3GTGK

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtgK00
3EQLA 2BE5A 4OIPA 4BXXK 3RZDC 3I4NK 4Y52C 4A93K 1HQMA 3GTMK 4YG2A 5TMCA 5M5YK 2O5IA 3GTGK 5IP9C 2R92C 1WCMK 4LK0A 4XSXA 1TWGK 4A3BC 5IP7C 5FLMK 4OIQA 4A3FK 5IYBK 3HKZD 1SFOK 3HOYC 4JK1A 1I3QK 2WAQL 3CQZK 3S16C 4A3GK 4A3CK 3S1QK 4X6AK 2E2IK 5C44K 4A3MK 4BY1C 2B63K 3I4MK 1TWFK 2CW0A 3GTLK 3S1MK 2JA5C 2NVXC 4C3IK 2Y0SD 3M4OC 1TWHC 1TWCC 2PA8L 4LJZA 5IYCK 5FJ8K 1I6HK 4G7OA 3GTKK 1XPPA 3DXJA 5M5XK 3HOZC 4MEYA 5C4XC 1K83K 4LLGA 4OIOA 5M3MK 5IYDK 3H3VD 2R7ZC 3PO3C 3HOXK 3HKZL 4A3EC 3GTQC 5D4DA 2R93C 3M3YC 4LK1A 4BBRK 4YFKA 5C4JC 2JA6K 2E2JK 2JA7C 3S15K 2NVTK 4X6AC 3FKIK 4A3DC 4A3LK 4G7ZA 2Y0SL 5C3EC 4G7HA 2WB1D 4ZH4A 4AYBD 3GTJK 4A93C 2A6HA 3GTGC 1WCMC 1TWGC 5M5WK 4A3KK 1R9TC 2YU9K 3RZDK 5FLMC 2PMZD 3GTOK 3PO2K 4BY7K 4NOIA 5IYBC 2NVQK 3RZOK 4QJVB 1I3QC 5IP9K 2A68A 4A3IK 3S2HK 4A3GC 3S1RK 4MQ9A 4A3BK 4Y7NK 5C44C 4A3MC 3H3VL 5IP7K 3S1QC 2B63C 1I6VA 3GTLC 3HOVK 3I4MC 3H0GK 3S14K 3S1MC 3HOYK 4QIWD 2JA8K 3K7AK 1I6HC 5IYCC 4A3JC 1TWAC 2NVYK 2WB1L 3GTPK 3HOUK 1I50K 4KN7A 2E2HC 1K83C 4BBSC 1Y1WK 1Y1VC 3S2DK 3S1NK 4KN4A 5IYDC 5TMFA 2PMZL 2VUMK 3S2DC 4BXXC 3HOXC 1ZYRA 3HOZK 3I4NC 5C4XK 4OINA 3GTMC 3HOWK 2WAQD 4BBRC 3S15C 2E2JC 3S17K 3WODA 4A3LC 4XSZA 4Y52K 4A3FC 4QJVA 1SMYA 1SFOC 4QIWL 1BDFA 3GTJC 3CQZC 5C4JK 2R92K 1IW7A 4A3CC 2E2IC 2PPBA 4OIRA 1TWFC 4A3KC 2YU9C 5M3FK 3PO2C 4C2MK 5C3EK 1YNNA 4C3HK 3GTOC 4BY7C 3S16K 4C3JK 2NVQC 4MEXA 3RZOC 4A3IC 3S2HC 2O5JA 4BY1K 3S1RC 4Q5SA 4Y7NC 1R9TK 3GTKC 2JA5K 2NVXK 4YFXA 3HOVC 4AYBL 3H0GC 3S14C 4XLNA 3M4OK 1TWHK 1TWCK 2A69A 2JA8C 3K7AC 2NVYC 3GTPC 3HOUC 1I50C 4Q4ZA 4KMUA 2JA6C 1Y1WC 2NVTC 4A3JK 1TWAK 3FKIC 4YFNA 2R7ZK 2VUMC 3PO3K 4A3EK 3GTQK 3S1NC 2A6EA 4XLPA 4GZYA 2R93K 3M3YK 2E2HK 4BBSK 2JA7K 3HOWC 1Y1VK 2PA8D 1YNJA 4A3DK 3S17C
chains in the Genus database with same CATH superfamily
3FHZA 4Y52C 3I4NK 4A93K 3T01A 2O5IA 5IP9C 4BLBA 4A3BC 4LR2A 4OIQA 5IYBK 3HKZD 3SZYA 1I3QK 2WAQL 3T02A 4A3GK 2P5MA 4A3CK 4X6AK 1BJTA 3I4MK 1JVIA 2KWAA 2Y3PA 4FM9A 2ZFZA 4GTLA 1UV7A 1I6HK 5FJ8K 4G0UA 3GTKK 2ZUEA 3DXJA 1I3QA 1BS2A 3L4KA 3A8KA 5M3MK 3H3VD 1B4BA 3AD8C 3HOXK 2R93C 3GEEA 4LK1A 3S15K 4YFKA 2JA7C 1VGXA 4GTBA 3GTKA 2NVTK 1JQWA 4A3LK 4GTFA 1EQRA 1B4AA 2CFAB 1WCMC 5FLMC 1WOOA 2NVQK 1Y1WA 4QJVB 5IP9K 1WSVA 4A3BK 5L46A 2B63C 3GTLC 3S14K 3S1MC 4QIWD 3K7AK 5IYCC 1INNA 4KAWX 2NVYK 2WB1L 4O2DA 4KN7A 3ERED 2E2HC 1K83C 4BBSC 3GIRA 1Y1VC 1ZQ1C 3S2DK 3S1NK 1ZYRA 3GTMC 1WQHA 1O26A 4RMFA 3GTJC 4AH6A 4A3KC 3AH5A 4BY7C 4C3HK 4C3IC 4KM9A 1PJ6A 1XZPB 3GTOC 2O5JA 4Y7NC 2R93A 3TFJA 1XXBA 3FOEA 3HOVC 3M4OK 1TWHK 1WORA 3GTPC 1WCMA 3HOUC 4XCHA 1ISEA 3PO3K 4YFNA 1V5VA 2A6EA 4XLPA 3L4JA 1TWHA 3M3YK 1WSRA 2E2HK 4BBSK 2RGRA 3HOWC 1Y1VK 3GTLA 2PA8D 1YNJA 2GSUA 3S17C 1AB4A 2BE5A 1XZQA 4GTDA 1O25A 5IORA 3GTMK 5TMCA 3GTGK 2R92C 3IPJA 1EK8A 5IP7C 2EBBA 2E2HA 1K83A 5IOQA 1Y1VA 4JK1A 4KASA 3S16C 4KDDA 3S1QK 4A3MK 4BY1C 3GTMA 2NVXC 3GTGA 4C3IK 2Y0SD 2W7VA 1RU0A 4LJZA 4GTAA 3GTJA 2D6FC 4MEYA 4P9SA 3GTOA 1J6WA 1O2FB 1XZPA 1WIHA 3HKZL 4A3EC 5D4DA 4BBRK 5C4JC 1ZVUA 4A3DC 5JVOA 1X31C 4G7ZA 5C3EC 4G7HA 4ZH4A 4AYBD 1BGWA 1DCHA 1TWGC 3GTPA 3OEPA 1F7VA 1VH2A 3RZOK 4KM8A 4A3IK 2A68A 3S2HK 3S1RK 3H3VL 5C44C 5IP7K 3TTGA 5JFEA 1IQ0A 1O24A 4A3JC 1F7UA 3N0BA 1Y1WK 1GE9A 4KN4A 5IYDC 4PAAA 5TMFA 4BXXC 4KMDA 1VLOA 4OINA 2XCOA 2WAQD 2E2JC 1VJEA 1USMA 4Y52K 1SFOC 4QIWL 3CQZC 5C4JK 2V6UA 2E2IC 2PPBA 1XXAA 2YU9C 3PO2C 5M3FK 5C3EK 1XZQB 4Q5SA 3N0CA 1IE0A 4YFXA 3H0GC 4XLNA 1O27A 3BP8C 4GFQA 2JA8C 5HL8A 1DCOA 1I50C 2V6TA 3FKIC 4A3JK 2VUMC 4GZYA 2R93K 1L0WA 3LAPA 2JA7K 3GEHA 1WOPA 3Q3QA 3EQLA 4OIPA 3NUHA 4BXXK 1HQMA 1JOEA 4YG2A 5M5YK 3A8IA 1WCMK 4XSXA 1O2AA 5FLMK 2JA7A 4C2MC 1SFOK 1YX2A 3CQZK 4C3JC 2E2IK 2B63K 2CW0A 2GAHC 3GTLK 3S1MK 2JA5C 3GSIA 1DCPA 1PJ5A 2RH6A 2PA8L 1TWCC 3ADAC 5IYCK 1SFOA 1WOSA 3OPFA 3CQZA 5M5XK 5IOSA 1DD5A 4GTEA 4M1XA 2E2IA 1K83K 3GDZA 5C4XC 2B63A 2YU9A 2R7ZC 3GTQC 3SZZA 3LPXA 1WQFA 2V6SA 3FKIK 2Y0SL 3GTJK 4KMHA 4A93C 2A6HA 5CJ9A 4KB4A 4A3KK 5M5WK 2PMZD 1I50A 3GTOK 4BY7K 5IYBC 1G51A 1I3QC 3FKIA 3BUEA 4A3GC 4X6AC 4Y7NK 2XCQA 3I4MC 5E68A 3HOVK 3HXAA 1I6HC 1TWAC 3GTPK 3HOUK 1EI6A 3G4AA 4ILDA 3QX3A 3HOXC 1XXCA 5C4XK 5IOTA 3HOWK 3S15C 4WJ4A 3CAGA 3S17K 3AD9C 4GTCA 3WODA 4A3LC 4XSZA 4A3FC 1TWCA 1BDFA 2R92K 4WJ3M 3G4CA 1EFWA 1TWFC 4OIRA 1YNNA 2PHCB 3S16K 2NVQC 4MEXA 2FQTA 2R7ZA 4BY1K 3GTQA 1HI9A 2NVXK 3S14C 2R92A 1USOA 2GSOA 3K7AC 2FQOA 2NVYC 3MMLB 4FZBA 4KMUA 2JA6C 2NVXA 3JSTA 1ZBSA 4LOWA 3S2DC 1TWAK 3S1NC 4A3EK 4GT9A 1F9NA 3GEIA 1YCLA 4A3DK 3RZDC 2P8TA 1TWAA 4LK0A 1TWGK 4G0VA 1KQ4A 4A3FK 3HOYC 4C3HC 5C44K 1TWFK 1F93A 3A8JA 1J98A 1TWGA 3M4OC 1TWHC 4G7OA 2XCRB 1XPPA 3HOZC 4P5BA 4LLGA 4OIOA 1TWFA 5IYDK 3PO3C 5EGHA 3M3YC 1O29A 2JA6K 2E2JK 4P5AA 3AD7C 1IS1A 3FOFA 2WB1D 1O28A 1O2BA 3GTGC 3VA7A 4DDQA 1J6XA 2JH3A 2NVYA 2YU9K 1R9TC 3PO2K 3RZDK 3AQPA 4NOIA 2JA6A 2ZUFA 3S1QC 4MQ9A 4C45A 4A3MC 1I6VA 3H0GK 3HOYK 1EH1A 4KATA 5CHPA 5TJ3A 2JA8K 3TFHA 4J3NA 1I50K 4BKWA 1IL2A 1ZXOA 4PABA 1PJ7A 3H0GA 3BP3A 2VUMK 4BLAA 2PMZL 3LAJA 3HOZK 3I4NC 2CFAA 4G0WA 4BBRC 3V4GA 4KB2A 4QJVA 1SMYA 4WILA 4KC6A 2VUMA 1IW7A 4A3CC 4LQYA 2GAGC 1J6VA 1C0AA 3S0XA 4C2MK 3TFIA 5EGEA 3T00A 4C3JK 3RZOC 4A3IC 3S2HC 3S1RC 1R9TK 3GTKC 2JA5K 4AYBL 4KARA 1TWCK 2A69A 2GSNA 3AQOA 1IBAA 4KMAA 4Q4ZA 1R9TA 2JA5A 1WQGA 1Y1WC 2NVTC 2R7ZK 3GTQK 3N3YA 3OREA 1VRQC
chains in the Genus database with same CATH topology
3EQLA 2BE5A 4OIPA 4BXXK 3RZDC 3I4NK 4Y52C 4A93K 1HQMA 3GTMK 4YG2A 5TMCA 5M5YK 2O5IA 3GTGK 5IP9C 2R92C 1WCMK 4LK0A 4XSXA 1TWGK 4A3BC 5IP7C 5FLMK 4OIQA 4A3FK 5IYBK 3HKZD 1SFOK 3HOYC 4JK1A 1I3QK 2WAQL 3CQZK 3S16C 4A3GK 4A3CK 3S1QK 4X6AK 2E2IK 5C44K 4A3MK 4BY1C 2B63K 3I4MK 1TWFK 2CW0A 3GTLK 3S1MK 2JA5C 2NVXC 4C3IK 2Y0SD 3M4OC 1TWHC 1TWCC 2PA8L 4LJZA 5IYCK 5FJ8K 1I6HK 4G7OA 3GTKK 1XPPA 3DXJA 5M5XK 3HOZC 4MEYA 5C4XC 1K83K 4LLGA 4OIOA 5M3MK 5IYDK 3H3VD 2R7ZC 3PO3C 3HOXK 3HKZL 4A3EC 3GTQC 5D4DA 2R93C 3M3YC 4LK1A 4BBRK 4YFKA 5C4JC 2JA6K 2E2JK 2JA7C 3S15K 2NVTK 4X6AC 3FKIK 4A3DC 4A3LK 4G7ZA 2Y0SL 5C3EC 4G7HA 2WB1D 4ZH4A 4AYBD 3GTJK 4A93C 2A6HA 3GTGC 1WCMC 1TWGC 5M5WK 4A3KK 1R9TC 2YU9K 3RZDK 5FLMC 2PMZD 3GTOK 3PO2K 4BY7K 4NOIA 5IYBC 2NVQK 3RZOK 4QJVB 1I3QC 5IP9K 2A68A 4A3IK 3S2HK 4A3GC 3S1RK 4MQ9A 4A3BK 4Y7NK 5C44C 4A3MC 3H3VL 5IP7K 3S1QC 2B63C 1I6VA 3GTLC 3HOVK 3I4MC 3H0GK 3S14K 3S1MC 3HOYK 4QIWD 2JA8K 3K7AK 1I6HC 5IYCC 4A3JC 1TWAC 2NVYK 2WB1L 3GTPK 3HOUK 1I50K 4KN7A 2E2HC 1K83C 4BBSC 1Y1WK 1Y1VC 3S2DK 3S1NK 4KN4A 5IYDC 5TMFA 2PMZL 2VUMK 3S2DC 4BXXC 3HOXC 1ZYRA 3HOZK 3I4NC 5C4XK 4OINA 3GTMC 3HOWK 2WAQD 4BBRC 3S15C 2E2JC 3S17K 3WODA 4A3LC 4XSZA 4Y52K 4A3FC 4QJVA 1SMYA 1SFOC 4QIWL 1BDFA 3GTJC 3CQZC 5C4JK 2R92K 1IW7A 4A3CC 2E2IC 2PPBA 4OIRA 1TWFC 4A3KC 2YU9C 5M3FK 3PO2C 4C2MK 5C3EK 1YNNA 4C3HK 3GTOC 4BY7C 3S16K 4C3JK 2NVQC 4MEXA 3RZOC 4A3IC 3S2HC 2O5JA 4BY1K 3S1RC 4Q5SA 4Y7NC 1R9TK 3GTKC 2JA5K 2NVXK 4YFXA 3HOVC 4AYBL 3H0GC 3S14C 4XLNA 3M4OK 1TWHK 1TWCK 2A69A 2JA8C 3K7AC 2NVYC 3GTPC 3HOUC 1I50C 4Q4ZA 4KMUA 2JA6C 1Y1WC 2NVTC 4A3JK 1TWAK 3FKIC 4YFNA 2R7ZK 2VUMC 3PO3K 4A3EK 3GTQK 3S1NC 2A6EA 4XLPA 4GZYA 2R93K 3M3YK 2E2HK 4BBSK 2JA7K 3HOWC 1Y1VK 2PA8D 1YNJA 4A3DK 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQL A;  2BE5 A;  4OIP A;  4BXX K;  3RZD C;  3I4N K;  4Y52 C;  4A93 K;  1HQM A;  3GTM K;  4YG2 A;  5TMC A;  5M5Y K;  2O5I A;  3GTG K;  5IP9 C;  2R92 C;  1WCM K;  4LK0 A;  4XSX A;  1TWG K;  4A3B C;  5IP7 C;  5FLM K;  4OIQ A;  4A3F K;  5IYB K;  3HKZ D;  1SFO K;  3HOY C;  4JK1 A;  1I3Q K;  2WAQ L;  3CQZ K;  3S16 C;  4A3G K;  4A3C K;  3S1Q K;  4X6A K;  2E2I K;  5C44 K;  4A3M K;  4BY1 C;  2B63 K;  3I4M K;  1TWF K;  2CW0 A;  3GTL K;  3S1M K;  2JA5 C;  2NVX C;  4C3I K;  2Y0S D;  3M4O C;  1TWH C;  1TWC C;  2PA8 L;  4LJZ A;  5IYC K;  5FJ8 K;  1I6H K;  4G7O A;  3GTK K;  1XPP A;  3DXJ A;  5M5X K;  3HOZ C;  4MEY A;  5C4X C;  1K83 K;  4LLG A;  4OIO A;  5M3M K;  5IYD K;  3H3V D;  2R7Z C;  3PO3 C;  3HOX K;  3HKZ L;  4A3E C;  3GTQ C;  5D4D A;  2R93 C;  3M3Y C;  4LK1 A;  4BBR K;  4YFK A;  5C4J C;  2JA6 K;  2E2J K;  2JA7 C;  3S15 K;  2NVT K;  4X6A C;  3FKI K;  4A3D C;  4A3L K;  4G7Z A;  2Y0S L;  5C3E C;  4G7H A;  2WB1 D;  4ZH4 A;  4AYB D;  3GTJ K;  4A93 C;  2A6H A;  3GTG C;  1WCM C;  1TWG C;  5M5W K;  4A3K K;  1R9T C;  2YU9 K;  3RZD K;  5FLM C;  2PMZ D;  3GTO K;  3PO2 K;  4BY7 K;  4NOI A;  5IYB C;  2NVQ K;  3RZO K;  4QJV B;  1I3Q C;  5IP9 K;  2A68 A;  4A3I K;  3S2H K;  4A3G C;  3S1R K;  4MQ9 A;  4A3B K;  4Y7N K;  5C44 C;  4A3M C;  3H3V L;  5IP7 K;  3S1Q C;  2B63 C;  1I6V A;  3GTL C;  3HOV K;  3I4M C;  3H0G K;  3S14 K;  3S1M C;  3HOY K;  4QIW D;  2JA8 K;  3K7A K;  1I6H C;  5IYC C;  4A3J C;  1TWA C;  2NVY K;  2WB1 L;  3GTP K;  3HOU K;  1I50 K;  4KN7 A;  2E2H C;  1K83 C;  4BBS C;  1Y1W K;  1Y1V C;  3S2D K;  3S1N K;  4KN4 A;  5IYD C;  5TMF A;  2PMZ L;  2VUM K;  3S2D C;  4BXX C;  3HOX C;  1ZYR A;  3HOZ K;  3I4N C;  5C4X K;  4OIN A;  3GTM C;  3HOW K;  2WAQ D;  4BBR C;  3S15 C;  2E2J C;  3S17 K;  3WOD A;  4A3L C;  4XSZ A;  4Y52 K;  4A3F C;  4QJV A;  1SMY A;  1SFO C;  4QIW L;  1BDF A;  3GTJ C;  3CQZ C;  5C4J K;  2R92 K;  1IW7 A;  4A3C C;  2E2I C;  2PPB A;  4OIR A;  1TWF C;  4A3K C;  2YU9 C;  5M3F K;  3PO2 C;  4C2M K;  5C3E K;  1YNN A;  4C3H K;  3GTO C;  4BY7 C;  3S16 K;  4C3J K;  2NVQ C;  4MEX A;  3RZO C;  4A3I C;  3S2H C;  2O5J A;  4BY1 K;  3S1R C;  4Q5S A;  4Y7N C;  1R9T K;  3GTK C;  2JA5 K;  2NVX K;  4YFX A;  3HOV C;  4AYB L;  3H0G C;  3S14 C;  4XLN A;  3M4O K;  1TWH K;  1TWC K;  2A69 A;  2JA8 C;  3K7A C;  2NVY C;  3GTP C;  3HOU C;  1I50 C;  4Q4Z A;  4KMU A;  2JA6 C;  1Y1W C;  2NVT C;  4A3J K;  1TWA K;  3FKI C;  4YFN A;  2R7Z K;  2VUM C;  3PO3 K;  4A3E K;  3GTQ K;  3S1N C;  2A6E A;  4XLP A;  4GZY A;  2R93 K;  3M3Y K;  2E2H K;  4BBS K;  2JA7 K;  3HOW C;  1Y1V K;  2PA8 D;  1YNJ A;  4A3D K;  3S17 C; 
#chains in the Genus database with same CATH topology
 3FHZ A;  4Y52 C;  3I4N K;  4A93 K;  3T01 A;  2O5I A;  5IP9 C;  4BLB A;  4A3B C;  4LR2 A;  4OIQ A;  5IYB K;  3HKZ D;  3SZY A;  1I3Q K;  2WAQ L;  3T02 A;  4A3G K;  2P5M A;  4A3C K;  4X6A K;  1BJT A;  3I4M K;  1JVI A;  2KWA A;  2Y3P A;  4FM9 A;  2ZFZ A;  4GTL A;  1UV7 A;  1I6H K;  5FJ8 K;  4G0U A;  3GTK K;  2ZUE A;  3DXJ A;  1I3Q A;  1BS2 A;  3L4K A;  3A8K A;  5M3M K;  3H3V D;  1B4B A;  3AD8 C;  3HOX K;  2R93 C;  3GEE A;  4LK1 A;  3S15 K;  4YFK A;  2JA7 C;  1VGX A;  4GTB A;  3GTK A;  2NVT K;  1JQW A;  4A3L K;  4GTF A;  1EQR A;  1B4A A;  2CFA B;  1WCM C;  5FLM C;  1WOO A;  2NVQ K;  1Y1W A;  4QJV B;  5IP9 K;  1WSV A;  4A3B K;  5L46 A;  2B63 C;  3GTL C;  3S14 K;  3S1M C;  4QIW D;  3K7A K;  5IYC C;  1INN A;  4KAW X;  2NVY K;  2WB1 L;  4O2D A;  4KN7 A;  3ERE D;  2E2H C;  1K83 C;  4BBS C;  3GIR A;  1Y1V C;  1ZQ1 C;  3S2D K;  3S1N K;  1ZYR A;  3GTM C;  1WQH A;  1O26 A;  4RMF A;  3GTJ C;  4AH6 A;  4A3K C;  3AH5 A;  4BY7 C;  4C3H K;  4C3I C;  4KM9 A;  1PJ6 A;  1XZP B;  3GTO C;  2O5J A;  4Y7N C;  2R93 A;  3TFJ A;  1XXB A;  3FOE A;  3HOV C;  3M4O K;  1TWH K;  1WOR A;  3GTP C;  1WCM A;  3HOU C;  4XCH A;  1ISE A;  3PO3 K;  4YFN A;  1V5V A;  2A6E A;  4XLP A;  3L4J A;  1TWH A;  3M3Y K;  1WSR A;  2E2H K;  4BBS K;  2RGR A;  3HOW C;  1Y1V K;  3GTL A;  2PA8 D;  1YNJ A;  2GSU A;  3S17 C;  1AB4 A;  2BE5 A;  1XZQ A;  4GTD A;  1O25 A;  5IOR A;  3GTM K;  5TMC A;  3GTG K;  2R92 C;  3IPJ A;  1EK8 A;  5IP7 C;  2EBB A;  2E2H A;  1K83 A;  5IOQ A;  1Y1V A;  4JK1 A;  4KAS A;  3S16 C;  4KDD A;  3S1Q K;  4A3M K;  4BY1 C;  3GTM A;  2NVX C;  3GTG A;  4C3I K;  2Y0S D;  2W7V A;  1RU0 A;  4LJZ A;  4GTA A;  3GTJ A;  2D6F C;  4MEY A;  4P9S A;  3GTO A;  1J6W A;  1O2F B;  1XZP A;  1WIH A;  3HKZ L;  4A3E C;  5D4D A;  4BBR K;  5C4J C;  1ZVU A;  4A3D C;  5JVO A;  1X31 C;  4G7Z A;  5C3E C;  4G7H A;  4ZH4 A;  4AYB D;  1BGW A;  1DCH A;  1TWG C;  3GTP A;  3OEP A;  1F7V A;  1VH2 A;  3RZO K;  4KM8 A;  4A3I K;  2A68 A;  3S2H K;  3S1R K;  3H3V L;  5C44 C;  5IP7 K;  3TTG A;  5JFE A;  1IQ0 A;  1O24 A;  4A3J C;  1F7U A;  3N0B A;  1Y1W K;  1GE9 A;  4KN4 A;  5IYD C;  4PAA A;  5TMF A;  4BXX C;  4KMD A;  1VLO A;  4OIN A;  2XCO A;  2WAQ D;  2E2J C;  1VJE A;  1USM A;  4Y52 K;  1SFO C;  4QIW L;  3CQZ C;  5C4J K;  2V6U A;  2E2I C;  2PPB A;  1XXA A;  2YU9 C;  3PO2 C;  5M3F K;  5C3E K;  1XZQ B;  4Q5S A;  3N0C A;  1IE0 A;  4YFX A;  3H0G C;  4XLN A;  1O27 A;  3BP8 C;  4GFQ A;  2JA8 C;  5HL8 A;  1DCO A;  1I50 C;  2V6T A;  3FKI C;  4A3J K;  2VUM C;  4GZY A;  2R93 K;  1L0W A;  3LAP A;  2JA7 K;  3GEH A;  1WOP A;  3Q3Q A;  3EQL A;  4OIP A;  3NUH A;  4BXX K;  1HQM A;  1JOE A;  4YG2 A;  5M5Y K;  3A8I A;  1WCM K;  4XSX A;  1O2A A;  5FLM K;  2JA7 A;  4C2M C;  1SFO K;  1YX2 A;  3CQZ K;  4C3J C;  2E2I K;  2B63 K;  2CW0 A;  2GAH C;  3GTL K;  3S1M K;  2JA5 C;  3GSI A;  1DCP A;  1PJ5 A;  2RH6 A;  2PA8 L;  1TWC C;  3ADA C;  5IYC K;  1SFO A;  1WOS A;  3OPF A;  3CQZ A;  5M5X K;  5IOS A;  1DD5 A;  4GTE A;  4M1X A;  2E2I A;  1K83 K;  3GDZ A;  5C4X C;  2B63 A;  2YU9 A;  2R7Z C;  3GTQ C;  3SZZ A;  3LPX A;  1WQF A;  2V6S A;  3FKI K;  2Y0S L;  3GTJ K;  4KMH A;  4A93 C;  2A6H A;  5CJ9 A;  4KB4 A;  4A3K K;  5M5W K;  2PMZ D;  1I50 A;  3GTO K;  4BY7 K;  5IYB C;  1G51 A;  1I3Q C;  3FKI A;  3BUE A;  4A3G C;  4X6A C;  4Y7N K;  2XCQ A;  3I4M C;  5E68 A;  3HOV K;  3HXA A;  1I6H C;  1TWA C;  3GTP K;  3HOU K;  1EI6 A;  3G4A A;  4ILD A;  3QX3 A;  3HOX C;  1XXC A;  5C4X K;  5IOT A;  3HOW K;  3S15 C;  4WJ4 A;  3CAG A;  3S17 K;  3AD9 C;  4GTC A;  3WOD A;  4A3L C;  4XSZ A;  4A3F C;  1TWC A;  1BDF A;  2R92 K;  4WJ3 M;  3G4C A;  1EFW A;  1TWF C;  4OIR A;  1YNN A;  2PHC B;  3S16 K;  2NVQ C;  4MEX A;  2FQT A;  2R7Z A;  4BY1 K;  3GTQ A;  1HI9 A;  2NVX K;  3S14 C;  2R92 A;  1USO A;  2GSO A;  3K7A C;  2FQO A;  2NVY C;  3MML B;  4FZB A;  4KMU A;  2JA6 C;  2NVX A;  3JST A;  1ZBS A;  4LOW A;  3S2D C;  1TWA K;  3S1N C;  4A3E K;  4GT9 A;  1F9N A;  3GEI A;  1YCL A;  4A3D K;  3RZD C;  2P8T A;  1TWA A;  4LK0 A;  1TWG K;  4G0V A;  1KQ4 A;  4A3F K;  3HOY C;  4C3H C;  5C44 K;  1TWF K;  1F93 A;  3A8J A;  1J98 A;  1TWG A;  3M4O C;  1TWH C;  4G7O A;  2XCR B;  1XPP A;  3HOZ C;  4P5B A;  4LLG A;  4OIO A;  1TWF A;  5IYD K;  3PO3 C;  5EGH A;  3M3Y C;  1O29 A;  2JA6 K;  2E2J K;  4P5A A;  3AD7 C;  1IS1 A;  3FOF A;  2WB1 D;  1O28 A;  1O2B A;  3GTG C;  3VA7 A;  4DDQ A;  1J6X A;  2JH3 A;  2NVY A;  2YU9 K;  1R9T C;  3PO2 K;  3RZD K;  3AQP A;  4NOI A;  2JA6 A;  2ZUF A;  3S1Q C;  4MQ9 A;  4C45 A;  4A3M C;  1I6V A;  3H0G K;  3HOY K;  1EH1 A;  4KAT A;  5CHP A;  5TJ3 A;  2JA8 K;  3TFH A;  4J3N A;  1I50 K;  4BKW A;  1IL2 A;  1ZXO A;  4PAB A;  1PJ7 A;  3H0G A;  3BP3 A;  2VUM K;  4BLA A;  2PMZ L;  3LAJ A;  3HOZ K;  3I4N C;  2CFA A;  4G0W A;  4BBR C;  3V4G A;  4KB2 A;  4QJV A;  1SMY A;  4WIL A;  4KC6 A;  2VUM A;  1IW7 A;  4A3C C;  4LQY A;  2GAG C;  1J6V A;  1C0A A;  3S0X A;  4C2M K;  3TFI A;  5EGE A;  3T00 A;  4C3J K;  3RZO C;  4A3I C;  3S2H C;  3S1R C;  1R9T K;  3GTK C;  2JA5 K;  4AYB L;  4KAR A;  1TWC K;  2A69 A;  2GSN A;  3AQO A;  1IBA A;  4KMA A;  4Q4Z A;  1R9T A;  2JA5 A;  1WQG A;  1Y1W C;  2NVT C;  2R7Z K;  3GTQ K;  3N3Y A;  3ORE A;  1VRQ C; 
#chains in the Genus database with same CATH homology
 3EQL A;  2BE5 A;  4OIP A;  4BXX K;  3RZD C;  3I4N K;  4Y52 C;  4A93 K;  1HQM A;  3GTM K;  4YG2 A;  5TMC A;  5M5Y K;  2O5I A;  3GTG K;  5IP9 C;  2R92 C;  1WCM K;  4LK0 A;  4XSX A;  1TWG K;  4A3B C;  5IP7 C;  5FLM K;  4OIQ A;  4A3F K;  5IYB K;  3HKZ D;  1SFO K;  3HOY C;  4JK1 A;  1I3Q K;  2WAQ L;  3CQZ K;  3S16 C;  4A3G K;  4A3C K;  3S1Q K;  4X6A K;  2E2I K;  5C44 K;  4A3M K;  4BY1 C;  2B63 K;  3I4M K;  1TWF K;  2CW0 A;  3GTL K;  3S1M K;  2JA5 C;  2NVX C;  4C3I K;  2Y0S D;  3M4O C;  1TWH C;  1TWC C;  2PA8 L;  4LJZ A;  5IYC K;  5FJ8 K;  1I6H K;  4G7O A;  3GTK K;  1XPP A;  3DXJ A;  5M5X K;  3HOZ C;  4MEY A;  5C4X C;  1K83 K;  4LLG A;  4OIO A;  5M3M K;  5IYD K;  3H3V D;  2R7Z C;  3PO3 C;  3HOX K;  3HKZ L;  4A3E C;  3GTQ C;  5D4D A;  2R93 C;  3M3Y C;  4LK1 A;  4BBR K;  4YFK A;  5C4J C;  2JA6 K;  2E2J K;  2JA7 C;  3S15 K;  2NVT K;  4X6A C;  3FKI K;  4A3D C;  4A3L K;  4G7Z A;  2Y0S L;  5C3E C;  4G7H A;  2WB1 D;  4ZH4 A;  4AYB D;  3GTJ K;  4A93 C;  2A6H A;  3GTG C;  1WCM C;  1TWG C;  5M5W K;  4A3K K;  1R9T C;  2YU9 K;  3RZD K;  5FLM C;  2PMZ D;  3GTO K;  3PO2 K;  4BY7 K;  4NOI A;  5IYB C;  2NVQ K;  3RZO K;  4QJV B;  1I3Q C;  5IP9 K;  2A68 A;  4A3I K;  3S2H K;  4A3G C;  3S1R K;  4MQ9 A;  4A3B K;  4Y7N K;  5C44 C;  4A3M C;  3H3V L;  5IP7 K;  3S1Q C;  2B63 C;  1I6V A;  3GTL C;  3HOV K;  3I4M C;  3H0G K;  3S14 K;  3S1M C;  3HOY K;  4QIW D;  2JA8 K;  3K7A K;  1I6H C;  5IYC C;  4A3J C;  1TWA C;  2NVY K;  2WB1 L;  3GTP K;  3HOU K;  1I50 K;  4KN7 A;  2E2H C;  1K83 C;  4BBS C;  1Y1W K;  1Y1V C;  3S2D K;  3S1N K;  4KN4 A;  5IYD C;  5TMF A;  2PMZ L;  2VUM K;  3S2D C;  4BXX C;  3HOX C;  1ZYR A;  3HOZ K;  3I4N C;  5C4X K;  4OIN A;  3GTM C;  3HOW K;  2WAQ D;  4BBR C;  3S15 C;  2E2J C;  3S17 K;  3WOD A;  4A3L C;  4XSZ A;  4Y52 K;  4A3F C;  4QJV A;  1SMY A;  1SFO C;  4QIW L;  1BDF A;  3GTJ C;  3CQZ C;  5C4J K;  2R92 K;  1IW7 A;  4A3C C;  2E2I C;  2PPB A;  4OIR A;  1TWF C;  4A3K C;  2YU9 C;  5M3F K;  3PO2 C;  4C2M K;  5C3E K;  1YNN A;  4C3H K;  3GTO C;  4BY7 C;  3S16 K;  4C3J K;  2NVQ C;  4MEX A;  3RZO C;  4A3I C;  3S2H C;  2O5J A;  4BY1 K;  3S1R C;  4Q5S A;  4Y7N C;  1R9T K;  3GTK C;  2JA5 K;  2NVX K;  4YFX A;  3HOV C;  4AYB L;  3H0G C;  3S14 C;  4XLN A;  3M4O K;  1TWH K;  1TWC K;  2A69 A;  2JA8 C;  3K7A C;  2NVY C;  3GTP C;  3HOU C;  1I50 C;  4Q4Z A;  4KMU A;  2JA6 C;  1Y1W C;  2NVT C;  4A3J K;  1TWA K;  3FKI C;  4YFN A;  2R7Z K;  2VUM C;  3PO3 K;  4A3E K;  3GTQ K;  3S1N C;  2A6E A;  4XLP A;  4GZY A;  2R93 K;  3M3Y K;  2E2H K;  4BBS K;  2JA7 K;  3HOW C;  1Y1V K;  2PA8 D;  1YNJ A;  4A3D K;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...