3GTGK

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtgK00
4A3GC 1TWFK 3PO3K 4MEYA 2JA6C 3GTOC 2WB1L 5M3FK 4XSZA 2E2HK 3GTMC 1YNNA 1I50C 1TWGK 4KMUA 3RZDK 4OIOA 1Y1WC 1SFOK 5FLMC 3GTGC 3HOVK 3K7AC 4BBRC 4OIRA 2E2IC 3S14K 3HOWK 4MEXA 5IYDK 4Q5SA 2O5JA 2NVXK 2R92C 5M5WK 2BE5A 5C44K 3S2DK 5FJ8K 3H3VL 4BY7C 1TWCK 2JA6K 3GTOK 3GTMK 4X6AC 3DXJA 3PO2K 1TWAK 1Y1WK 2R7ZC 4Y52K 5FLMK 2NVYC 4KN7A 5C4JK 4A3FK 2CW0A 3GTKC 1K83C 1ZYRA 2WB1D 1TWAC 1TWHC 4LK1A 4BBRK 5IP7K 2NVTC 3M4OC 4A93C 1I6HC 3S15C 2R92K 3RZOK 3HOYK 2E2HC 2PA8D 4BY7K 1TWGC 2YU9K 1SFOC 3HOVC 4X6AK 1I3QK 4G7ZA 3S14C 3HOWC 1K83K 5IYBK 2Y0SL 3S1NC 2NVXC 3S2DC 4A93K 5C44C 3S15K 4QJVA 1TWCC 4KN4A 2B63C 4OIPA 1Y1VK 3GTPC 4BXXK 4Y52C 5C4JC 5D4DA 4A3FC 3I4MC 3S17C 3I4NC 4JK1A 5IP7C 5IYDC 4A3JK 3CQZK 2JA7C 4G7OA 4YFXA 3S1NK 3RZOC 2JA8C 3HOYC 5C4XC 2B63K 2YU9C 2A6EA 1I3QC 1HQMA 2Y0SD 4A3MK 1YNJA 3GTPK 3H3VD 4A3LC 3FKIK 5M5YK 3I4MK 3HOZK 5IYBC 3S2HC 2JA7K 2PMZL 1XPPA 2JA8K 5TMCA 5C4XK 1Y1VC 4C3IK 4BXXC 4A3LK 4YFKA 4A3JC 3CQZC 3S16K 4LJZA 2WAQL 2R93C 3EQLA 2VUMK 3S2HK 4GZYA 3GTQK 1BDFA 4YG2A 4A3KK 5M5XK 4A3IC 3S1QK 4A3MC 4A3BK 4C2MK 1SMYA 3S1RK 2A69A 3FKIC 4XSXA 2PMZD 4NOIA 3HOZC 2R93K 1IW7A 1WCMK 4XLNA 4BY1K 4ZH4A 3S1MC 3H0GC 4A3IK 4G7HA 3M3YK 2JA5C 3GTLK 2WAQD 4OINA 4OIQA 4QIWL 4Y7NK 4C3JK 3S16C 2VUMC 4YFNA 4XLPA 3GTQC 4A3KC 2E2JC 3S1QC 4A3DK 5IYCK 3H0GK 3PO2C 3S1MK 4A3BC 2JA5K 4LLGA 4Q4ZA 3WODA 5C3EC 3S1RC 3HOUK 4BBSC 4MQ9A 1R9TC 1WCMC 4QIWD 5IP9K 4BY1C 4AYBL 2PA8L 5TMFA 2A6HA 2E2JK 4A3EC 3M3YC 3HOXC 2PPBA 3GTLC 3GTJC 4QJVB 4A3CK 3HKZL 4Y7NC 4A3GK 5C3EK 1I6VA 4BBSK 1I50K 3GTGK 4LK0A 3I4NK 1R9TK 3K7AK 5M3MK 2NVQC 4C3HK 5IYCC 4A3DC 2E2IK 4A3EK 3HOXK 3GTJK 1TWFC 3HOUC 3PO3C 4AYBD 3RZDC 3S17K 2A68A 5IP9C 3HKZD 2R7ZK 4A3CC 2NVYK 3GTKK 2NVQK 2O5IA 1TWHK 1I6HK 2NVTK 3M4OK
chains in the Genus database with same CATH superfamily
1XZQB 2PHCB 1YNNA 4KMUA 3RZDK 4KMHA 4GTDA 1O2FB 1O25A 5JVOA 1IQ0A 1K83A 4OIRA 4MEXA 3G4CA 2NVXK 1JQWA 5EGEA 5FJ8K 1SFOA 3PO2K 5E68A 1Y1WK 1XXBA 3I4NK 2CW0A 1K83C 1J6WA 4KM9A 3S15C 2R92K 1C0AA 1VGXA 1SFOC 4LR2A 3T02A 1ZQ1C 5CHPA 3QX3A 3S1NC 4KN4A 1I3QA 4RMFA 4Y52C 5C4JC 4A3FC 5IYDC 2V6SA 4YFXA 4XCHA 3HOYC 1I3QC 3GTPK 3L4KA 4G0UA 3I4MK 3CQZA 2PMZL 2JA8K 5TMCA 3GTLA 5C4XK 2XCOA 4BXXC 3FKIA 2GAHC 3A8KA 3CQZC 1VJEA 4GTFA 2CFAA 2P5MA 3S2HK 4GZYA 5M5XK 4A3IC 1BJTA 3S1QK 2JA5A 4C2MK 4XSXA 3FKIC 3HOZC 2VUMA 1WIHA 1IW7A 1X31C 4BY1K 4O2DA 3V4GA 4G7HA 4C3IC 2JA5C 3OEPA 2WAQD 4OINA 1IL2A 4C3JK 1L0WA 3S16C 1BGWA 2VUMC 4YFNA 3S0XA 1XXAA 4A3BC 4M1XA 1KQ4A 1VH2A 4MQ9A 1IS1A 4C3HC 2PA8L 5TMFA 4A3CK 3M3YC 3FOEA 3GEHA 4Y7NC 2ZFZA 5C3EK 1I6VA 4A3EK 3GTJK 3HOUC 2P8TA 3GTMA 3GTOA 2JA6A 3GTGA 2A68A 3TFHA 2E2IA 3H3VL 3SZYA 4A3GC 4KDDA 2JA6C 3FOFA 3GTOC 5M3FK 3GTMC 1WOPA 3GTGC 1SFOK 2NVYA 3K7AC 3NUHA 2E2IC 1TWAA 2ZUFA 1J6XA 4BY7C 2E2HA 4X6AC 4DDQA 3DXJA 4Y52K 5FLMK 2NVYC 4KN7A 5C4JK 4A3FK 4BBRK 3BUEA 1TWAC 5IYDK 1GE9A 1ISEA 1TWCA 3HOYK 2E2HC 2PA8D 2B63A 1TWGC 4KATA 1EQRA 1I3QK 4G0WA 2GSOA 3OREA 3S14C 3S2DC 1J6VA 4A93K 5C44C 5JFEA 1TWCC 2B63C 1F93A 4BXXK 4JK1A 3FHZA 4LQYA 5IP7C 2KWAA 3CQZK 3GTQA 1Y1VA 2A6EA 2Y0SD 1HQMA 3H3VD 4A3LC 3FKIK 2FQOA 2EBBA 3HOZK 5IYBC 1V5VA 3AQPA 4KARA 2JA7K 1XPPA 1Y1VC 4C3IK 1WQGA 1WORA 4AH6A 4BLAA 4A3JC 3S16K 2WAQL 2VUMK 3HXAA 4YG2A 3AD7C 3H0GA 1PJ7A 4A3MC 4A3BK 3N0BA 2A69A 4G0VA 4KC6A 2R93K 1O24A 4XLNA 4ZH4A 1EH1A 3ADAC 3H0GC 1ZVUA 4GTBA 3M3YK 4Y7NK 1EFWA 4FZBA 4GTEA 1R9TA 1WCMA 4XLPA 4A3KC 4J3NA 2E2JC 3S1MK 1F9NA 3S1RC 3HOUK 3WODA 3GEEA 5IORA 3LAPA 4BBSC 1O27A 1ZXOA 1WCMC 1R9TC 3GTKA 3GTLC 4BKWA 4A3GK 3T00A 3GTGK 4LK0A 3K7AK 4KB4A 5M3MK 5IYCC 2NVQC 1WSRA 2E2IK 3HOXK 4KM8A 4GT9A 3G4AA 4AYBD 3RZDC 1I50A 1Y1WA 2NVYK 2O5IA 1TWAK 2R92A 4FM9A 1TWFK 3PO3K 4MEYA 1AB4A 2E2HK 4XSZA 1I50C 1TWGK 4KMDA 1Y1WC 2D6FC 3IPJA 3PO2C 2CFAB 4WJ3M 3S14K 4Q5SA 2O5JA 2R92C 3S2DK 2BE5A 5C44K 4GFQA 1TWCK 3TFJA 3GSIA 2WB1D 4ILDA 4LK1A 5IP7K 2NVTC 3LAJA 3M4OC 3GTPA 3HOVC 3OPFA 5IOSA 3HOWC 4P5BA 1K83K 5IYBK 2Y0SL 3S15K 1WOOA 4QJVA 5L46A 2YU9A 1Y1VK 3GTPC 3AH5A 5D4DA 3I4MC 1O28A 1WQHA 3S17C 4A3JK 1PJ6A 3S1NK 3RZOC 2JA8C 4PAAA 5C4XC 2YU9C 4A3MK 1YNJA 4KMAA 5EGHA 1DCHA 3S2HC 1XZQA 3A8IA 4YFKA 3EQLA 4C45A 4A3KK 3S1RK 4NOIA 2JH3A 3L4JA 1F7VA 1USMA 1WCMK 1DD5A 1EK8A 4A3IK 3GTLK 1O29A 5HL8A 4OIQA 4PABA 2Y3PA 3GTQC 5IOTA 5IYCK 3GTJA 3AD8C 2JA5K 4LLGA 1JOEA 1O26A 1DCPA 5C3EC 1HI9A 2RH6A 3ERED 4QIWD 4AYBL 2A6HA 4A3EC 2PPBA 3GTJC 1RU0A 1I50K 3T01A 4A3DC 4C3HK 3TFIA 1UV7A 4GTLA 5IP9C 3HKZD 1J98A 2NVTK 3M4OK 2XCQA 1XXCA 2WB1L 4OIOA 3HOVK 2R7ZA 5FLMC 3AQOA 3A8JA 4BBRC 1TWHA 3HOWK 3AD9C 1G51A 5M5WK 3GTMK 2JA6K 3GTOK 2R7ZC 1WQFA 3GTKC 3S17K 1YCLA 1ZYRA 1TWHC 1I6HC 4A93C 2ZUEA 2NVXA 3RZOK 1WSVA 4BY7K 2YU9K 4WILA 4X6AK 3CAGA 2XCRB 4G7ZA 2JA7A 1XZPA 4KB2A 4P9SA 2NVXC 1F7UA 3JSTA 2GSUA 4OIPA 1VLOA 1B4AA 3I4NC 1IBAA 3SZZA 5IOQA 4WJ4A 2JA7C 4G7OA 1B4BA 2GSNA 2B63K 4BLBA 5M5YK 4KAWX 3GDZA 2R93A 1O2AA 3N3YA 4P5AA 1ZBSA 1WOSA 1O2BA 4A3LK 2GAGC 2W7VA 4KASA 4LOWA 2R93C 4LJZA 1EI6A 2V6UA 3GTQK 1BDFA 1XZPB 1PJ5A 1SMYA 2PMZD 5TJ3A 1JVIA 1VRQC 3BP8C 4GTAA 3VA7A 3S1MC 4QIWL 1YX2A 3GIRA 3MMLB 2V6TA 3S1QC 3BP3A 4A3DK 1INNA 3H0GK 4C2MC 4Q4ZA 5IP9K 4BY1C 3Q3QA 2E2JK 1DCOA 3HOXC 4QJVB 1TWFA 3HKZL 4C3JC 1IE0A 1BS2A 2RGRA 4BBSK 1TWGA 3LPXA 3GEIA 1R9TK 3TTGA 1TWFC 3PO3C 4GTCA 2FQTA 1USOA 2R7ZK 4A3CC 3GTKK 3N0CA 2NVQK 1TWHK 5CJ9A 1I6HK
chains in the Genus database with same CATH topology
4A3GC 1TWFK 3PO3K 4MEYA 2JA6C 3GTOC 2WB1L 5M3FK 4XSZA 2E2HK 3GTMC 1YNNA 1I50C 1TWGK 4KMUA 3RZDK 4OIOA 1Y1WC 1SFOK 5FLMC 3GTGC 3HOVK 3K7AC 4BBRC 4OIRA 2E2IC 3S14K 3HOWK 4MEXA 5IYDK 4Q5SA 2O5JA 2NVXK 2R92C 5M5WK 2BE5A 5C44K 3S2DK 5FJ8K 3H3VL 4BY7C 1TWCK 2JA6K 3GTOK 3GTMK 4X6AC 3DXJA 3PO2K 1TWAK 1Y1WK 2R7ZC 4Y52K 5FLMK 2NVYC 4KN7A 5C4JK 4A3FK 2CW0A 3GTKC 1K83C 1ZYRA 2WB1D 1TWAC 1TWHC 4LK1A 4BBRK 5IP7K 2NVTC 3M4OC 4A93C 1I6HC 3S15C 2R92K 3RZOK 3HOYK 2E2HC 2PA8D 4BY7K 1TWGC 2YU9K 1SFOC 3HOVC 4X6AK 1I3QK 4G7ZA 3S14C 3HOWC 1K83K 5IYBK 2Y0SL 3S1NC 2NVXC 3S2DC 4A93K 5C44C 3S15K 4QJVA 1TWCC 4KN4A 2B63C 4OIPA 1Y1VK 3GTPC 4BXXK 4Y52C 5C4JC 5D4DA 4A3FC 3I4MC 3S17C 3I4NC 4JK1A 5IP7C 5IYDC 4A3JK 3CQZK 2JA7C 4G7OA 4YFXA 3S1NK 3RZOC 2JA8C 3HOYC 5C4XC 2B63K 2YU9C 2A6EA 1I3QC 1HQMA 2Y0SD 4A3MK 1YNJA 3GTPK 3H3VD 4A3LC 3FKIK 5M5YK 3I4MK 3HOZK 5IYBC 3S2HC 2JA7K 2PMZL 1XPPA 2JA8K 5TMCA 5C4XK 1Y1VC 4C3IK 4BXXC 4A3LK 4YFKA 4A3JC 3CQZC 3S16K 4LJZA 2WAQL 2R93C 3EQLA 2VUMK 3S2HK 4GZYA 3GTQK 1BDFA 4YG2A 4A3KK 5M5XK 4A3IC 3S1QK 4A3MC 4A3BK 4C2MK 1SMYA 3S1RK 2A69A 3FKIC 4XSXA 2PMZD 4NOIA 3HOZC 2R93K 1IW7A 1WCMK 4XLNA 4BY1K 4ZH4A 3S1MC 3H0GC 4A3IK 4G7HA 3M3YK 2JA5C 3GTLK 2WAQD 4OINA 4OIQA 4QIWL 4Y7NK 4C3JK 3S16C 2VUMC 4YFNA 4XLPA 3GTQC 4A3KC 2E2JC 3S1QC 4A3DK 5IYCK 3H0GK 3PO2C 3S1MK 4A3BC 2JA5K 4LLGA 4Q4ZA 3WODA 5C3EC 3S1RC 3HOUK 4BBSC 4MQ9A 1R9TC 1WCMC 4QIWD 5IP9K 4BY1C 4AYBL 2PA8L 5TMFA 2A6HA 2E2JK 4A3EC 3M3YC 3HOXC 2PPBA 3GTLC 3GTJC 4QJVB 4A3CK 3HKZL 4Y7NC 4A3GK 5C3EK 1I6VA 4BBSK 1I50K 3GTGK 4LK0A 3I4NK 1R9TK 3K7AK 5M3MK 2NVQC 4C3HK 5IYCC 4A3DC 2E2IK 4A3EK 3HOXK 3GTJK 1TWFC 3HOUC 3PO3C 4AYBD 3RZDC 3S17K 2A68A 5IP9C 3HKZD 2R7ZK 4A3CC 2NVYK 3GTKK 2NVQK 2O5IA 1TWHK 1I6HK 2NVTK 3M4OK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G C;  1TWF K;  3PO3 K;  4MEY A;  2JA6 C;  3GTO C;  2WB1 L;  5M3F K;  4XSZ A;  2E2H K;  3GTM C;  1YNN A;  1I50 C;  1TWG K;  4KMU A;  3RZD K;  4OIO A;  1Y1W C;  1SFO K;  5FLM C;  3GTG C;  3HOV K;  3K7A C;  4BBR C;  4OIR A;  2E2I C;  3S14 K;  3HOW K;  4MEX A;  5IYD K;  4Q5S A;  2O5J A;  2NVX K;  2R92 C;  5M5W K;  2BE5 A;  5C44 K;  3S2D K;  5FJ8 K;  3H3V L;  4BY7 C;  1TWC K;  2JA6 K;  3GTO K;  3GTM K;  4X6A C;  3DXJ A;  3PO2 K;  1TWA K;  1Y1W K;  2R7Z C;  4Y52 K;  5FLM K;  2NVY C;  4KN7 A;  5C4J K;  4A3F K;  2CW0 A;  3GTK C;  1K83 C;  1ZYR A;  2WB1 D;  1TWA C;  1TWH C;  4LK1 A;  4BBR K;  5IP7 K;  2NVT C;  3M4O C;  4A93 C;  1I6H C;  3S15 C;  2R92 K;  3RZO K;  3HOY K;  2E2H C;  2PA8 D;  4BY7 K;  1TWG C;  2YU9 K;  1SFO C;  3HOV C;  4X6A K;  1I3Q K;  4G7Z A;  3S14 C;  3HOW C;  1K83 K;  5IYB K;  2Y0S L;  3S1N C;  2NVX C;  3S2D C;  4A93 K;  5C44 C;  3S15 K;  4QJV A;  1TWC C;  4KN4 A;  2B63 C;  4OIP A;  1Y1V K;  3GTP C;  4BXX K;  4Y52 C;  5C4J C;  5D4D A;  4A3F C;  3I4M C;  3S17 C;  3I4N C;  4JK1 A;  5IP7 C;  5IYD C;  4A3J K;  3CQZ K;  2JA7 C;  4G7O A;  4YFX A;  3S1N K;  3RZO C;  2JA8 C;  3HOY C;  5C4X C;  2B63 K;  2YU9 C;  2A6E A;  1I3Q C;  1HQM A;  2Y0S D;  4A3M K;  1YNJ A;  3GTP K;  3H3V D;  4A3L C;  3FKI K;  5M5Y K;  3I4M K;  3HOZ K;  5IYB C;  3S2H C;  2JA7 K;  2PMZ L;  1XPP A;  2JA8 K;  5TMC A;  5C4X K;  1Y1V C;  4C3I K;  4BXX C;  4A3L K;  4YFK A;  4A3J C;  3CQZ C;  3S16 K;  4LJZ A;  2WAQ L;  2R93 C;  3EQL A;  2VUM K;  3S2H K;  4GZY A;  3GTQ K;  1BDF A;  4YG2 A;  4A3K K;  5M5X K;  4A3I C;  3S1Q K;  4A3M C;  4A3B K;  4C2M K;  1SMY A;  3S1R K;  2A69 A;  3FKI C;  4XSX A;  2PMZ D;  4NOI A;  3HOZ C;  2R93 K;  1IW7 A;  1WCM K;  4XLN A;  4BY1 K;  4ZH4 A;  3S1M C;  3H0G C;  4A3I K;  4G7H A;  3M3Y K;  2JA5 C;  3GTL K;  2WAQ D;  4OIN A;  4OIQ A;  4QIW L;  4Y7N K;  4C3J K;  3S16 C;  2VUM C;  4YFN A;  4XLP A;  3GTQ C;  4A3K C;  2E2J C;  3S1Q C;  4A3D K;  5IYC K;  3H0G K;  3PO2 C;  3S1M K;  4A3B C;  2JA5 K;  4LLG A;  4Q4Z A;  3WOD A;  5C3E C;  3S1R C;  3HOU K;  4BBS C;  4MQ9 A;  1R9T C;  1WCM C;  4QIW D;  5IP9 K;  4BY1 C;  4AYB L;  2PA8 L;  5TMF A;  2A6H A;  2E2J K;  4A3E C;  3M3Y C;  3HOX C;  2PPB A;  3GTL C;  3GTJ C;  4QJV B;  4A3C K;  3HKZ L;  4Y7N C;  4A3G K;  5C3E K;  1I6V A;  4BBS K;  1I50 K;  3GTG K;  4LK0 A;  3I4N K;  1R9T K;  3K7A K;  5M3M K;  2NVQ C;  4C3H K;  5IYC C;  4A3D C;  2E2I K;  4A3E K;  3HOX K;  3GTJ K;  1TWF C;  3HOU C;  3PO3 C;  4AYB D;  3RZD C;  3S17 K;  2A68 A;  5IP9 C;  3HKZ D;  2R7Z K;  4A3C C;  2NVY K;  3GTK K;  2NVQ K;  2O5I A;  1TWH K;  1I6H K;  2NVT K;  3M4O K; 
#chains in the Genus database with same CATH topology
 1XZQ B;  2PHC B;  1YNN A;  4KMU A;  3RZD K;  4KMH A;  4GTD A;  1O2F B;  1O25 A;  5JVO A;  1IQ0 A;  1K83 A;  4OIR A;  4MEX A;  3G4C A;  2NVX K;  1JQW A;  5EGE A;  5FJ8 K;  1SFO A;  3PO2 K;  5E68 A;  1Y1W K;  1XXB A;  3I4N K;  2CW0 A;  1K83 C;  1J6W A;  4KM9 A;  3S15 C;  2R92 K;  1C0A A;  1VGX A;  1SFO C;  4LR2 A;  3T02 A;  1ZQ1 C;  5CHP A;  3QX3 A;  3S1N C;  4KN4 A;  1I3Q A;  4RMF A;  4Y52 C;  5C4J C;  4A3F C;  5IYD C;  2V6S A;  4YFX A;  4XCH A;  3HOY C;  1I3Q C;  3GTP K;  3L4K A;  4G0U A;  3I4M K;  3CQZ A;  2PMZ L;  2JA8 K;  5TMC A;  3GTL A;  5C4X K;  2XCO A;  4BXX C;  3FKI A;  2GAH C;  3A8K A;  3CQZ C;  1VJE A;  4GTF A;  2CFA A;  2P5M A;  3S2H K;  4GZY A;  5M5X K;  4A3I C;  1BJT A;  3S1Q K;  2JA5 A;  4C2M K;  4XSX A;  3FKI C;  3HOZ C;  2VUM A;  1WIH A;  1IW7 A;  1X31 C;  4BY1 K;  4O2D A;  3V4G A;  4G7H A;  4C3I C;  2JA5 C;  3OEP A;  2WAQ D;  4OIN A;  1IL2 A;  4C3J K;  1L0W A;  3S16 C;  1BGW A;  2VUM C;  4YFN A;  3S0X A;  1XXA A;  4A3B C;  4M1X A;  1KQ4 A;  1VH2 A;  4MQ9 A;  1IS1 A;  4C3H C;  2PA8 L;  5TMF A;  4A3C K;  3M3Y C;  3FOE A;  3GEH A;  4Y7N C;  2ZFZ A;  5C3E K;  1I6V A;  4A3E K;  3GTJ K;  3HOU C;  2P8T A;  3GTM A;  3GTO A;  2JA6 A;  3GTG A;  2A68 A;  3TFH A;  2E2I A;  3H3V L;  3SZY A;  4A3G C;  4KDD A;  2JA6 C;  3FOF A;  3GTO C;  5M3F K;  3GTM C;  1WOP A;  3GTG C;  1SFO K;  2NVY A;  3K7A C;  3NUH A;  2E2I C;  1TWA A;  2ZUF A;  1J6X A;  4BY7 C;  2E2H A;  4X6A C;  4DDQ A;  3DXJ A;  4Y52 K;  5FLM K;  2NVY C;  4KN7 A;  5C4J K;  4A3F K;  4BBR K;  3BUE A;  1TWA C;  5IYD K;  1GE9 A;  1ISE A;  1TWC A;  3HOY K;  2E2H C;  2PA8 D;  2B63 A;  1TWG C;  4KAT A;  1EQR A;  1I3Q K;  4G0W A;  2GSO A;  3ORE A;  3S14 C;  3S2D C;  1J6V A;  4A93 K;  5C44 C;  5JFE A;  1TWC C;  2B63 C;  1F93 A;  4BXX K;  4JK1 A;  3FHZ A;  4LQY A;  5IP7 C;  2KWA A;  3CQZ K;  3GTQ A;  1Y1V A;  2A6E A;  2Y0S D;  1HQM A;  3H3V D;  4A3L C;  3FKI K;  2FQO A;  2EBB A;  3HOZ K;  5IYB C;  1V5V A;  3AQP A;  4KAR A;  2JA7 K;  1XPP A;  1Y1V C;  4C3I K;  1WQG A;  1WOR A;  4AH6 A;  4BLA A;  4A3J C;  3S16 K;  2WAQ L;  2VUM K;  3HXA A;  4YG2 A;  3AD7 C;  3H0G A;  1PJ7 A;  4A3M C;  4A3B K;  3N0B A;  2A69 A;  4G0V A;  4KC6 A;  2R93 K;  1O24 A;  4XLN A;  4ZH4 A;  1EH1 A;  3ADA C;  3H0G C;  1ZVU A;  4GTB A;  3M3Y K;  4Y7N K;  1EFW A;  4FZB A;  4GTE A;  1R9T A;  1WCM A;  4XLP A;  4A3K C;  4J3N A;  2E2J C;  3S1M K;  1F9N A;  3S1R C;  3HOU K;  3WOD A;  3GEE A;  5IOR A;  3LAP A;  4BBS C;  1O27 A;  1ZXO A;  1WCM C;  1R9T C;  3GTK A;  3GTL C;  4BKW A;  4A3G K;  3T00 A;  3GTG K;  4LK0 A;  3K7A K;  4KB4 A;  5M3M K;  5IYC C;  2NVQ C;  1WSR A;  2E2I K;  3HOX K;  4KM8 A;  4GT9 A;  3G4A A;  4AYB D;  3RZD C;  1I50 A;  1Y1W A;  2NVY K;  2O5I A;  1TWA K;  2R92 A;  4FM9 A;  1TWF K;  3PO3 K;  4MEY A;  1AB4 A;  2E2H K;  4XSZ A;  1I50 C;  1TWG K;  4KMD A;  1Y1W C;  2D6F C;  3IPJ A;  3PO2 C;  2CFA B;  4WJ3 M;  3S14 K;  4Q5S A;  2O5J A;  2R92 C;  3S2D K;  2BE5 A;  5C44 K;  4GFQ A;  1TWC K;  3TFJ A;  3GSI A;  2WB1 D;  4ILD A;  4LK1 A;  5IP7 K;  2NVT C;  3LAJ A;  3M4O C;  3GTP A;  3HOV C;  3OPF A;  5IOS A;  3HOW C;  4P5B A;  1K83 K;  5IYB K;  2Y0S L;  3S15 K;  1WOO A;  4QJV A;  5L46 A;  2YU9 A;  1Y1V K;  3GTP C;  3AH5 A;  5D4D A;  3I4M C;  1O28 A;  1WQH A;  3S17 C;  4A3J K;  1PJ6 A;  3S1N K;  3RZO C;  2JA8 C;  4PAA A;  5C4X C;  2YU9 C;  4A3M K;  1YNJ A;  4KMA A;  5EGH A;  1DCH A;  3S2H C;  1XZQ A;  3A8I A;  4YFK A;  3EQL A;  4C45 A;  4A3K K;  3S1R K;  4NOI A;  2JH3 A;  3L4J A;  1F7V A;  1USM A;  1WCM K;  1DD5 A;  1EK8 A;  4A3I K;  3GTL K;  1O29 A;  5HL8 A;  4OIQ A;  4PAB A;  2Y3P A;  3GTQ C;  5IOT A;  5IYC K;  3GTJ A;  3AD8 C;  2JA5 K;  4LLG A;  1JOE A;  1O26 A;  1DCP A;  5C3E C;  1HI9 A;  2RH6 A;  3ERE D;  4QIW D;  4AYB L;  2A6H A;  4A3E C;  2PPB A;  3GTJ C;  1RU0 A;  1I50 K;  3T01 A;  4A3D C;  4C3H K;  3TFI A;  1UV7 A;  4GTL A;  5IP9 C;  3HKZ D;  1J98 A;  2NVT K;  3M4O K;  2XCQ A;  1XXC A;  2WB1 L;  4OIO A;  3HOV K;  2R7Z A;  5FLM C;  3AQO A;  3A8J A;  4BBR C;  1TWH A;  3HOW K;  3AD9 C;  1G51 A;  5M5W K;  3GTM K;  2JA6 K;  3GTO K;  2R7Z C;  1WQF A;  3GTK C;  3S17 K;  1YCL A;  1ZYR A;  1TWH C;  1I6H C;  4A93 C;  2ZUE A;  2NVX A;  3RZO K;  1WSV A;  4BY7 K;  2YU9 K;  4WIL A;  4X6A K;  3CAG A;  2XCR B;  4G7Z A;  2JA7 A;  1XZP A;  4KB2 A;  4P9S A;  2NVX C;  1F7U A;  3JST A;  2GSU A;  4OIP A;  1VLO A;  1B4A A;  3I4N C;  1IBA A;  3SZZ A;  5IOQ A;  4WJ4 A;  2JA7 C;  4G7O A;  1B4B A;  2GSN A;  2B63 K;  4BLB A;  5M5Y K;  4KAW X;  3GDZ A;  2R93 A;  1O2A A;  3N3Y A;  4P5A A;  1ZBS A;  1WOS A;  1O2B A;  4A3L K;  2GAG C;  2W7V A;  4KAS A;  4LOW A;  2R93 C;  4LJZ A;  1EI6 A;  2V6U A;  3GTQ K;  1BDF A;  1XZP B;  1PJ5 A;  1SMY A;  2PMZ D;  5TJ3 A;  1JVI A;  1VRQ C;  3BP8 C;  4GTA A;  3VA7 A;  3S1M C;  4QIW L;  1YX2 A;  3GIR A;  3MML B;  2V6T A;  3S1Q C;  3BP3 A;  4A3D K;  1INN A;  3H0G K;  4C2M C;  4Q4Z A;  5IP9 K;  4BY1 C;  3Q3Q A;  2E2J K;  1DCO A;  3HOX C;  4QJV B;  1TWF A;  3HKZ L;  4C3J C;  1IE0 A;  1BS2 A;  2RGR A;  4BBS K;  1TWG A;  3LPX A;  3GEI A;  1R9T K;  3TTG A;  1TWF C;  3PO3 C;  4GTC A;  2FQT A;  1USO A;  2R7Z K;  4A3C C;  3GTK K;  3N0C A;  2NVQ K;  1TWH K;  5CJ9 A;  1I6H K; 
#chains in the Genus database with same CATH homology
 4A3G C;  1TWF K;  3PO3 K;  4MEY A;  2JA6 C;  3GTO C;  2WB1 L;  5M3F K;  4XSZ A;  2E2H K;  3GTM C;  1YNN A;  1I50 C;  1TWG K;  4KMU A;  3RZD K;  4OIO A;  1Y1W C;  1SFO K;  5FLM C;  3GTG C;  3HOV K;  3K7A C;  4BBR C;  4OIR A;  2E2I C;  3S14 K;  3HOW K;  4MEX A;  5IYD K;  4Q5S A;  2O5J A;  2NVX K;  2R92 C;  5M5W K;  2BE5 A;  5C44 K;  3S2D K;  5FJ8 K;  3H3V L;  4BY7 C;  1TWC K;  2JA6 K;  3GTO K;  3GTM K;  4X6A C;  3DXJ A;  3PO2 K;  1TWA K;  1Y1W K;  2R7Z C;  4Y52 K;  5FLM K;  2NVY C;  4KN7 A;  5C4J K;  4A3F K;  2CW0 A;  3GTK C;  1K83 C;  1ZYR A;  2WB1 D;  1TWA C;  1TWH C;  4LK1 A;  4BBR K;  5IP7 K;  2NVT C;  3M4O C;  4A93 C;  1I6H C;  3S15 C;  2R92 K;  3RZO K;  3HOY K;  2E2H C;  2PA8 D;  4BY7 K;  1TWG C;  2YU9 K;  1SFO C;  3HOV C;  4X6A K;  1I3Q K;  4G7Z A;  3S14 C;  3HOW C;  1K83 K;  5IYB K;  2Y0S L;  3S1N C;  2NVX C;  3S2D C;  4A93 K;  5C44 C;  3S15 K;  4QJV A;  1TWC C;  4KN4 A;  2B63 C;  4OIP A;  1Y1V K;  3GTP C;  4BXX K;  4Y52 C;  5C4J C;  5D4D A;  4A3F C;  3I4M C;  3S17 C;  3I4N C;  4JK1 A;  5IP7 C;  5IYD C;  4A3J K;  3CQZ K;  2JA7 C;  4G7O A;  4YFX A;  3S1N K;  3RZO C;  2JA8 C;  3HOY C;  5C4X C;  2B63 K;  2YU9 C;  2A6E A;  1I3Q C;  1HQM A;  2Y0S D;  4A3M K;  1YNJ A;  3GTP K;  3H3V D;  4A3L C;  3FKI K;  5M5Y K;  3I4M K;  3HOZ K;  5IYB C;  3S2H C;  2JA7 K;  2PMZ L;  1XPP A;  2JA8 K;  5TMC A;  5C4X K;  1Y1V C;  4C3I K;  4BXX C;  4A3L K;  4YFK A;  4A3J C;  3CQZ C;  3S16 K;  4LJZ A;  2WAQ L;  2R93 C;  3EQL A;  2VUM K;  3S2H K;  4GZY A;  3GTQ K;  1BDF A;  4YG2 A;  4A3K K;  5M5X K;  4A3I C;  3S1Q K;  4A3M C;  4A3B K;  4C2M K;  1SMY A;  3S1R K;  2A69 A;  3FKI C;  4XSX A;  2PMZ D;  4NOI A;  3HOZ C;  2R93 K;  1IW7 A;  1WCM K;  4XLN A;  4BY1 K;  4ZH4 A;  3S1M C;  3H0G C;  4A3I K;  4G7H A;  3M3Y K;  2JA5 C;  3GTL K;  2WAQ D;  4OIN A;  4OIQ A;  4QIW L;  4Y7N K;  4C3J K;  3S16 C;  2VUM C;  4YFN A;  4XLP A;  3GTQ C;  4A3K C;  2E2J C;  3S1Q C;  4A3D K;  5IYC K;  3H0G K;  3PO2 C;  3S1M K;  4A3B C;  2JA5 K;  4LLG A;  4Q4Z A;  3WOD A;  5C3E C;  3S1R C;  3HOU K;  4BBS C;  4MQ9 A;  1R9T C;  1WCM C;  4QIW D;  5IP9 K;  4BY1 C;  4AYB L;  2PA8 L;  5TMF A;  2A6H A;  2E2J K;  4A3E C;  3M3Y C;  3HOX C;  2PPB A;  3GTL C;  3GTJ C;  4QJV B;  4A3C K;  3HKZ L;  4Y7N C;  4A3G K;  5C3E K;  1I6V A;  4BBS K;  1I50 K;  3GTG K;  4LK0 A;  3I4N K;  1R9T K;  3K7A K;  5M3M K;  2NVQ C;  4C3H K;  5IYC C;  4A3D C;  2E2I K;  4A3E K;  3HOX K;  3GTJ K;  1TWF C;  3HOU C;  3PO3 C;  4AYB D;  3RZD C;  3S17 K;  2A68 A;  5IP9 C;  3HKZ D;  2R7Z K;  4A3C C;  2NVY K;  3GTK K;  2NVQ K;  2O5I A;  1TWH K;  1I6H K;  2NVT K;  3M4O K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...