  1PJ5 A;  4BBS K;  1TWC C;  4C45 A;  3A8K A;  3S2H C;  1WSV A;  4X6A C;  4KAR A;  1V5V A;  3S14 C;  4C3I K;  4YFX A;  2GAG C;  5IP9 K;  1DD5 A;  4LR2 A;  3CQZ C;  2A6E A;  3JST A;  4G0W A;  5CJ9 A;  3HOV K;  4KM9 A;  3AD7 C;  4KB2 A;  5E68 A;  5C4J C;  4ILD A;  1O2A A;  3FKI A;  4OIO A;  3N0C A;  3S1N C;  4A93 C;  2VUM A;  4FZB A;  1J6W A;  4A3I K;  5HL8 A;  2XCR B;  1EH1 A;  2ZUE A;  3GTL A;  3S1Q K;  2JA7 C;  3TFH A;  1ZXO A;  2E2I C;  1TWG K;  4GT9 A;  4XCH A;  4A3K C;  3S2D K;  4M1X A;  3GTK C;  5L46 A;  1B4A A;  4KM8 A;  1G51 A;  3H0G A;  2WAQ L;  4YFK A;  1JVI A;  2KWA A;  4AH6 A;  4OIR A;  5CHP A;  1TWC K;  2PMZ L;  3OPF A;  3GEH A;  2O5J A;  4G0U A;  4X6A K;  3AQP A;  4RMF A;  3S14 K;  1WCM K;  2PPB A;  5JFE A;  3VA7 A;  2JA5 C;  1I50 C;  5C3E C;  1VGX A;  1BJT A;  4OIN A;  5TMF A;  1YNN A;  3CQZ K;  3S0X A;  4JK1 A;  1R9T C;  2ZUF A;  3GTP A;  1GE9 A;  1ISE A;  5C4J K;  4KB4 A;  3FOE A;  1TWH A;  4A3L K;  4PAA A;  1DCP A;  1Y1V A;  4QIW L;  4LK0 A;  3TFJ A;  4A3J K;  1TWF C;  2JA7 A;  3LAP A;  4A3E K;  2EBB A;  4A3D K;  5IYD K;  1SFO C;  1DCH A;  2E2I A;  1ZYR A;  2E2J K;  2YU9 K;  4C3H C;  1O26 A;  3S17 C;  1WOO A;  1I3Q K;  4GTD A;  2NVY A;  3AD9 C;  2R7Z K;  1WQG A;  3ERE D;  3HOZ K;  3GTO K;  1JOE A;  3H3V D;  2B63 C;  2CW0 A;  1WQF A;  5IP7 K;  2A68 A;  2VUM C;  4AYB L;  3HXA A;  2R92 K;  5IOQ A;  3GTL C;  2NVQ C;  3GTM K;  5FJ8 K;  3RZO K;  2JA5 A;  1I50 A;  3N0B A;  4PAB A;  4KAT A;  1TWA K;  2XCO A;  1R9T A;  2JA8 C;  5IYC C;  4A3G C;  3GTJ C;  2PA8 L;  1IE0 A;  4Q5S A;  1ZBS A;  2RH6 A;  3HOX K;  1ZQ1 C;  4Y52 K;  2O5I A;  4WJ4 A;  1O2F B;  3T00 A;  3HOU C;  4BBR K;  4LQY A;  1TWF A;  4BXX C;  3PO3 C;  4KN7 A;  3SZY A;  1SFO A;  3GTQ A;  1X31 C;  3TFI A;  2R93 C;  3IPJ A;  5D4D A;  1IL2 A;  3S17 K;  1C0A A;  4YG2 A;  4A3B C;  1VRQ C;  2W7V A;  2A69 A;  4A3M K;  1K83 C;  3GTP C;  1EK8 A;  4C3J C;  4C2M K;  2B63 A;  2WB1 L;  4GTF A;  3S1R C;  3FKI K;  1TWH C;  2VUM K;  2GSN A;  3PO2 K;  5C44 K;  3BP8 C;  4G7H A;  3S16 K;  2BE5 A;  4KN4 A;  1Y1V C;  1VLO A;  5EGH A;  1USO A;  3GTL K;  2GAH C;  1I6H C;  3I4M K;  4P5A A;  2E2H C;  3L4J A;  4A3F K;  1IS1 A;  3AH5 A;  1EFW A;  3GEI A;  2NVY C;  3HKZ L;  3GTG C;  3M3Y C;  3I4N C;  2PHC B;  3GTJ A;  1F7U A;  3H0G K;  4KMD A;  4OIP A;  5TMC A;  2V6T A;  3A8I A;  3Q3Q A;  3ADA C;  1WOR A;  3K7A C;  4GZY A;  1BS2 A;  3S2H K;  5IYB C;  1HQM A;  3HOW C;  3S15 C;  2NVX C;  2R93 A;  5EGE A;  3HOY C;  4WJ3 M;  1XXA A;  1EI6 A;  1XXB A;  1F7V A;  2PMZ D;  3L4K A;  4G7O A;  1K83 A;  4LK1 A;  3GTP K;  1L0W A;  3S1N K;  4A93 K;  1IW7 A;  1PJ7 A;  4GFQ A;  4KAS A;  3OEP A;  4BY1 C;  2JA6 A;  1WCM A;  1XZP B;  4Q4Z A;  1EQR A;  2JA7 K;  1B4B A;  2XCQ A;  4A3C C;  3GTQ C;  5FLM C;  3RZD C;  2D6F C;  2E2H A;  2E2I K;  4A3K K;  4Y7N C;  2Y0S L;  4KC6 A;  1SMY A;  3GTK K;  2NVY K;  4BY7 C;  3GTG A;  3I4N K;  4G7Z A;  4MEX A;  3M4O C;  1O29 A;  3BUE A;  4BBS C;  4YFN A;  1VH2 A;  1WSR A;  3WOD A;  1O27 A;  1WQH A;  4KMH A;  1Y1W A;  4C3I C;  4LLG A;  2V6S A;  2FQO A;  4P9S A;  2NVX A;  3AD8 C;  2JA5 K;  1I50 K;  4BKW A;  4J3N A; 
#chains in the Genus database with same CATH homology
 1TWG K;  5C3E K;  5D4D A;  1TWA C;  4A3K C;  3S2D K;  3S17 K;  3S1M C;  4KMU A;  2E2H K;  5M5W K;  3DXJ A;  4YG2 A;  3GTK C;  1R9T K;  4A3B C;  2NVT C;  4AYB D;  5C4X C;  4QIW D;  2A69 A;  4A3M K;  1K83 C;  2WAQ L;  4YFK A;  3GTG K;  3M3Y K;  3GTP C;  3HOX C;  4Y52 C;  4C2M K;  2WB1 L;  4OIR A;  3S1R C;  3FKI K;  4A3I C;  1TWC K;  1TWH C;  2PMZ L;  2VUM K;  3PO2 K;  2Y0S D;  5C44 K;  4G7H A;  3S16 K;  2O5J A;  2BE5 A;  4BBR C;  4KN4 A;  1Y1V C;  4A3D C;  4X6A K;  1YNJ A;  3K7A K;  4XSZ A;  3EQL A;  3S14 K;  5IYB K;  1Y1W K;  3GTL K;  1WCM K;  1TWF K;  4MEY A;  4XLP A;  2PA8 D;  2PPB A;  2JA5 C;  3HOW K;  1I50 C;  4A3C K;  1I6H C;  5IP9 C;  3S15 K;  1SFO K;  5C3E C;  4NOI A;  2NVX K;  3H3V L;  3RZD K;  3I4M K;  4OIN A;  5TMF A;  1YNN A;  2E2H C;  3CQZ K;  5M5X K;  4JK1 A;  4C3H K;  5M3M K;  1R9T C;  4XLN A;  4A3F K;  4A3M C;  2NVY C;  3HKZ L;  4BY7 K;  3GTG C;  3M3Y C;  3I4N C;  3HOV C;  3H0G K;  4OIP A;  5C4J K;  5TMC A;  3FKI C;  2B63 K;  4ZH4 A;  3PO2 C;  5C44 C;  4QJV A;  3S16 C;  4A3L K;  5M5Y K;  4QIW L;  4LK0 A;  3K7A C;  4GZY A;  4BY1 K;  5IYB C;  3S2H K;  2JA6 C;  4A3J K;  1WCM C;  3S1Q C;  1HQM A;  1TWF C;  4A3E K;  3HOW C;  2NVQ K;  3S15 C;  4A3D K;  1SFO C;  5IYD K;  2NVX C;  3I4M C;  3HOY C;  5M3F K;  1TWG C;  1ZYR A;  2E2J K;  2YU9 K;  2WB1 D;  5FLM K;  3GTQ K;  3S2D C;  3S17 C;  3S1M K;  4A3F C;  2PMZ D;  1I3Q K;  4Y7N K;  2A6H A;  4OIQ A;  5C4X K;  2NVT K;  2R7Z K;  2JA8 K;  4G7O A;  3H0G C;  3HOZ K;  4LK1 A;  3GTO K;  5IYC K;  3GTP K;  3M4O K;  4A3G K;  3GTJ K;  3H3V D;  2B63 C;  4A3L C;  4BBS K;  3S1N K;  1I6V A;  1TWC C;  2CW0 A;  4A93 K;  1IW7 A;  2A68 A;  5IP7 K;  2VUM C;  4BY1 C;  4AYB L;  3S2H C;  4X6A C;  4A3J C;  2R92 K;  3HOU K;  3HKZ D;  4A3E C;  3S14 C;  4C3I K;  4MQ9 A;  1Y1W C;  4Q4Z A;  5IYD C;  2NVQ C;  5FJ8 K;  2JA7 K;  3GTL C;  2WAQ D;  4YFX A;  3GTM K;  3RZO K;  3PO3 K;  4BXX K;  5IP9 K;  4A3C C;  2E2J C;  2YU9 C;  3GTQ C;  5FLM C;  3RZD C;  2R93 K;  2E2I K;  3CQZ C;  4A3K K;  1I3Q C;  1TWA K;  2A6E A;  2Y0S L;  4Y7N C;  1SMY A;  2R7Z C;  2JA8 C;  4XSX A;  4QJV B;  3GTK K;  2NVY K;  4BY7 C;  4A3B K;  3HOZ C;  3GTO C;  5IYC C;  3I4N K;  4G7Z A;  4MEX A;  3HOV K;  3GTJ C;  2PA8 L;  1K83 K;  3M4O C;  1BDF A;  4A3G C;  4Q5S A;  4BBS C;  5C4J C;  3HOX K;  4YFN A;  4OIO A;  4C3J K;  3S1N C;  4A93 C;  4LJZ A;  5IP7 C;  2O5I A;  4Y52 K;  3S1R K;  3WOD A;  4A3I K;  1TWH K;  2R92 C;  1XPP A;  3HOU C;  4BBR K;  3S1Q K;  1Y1V K;  2JA6 K;  3GTM C;  4LLG A;  3RZO C;  2JA7 C;  3PO3 C;  4BXX C;  4KN7 A;  2JA5 K;  2R93 C;  1I50 K;  1I6H K;  3HOY K;  2E2I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...