3GTGK

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtgK00
3PO3C 4X6AK 3HOUK 4NOIA 4A3GC 5IYBC 5M3MK 5M3FK 3I4MC 2NVYK 4A3MK 2NVTK 1BDFA 4MEYA 3GTPK 4LK1A 3S17C 1YNNA 3WODA 3CQZC 3S1RK 3HOVK 3M4OK 1I6VA 4QIWD 5IYDK 2NVYC 3GTOK 4KMUA 3K7AC 4BXXC 4QIWL 2JA5K 4BBRK 1K83K 1Y1WK 3HOXC 4XSZA 1SFOC 2WB1L 5TMCA 1ZYRA 2JA6K 1I6HK 2R7ZK 4A3DC 4A3FK 2R93K 3FKIC 2VUMK 3GTGK 3S1QC 4A3LC 4LJZA 4BY1K 2NVXK 2E2JC 2JA6C 1TWFK 3GTKC 2R93C 3PO3K 3S1MC 2VUMC 3S2DC 4QJVA 3GTGC 4G7HA 4A3GK 5IYBK 4OIRA 4C2MK 1R9TC 3S2HK 4OINA 3I4MK 3H0GC 4G7OA 4KN4A 3S17K 3CQZK 3S2HC 2Y0SD 2PMZD 4YFXA 3PO2K 4KN7A 3K7AK 4BXXK 4A3KK 5C44C 2Y0SL 2PMZL 5C3EC 3RZOC 4QJVB 3HOXK 4MEXA 1SFOK 5D4DA 4A3JC 2E2HC 4A3CC 3PO2C 4A3DK 1Y1VC 4A3KC 2WB1D 3FKIK 2CW0A 3S1QK 4A3LK 5C4XC 2A6HA 1WCMK 2E2JK 3GTMK 3RZDC 1XPPA 3GTKK 2PA8D 4Y7NC 3S1MK 3S2DK 2E2IK 4C3JK 3GTJK 4A93K 1YNJA 2JA7C 2O5JA 1WCMC 2PA8L 3EQLA 1R9TK 2A69A 4C3HK 3GTMC 3H0GK 4A93C 3I4NC 2E2IC 3GTJC 1TWHK 2NVQC 4YFKA 4AYBL 4LK0A 1TWHC 2PPBA 3S14C 5C44K 3RZOK 5C3EK 2B63K 4G7ZA 3GTQC 3HOYC 4Y52C 3S16K 4XLPA 4C3IK 4A3JK 2E2HK 4A3CK 3S15C 2JA8C 3GTLK 1Y1VK 4BBSK 4MQ9A 5M5YK 3M3YC 3S1NC 4GZYA 1SMYA 2A68A 2B63C 1I3QC 5C4XK 3S16C 2WAQD 3HOZC 5IP7C 3RZDK 5C4JC 4Y7NK 3GTLC 2WAQL 4BBSC 5M5XK 4A3EC 1IW7A 2JA7K 2O5IA 4Q5SA 5IYCC 1TWAK 3H3VL 3I4NK 3HKZD 4YFNA 4OIPA 2YU9C 4A3BC 2A6EA 3HKZL 2NVQK 1I50C 1TWAC 1TWCC 4OIOA 2BE5A 5IP9C 3S14K 1TWGC 3HOYK 4AYBD 3GTQK 5FLMK 4X6AC 1HQMA 2R92K 4Y52K 3HOUC 5TMFA 2JA8K 3S15K 4ZH4A 3M3YK 3S1NK 4XLNA 5FJ8K 1I3QK 5FLMC 4A3MC 2NVTC 2R92C 3GTPC 4BY7K 4JK1A 3HOZK 5IP7K 5C4JK 3S1RC 3HOWK 3HOVC 3M4OC 4A3EK 3DXJA 5IYDC 4BY7C 4XSXA 3GTOC 5IYCK 2JA5C 4BBRC 1K83C 1Y1WC 5M5WK 4OIQA 3HOWC 2YU9K 4A3BK 3H3VD 4A3IK 4LLGA 1I6HC 4Q4ZA 2R7ZC 4A3FC 1I50K 1TWCK 4YG2A 4BY1C 2NVXC 5IP9K 4A3IC 1TWFC 1TWGK
chains in the Genus database with same CATH superfamily
1O2BA 4NOIA 5IYBC 4A3MK 4LK1A 3GEIA 2P5MA 5IOTA 1WQHA 3S17C 4KDDA 3S1RK 3HOVK 1VJEA 4P5AA 5TJ3A 1WORA 1VH2A 3S0XA 2XCOA 1SFOC 4C45A 2R7ZK 3FKIC 3S1QC 4BY1K 3AD8C 1TWFK 1WCMA 3GTKC 1O24A 3PO3K 4C3JC 5E68A 3GTGC 1BGWA 1R9TC 4OINA 1DD5A 4C3HC 3H0GC 4G7OA 4KATA 4KN4A 3S2HC 1IBAA 3GTQA 4YFXA 3PO2K 3K7AK 4BXXK 3G4CA 4QJVB 2B63A 4A3JC 4A3CC 3N0BA 2E2HA 4A3DK 4A3KC 1XXCA 4J3NA 2PHCB 1WCMK 2E2JK 2PA8D 3S1MK 2JA7C 4XCHA 2A69A 1TWAA 1YX2A 3LAJA 2RGRA 2NVQC 1ZQ1C 4AYBL 3S14C 5C44K 3LPXA 3T00A 5C3EK 2B63K 4Y52C 2E2HK 4C3IK 1VRQC 4KAWX 1Y1VK 1F9NA 4GTCA 3FOEA 2A68A 3A8IA 1I3QC 5C4XK 1C0AA 3RZDK 3GTLC 1O27A 4GFQA 2WAQL 2JA5A 5M5XK 1K83A 1Y1WA 2O5IA 1TWAK 3HKZD 4OIPA 2YU9C 4A3BC 2A6EA 1EFWA 1I50C 2CFAB 5EGHA 3HOYK 3ERED 1USOA 5TMFA 3T01A 2JA8K 3V4GA 4KMDA 3CQZA 3OPFA 4A3MC 1BS2A 1JVIA 4BKWA 1XXAA 3LAPA 3S1RC 3HOVC 2RH6A 4BY7C 3GTOA 5CJ9A 3HOWC 1USMA 5M5WK 4OIQA 2R7ZC 1TWCK 2VUMA 4BY1C 2NVXA 1TWFC 4G0VA 2XCRB 3PO3C 2GSUA 3AH5A 3HOUK 4GT9A 5M3MK 4KMAA 3A8KA 2GSOA 4WJ4A 1YNNA 5IORA 2NVYC 3GTOK 3K7AC 4BXXC 4QIWL 3L4KA 1I6HK 1EH1A 1ZYRA 1HI9A 4A3DC 2VUMK 4LJZA 2NVXK 2E2JC 2JA6C 1O29A 5JFEA 2R93C 3GTMA 4KM9A 3S1MC 4GTFA 1WSRA 4QJVA 4WILA 4A3GK 1ZXOA 2P8TA 1L0WA 3GEHA 3GSIA 1DCPA 4LOWA 2KWAA 2JH3A 2Y0SD 4KN7A 4LR2A 5C44C 1J6WA 2PMZL 5C3EC 1G51A 2E2HC 4C3IC 1Y1VC 2WB1D 2CW0A 1KQ4A 4A3LK 5C4XC 2A6HA 2D6FC 3GTMK 3RZDC 1XPPA 2GAHC 2W7VA 3S2DK 1YNJA 3EQLA 4A93C 2E2IC 3GTJC 1PJ6A 1TWGA 4BLBA 1RU0A 1TWHC 3RZOK 3HOYC 3S16K 2JA8C 4BBSK 3L4JA 4MQ9A 3AD9C 1SMYA 2CFAA 3OEPA 4PAAA 4WJ3M 4PABA 1F7UA 4YFNA 4GTDA 1TWCC 4OIOA 1VGXA 1XZQB 3GTQK 3HOUC 3S15K 2ZUFA 3S1NK 5FJ8K 3TFHA 5FLMC 3FHZA 2R92C 2EBBA 4JK1A 3HOZK 4P5BA 5IP7K 5C4JK 3JSTA 2V6SA 1PJ7A 4A3EK 4M1XA 1SFOA 1WQGA 3GTOC 5CHPA 5IYCK 4GTBA 3FKIA 1WIHA 1I6HC 4A3IK 4LLGA 1WSVA 3GTKA 2NVXC 3GTGA 1R9TA 1O25A 3H0GA 4G0UA 4A3GC 1EQRA 4KMHA 1DCHA 4MEYA 2NVTK 1B4AA 3WODA 3M4OK 1I6VA 4KASA 1BJTA 2JA5K 1K83K 1Y1WK 3VA7A 3IPJA 4XSZA 2WB1L 4A3FK 1J98A 1O26A 2V6UA 4DDQA 3GTGK 4A3LC 3GIRA 2JA7A 1IQ0A 3S2DC 4G7HA 3AD7C 4OIRA 4C2MK 3GDZA 3S2HK 3I4MK 1UV7A 3CQZK 4O2DA 4A3KK 1F93A 1INNA 4G0WA 3RZOC 3SZZA 3HOXK 4MEXA 2Y3PA 1I3QA 4KARA 3PO2C 1J6VA 4KM8A 3AQPA 3GTLA 2ZUEA 3HXAA 1F7VA 3T02A 3BP3A 5EGEA 2O5JA 3QX3A 1WCMC 2PA8L 4YFKA 2GSNA 1ZBSA 4FZBA 4LK0A 3ADAC 3GTQC 3A8JA 4XLPA 3S15C 3FOFA 1IS1A 3GTLK 5M5YK 3S1NC 4GZYA 2B63C 2WAQD 3HOZC 5IP7C 5C4JC 1WOSA 1XZQA 2FQTA 4Y7NK 1IE0A 3NUHA 4A3EC 4Q5SA 1EK8A 5IYCC 2R7ZA 3I4NK 3Q3QA 4GTAA 4KB4A 3HKZL 1TWFA 1TWAC 3TTGA 1YCLA 4GTLA 5JVOA 3TFIA 1HQMA 1WOOA 4KB2A 3M3YK 1WQFA 5IOQA 4XLNA 4BY7K 2NVTC 2NVYA 3GTPA 3CAGA 3HOWK 3M4OC 3DXJA 1XZPB 4P9SA 2JA5C 1K83C 1XXBA 1Y1WC 3H3VD 2GAGC 4Q4ZA 2JA6A 4A3FC 2R93A 1J6XA 4YG2A 5IP9K 1TWGK 4X6AK 4C2MC 3I4MC 5M3FK 2NVYK 1BDFA 3GTPK 3TFJA 5HL8A 3CQZC 2XCQA 4QIWD 5IYDK 4KMUA 4FM9A 4BBRK 1Y1VA 4ILDA 3HOXC 3OREA 1X31C 3AQOA 5TMCA 2JA6K 2R93K 1JOEA 1IL2A 1DCOA 1EI6A 2VUMC 2E2IA 3GTJA 5IYBK 3N3YA 3S17K 1TWHA 1PJ5A 1JQWA 2PMZD 2Y0SL 1SFOK 5D4DA 3MMLB 3BP8C 3FKIK 3S1QK 1AB4A 3N0CA 3GTKK 4A93K 4Y7NC 2E2IK 4C3JK 3GTJK 1O2FB 1GE9A 4BLAA 1R9TK 3GTMC 4C3HK 3H0GK 3I4NC 1TWCA 1TWHK 3GEEA 5IOSA 2PPBA 4G7ZA 2FQOA 4A3JK 4A3CK 2R92A 1O28A 3M3YC 3BUEA 3S16C 4BBSC 4AH6A 1IW7A 4GTEA 2JA7K 3H3VL 1V5VA 1ZVUA 1O2AA 2YU9A 2ZFZA 1B4BA 2NVQK 1ISEA 1I50A 1XZPA 2BE5A 5IP9C 3S14K 1TWGC 4AYBD 5FLMK 2V6TA 2R92K 4X6AC 4Y52K 4RMFA 4ZH4A 1VLOA 1I3QK 3GTPC 1WOPA 5IYDC 4XSXA 4BBRC 4LQYA 2YU9K 4A3BK 3SZYA 5L46A 3G4AA 1I50K 4KC6A 4A3IC
chains in the Genus database with same CATH topology
3PO3C 4X6AK 3HOUK 4NOIA 4A3GC 5IYBC 5M3MK 5M3FK 3I4MC 2NVYK 4A3MK 2NVTK 1BDFA 4MEYA 3GTPK 4LK1A 3S17C 1YNNA 3WODA 3CQZC 3S1RK 3HOVK 3M4OK 1I6VA 4QIWD 5IYDK 2NVYC 3GTOK 4KMUA 3K7AC 4BXXC 4QIWL 2JA5K 4BBRK 1K83K 1Y1WK 3HOXC 4XSZA 1SFOC 2WB1L 5TMCA 1ZYRA 2JA6K 1I6HK 2R7ZK 4A3DC 4A3FK 2R93K 3FKIC 2VUMK 3GTGK 3S1QC 4A3LC 4LJZA 4BY1K 2NVXK 2E2JC 2JA6C 1TWFK 3GTKC 2R93C 3PO3K 3S1MC 2VUMC 3S2DC 4QJVA 3GTGC 4G7HA 4A3GK 5IYBK 4OIRA 4C2MK 1R9TC 3S2HK 4OINA 3I4MK 3H0GC 4G7OA 4KN4A 3S17K 3CQZK 3S2HC 2Y0SD 2PMZD 4YFXA 3PO2K 4KN7A 3K7AK 4BXXK 4A3KK 5C44C 2Y0SL 2PMZL 5C3EC 3RZOC 4QJVB 3HOXK 4MEXA 1SFOK 5D4DA 4A3JC 2E2HC 4A3CC 3PO2C 4A3DK 1Y1VC 4A3KC 2WB1D 3FKIK 2CW0A 3S1QK 4A3LK 5C4XC 2A6HA 1WCMK 2E2JK 3GTMK 3RZDC 1XPPA 3GTKK 2PA8D 4Y7NC 3S1MK 3S2DK 2E2IK 4C3JK 3GTJK 4A93K 1YNJA 2JA7C 2O5JA 1WCMC 2PA8L 3EQLA 1R9TK 2A69A 4C3HK 3GTMC 3H0GK 4A93C 3I4NC 2E2IC 3GTJC 1TWHK 2NVQC 4YFKA 4AYBL 4LK0A 1TWHC 2PPBA 3S14C 5C44K 3RZOK 5C3EK 2B63K 4G7ZA 3GTQC 3HOYC 4Y52C 3S16K 4XLPA 4C3IK 4A3JK 2E2HK 4A3CK 3S15C 2JA8C 3GTLK 1Y1VK 4BBSK 4MQ9A 5M5YK 3M3YC 3S1NC 4GZYA 1SMYA 2A68A 2B63C 1I3QC 5C4XK 3S16C 2WAQD 3HOZC 5IP7C 3RZDK 5C4JC 4Y7NK 3GTLC 2WAQL 4BBSC 5M5XK 4A3EC 1IW7A 2JA7K 2O5IA 4Q5SA 5IYCC 1TWAK 3H3VL 3I4NK 3HKZD 4YFNA 4OIPA 2YU9C 4A3BC 2A6EA 3HKZL 2NVQK 1I50C 1TWAC 1TWCC 4OIOA 2BE5A 5IP9C 3S14K 1TWGC 3HOYK 4AYBD 3GTQK 5FLMK 4X6AC 1HQMA 2R92K 4Y52K 3HOUC 5TMFA 2JA8K 3S15K 4ZH4A 3M3YK 3S1NK 4XLNA 5FJ8K 1I3QK 5FLMC 4A3MC 2NVTC 2R92C 3GTPC 4BY7K 4JK1A 3HOZK 5IP7K 5C4JK 3S1RC 3HOWK 3HOVC 3M4OC 4A3EK 3DXJA 5IYDC 4BY7C 4XSXA 3GTOC 5IYCK 2JA5C 4BBRC 1K83C 1Y1WC 5M5WK 4OIQA 3HOWC 2YU9K 4A3BK 3H3VD 4A3IK 4LLGA 1I6HC 4Q4ZA 2R7ZC 4A3FC 1I50K 1TWCK 4YG2A 4BY1C 2NVXC 5IP9K 4A3IC 1TWFC 1TWGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 C;  4X6A K;  3HOU K;  4NOI A;  4A3G C;  5IYB C;  5M3M K;  5M3F K;  3I4M C;  2NVY K;  4A3M K;  2NVT K;  1BDF A;  4MEY A;  3GTP K;  4LK1 A;  3S17 C;  1YNN A;  3WOD A;  3CQZ C;  3S1R K;  3HOV K;  3M4O K;  1I6V A;  4QIW D;  5IYD K;  2NVY C;  3GTO K;  4KMU A;  3K7A C;  4BXX C;  4QIW L;  2JA5 K;  4BBR K;  1K83 K;  1Y1W K;  3HOX C;  4XSZ A;  1SFO C;  2WB1 L;  5TMC A;  1ZYR A;  2JA6 K;  1I6H K;  2R7Z K;  4A3D C;  4A3F K;  2R93 K;  3FKI C;  2VUM K;  3GTG K;  3S1Q C;  4A3L C;  4LJZ A;  4BY1 K;  2NVX K;  2E2J C;  2JA6 C;  1TWF K;  3GTK C;  2R93 C;  3PO3 K;  3S1M C;  2VUM C;  3S2D C;  4QJV A;  3GTG C;  4G7H A;  4A3G K;  5IYB K;  4OIR A;  4C2M K;  1R9T C;  3S2H K;  4OIN A;  3I4M K;  3H0G C;  4G7O A;  4KN4 A;  3S17 K;  3CQZ K;  3S2H C;  2Y0S D;  2PMZ D;  4YFX A;  3PO2 K;  4KN7 A;  3K7A K;  4BXX K;  4A3K K;  5C44 C;  2Y0S L;  2PMZ L;  5C3E C;  3RZO C;  4QJV B;  3HOX K;  4MEX A;  1SFO K;  5D4D A;  4A3J C;  2E2H C;  4A3C C;  3PO2 C;  4A3D K;  1Y1V C;  4A3K C;  2WB1 D;  3FKI K;  2CW0 A;  3S1Q K;  4A3L K;  5C4X C;  2A6H A;  1WCM K;  2E2J K;  3GTM K;  3RZD C;  1XPP A;  3GTK K;  2PA8 D;  4Y7N C;  3S1M K;  3S2D K;  2E2I K;  4C3J K;  3GTJ K;  4A93 K;  1YNJ A;  2JA7 C;  2O5J A;  1WCM C;  2PA8 L;  3EQL A;  1R9T K;  2A69 A;  4C3H K;  3GTM C;  3H0G K;  4A93 C;  3I4N C;  2E2I C;  3GTJ C;  1TWH K;  2NVQ C;  4YFK A;  4AYB L;  4LK0 A;  1TWH C;  2PPB A;  3S14 C;  5C44 K;  3RZO K;  5C3E K;  2B63 K;  4G7Z A;  3GTQ C;  3HOY C;  4Y52 C;  3S16 K;  4XLP A;  4C3I K;  4A3J K;  2E2H K;  4A3C K;  3S15 C;  2JA8 C;  3GTL K;  1Y1V K;  4BBS K;  4MQ9 A;  5M5Y K;  3M3Y C;  3S1N C;  4GZY A;  1SMY A;  2A68 A;  2B63 C;  1I3Q C;  5C4X K;  3S16 C;  2WAQ D;  3HOZ C;  5IP7 C;  3RZD K;  5C4J C;  4Y7N K;  3GTL C;  2WAQ L;  4BBS C;  5M5X K;  4A3E C;  1IW7 A;  2JA7 K;  2O5I A;  4Q5S A;  5IYC C;  1TWA K;  3H3V L;  3I4N K;  3HKZ D;  4YFN A;  4OIP A;  2YU9 C;  4A3B C;  2A6E A;  3HKZ L;  2NVQ K;  1I50 C;  1TWA C;  1TWC C;  4OIO A;  2BE5 A;  5IP9 C;  3S14 K;  1TWG C;  3HOY K;  4AYB D;  3GTQ K;  5FLM K;  4X6A C;  1HQM A;  2R92 K;  4Y52 K;  3HOU C;  5TMF A;  2JA8 K;  3S15 K;  4ZH4 A;  3M3Y K;  3S1N K;  4XLN A;  5FJ8 K;  1I3Q K;  5FLM C;  4A3M C;  2NVT C;  2R92 C;  3GTP C;  4BY7 K;  4JK1 A;  3HOZ K;  5IP7 K;  5C4J K;  3S1R C;  3HOW K;  3HOV C;  3M4O C;  4A3E K;  3DXJ A;  5IYD C;  4BY7 C;  4XSX A;  3GTO C;  5IYC K;  2JA5 C;  4BBR C;  1K83 C;  1Y1W C;  5M5W K;  4OIQ A;  3HOW C;  2YU9 K;  4A3B K;  3H3V D;  4A3I K;  4LLG A;  1I6H C;  4Q4Z A;  2R7Z C;  4A3F C;  1I50 K;  1TWC K;  4YG2 A;  4BY1 C;  2NVX C;  5IP9 K;  4A3I C;  1TWF C;  1TWG K; 
#chains in the Genus database with same CATH topology
 1O2B A;  4NOI A;  5IYB C;  4A3M K;  4LK1 A;  3GEI A;  2P5M A;  5IOT A;  1WQH A;  3S17 C;  4KDD A;  3S1R K;  3HOV K;  1VJE A;  4P5A A;  5TJ3 A;  1WOR A;  1VH2 A;  3S0X A;  2XCO A;  1SFO C;  4C45 A;  2R7Z K;  3FKI C;  3S1Q C;  4BY1 K;  3AD8 C;  1TWF K;  1WCM A;  3GTK C;  1O24 A;  3PO3 K;  4C3J C;  5E68 A;  3GTG C;  1BGW A;  1R9T C;  4OIN A;  1DD5 A;  4C3H C;  3H0G C;  4G7O A;  4KAT A;  4KN4 A;  3S2H C;  1IBA A;  3GTQ A;  4YFX A;  3PO2 K;  3K7A K;  4BXX K;  3G4C A;  4QJV B;  2B63 A;  4A3J C;  4A3C C;  3N0B A;  2E2H A;  4A3D K;  4A3K C;  1XXC A;  4J3N A;  2PHC B;  1WCM K;  2E2J K;  2PA8 D;  3S1M K;  2JA7 C;  4XCH A;  2A69 A;  1TWA A;  1YX2 A;  3LAJ A;  2RGR A;  2NVQ C;  1ZQ1 C;  4AYB L;  3S14 C;  5C44 K;  3LPX A;  3T00 A;  5C3E K;  2B63 K;  4Y52 C;  2E2H K;  4C3I K;  1VRQ C;  4KAW X;  1Y1V K;  1F9N A;  4GTC A;  3FOE A;  2A68 A;  3A8I A;  1I3Q C;  5C4X K;  1C0A A;  3RZD K;  3GTL C;  1O27 A;  4GFQ A;  2WAQ L;  2JA5 A;  5M5X K;  1K83 A;  1Y1W A;  2O5I A;  1TWA K;  3HKZ D;  4OIP A;  2YU9 C;  4A3B C;  2A6E A;  1EFW A;  1I50 C;  2CFA B;  5EGH A;  3HOY K;  3ERE D;  1USO A;  5TMF A;  3T01 A;  2JA8 K;  3V4G A;  4KMD A;  3CQZ A;  3OPF A;  4A3M C;  1BS2 A;  1JVI A;  4BKW A;  1XXA A;  3LAP A;  3S1R C;  3HOV C;  2RH6 A;  4BY7 C;  3GTO A;  5CJ9 A;  3HOW C;  1USM A;  5M5W K;  4OIQ A;  2R7Z C;  1TWC K;  2VUM A;  4BY1 C;  2NVX A;  1TWF C;  4G0V A;  2XCR B;  3PO3 C;  2GSU A;  3AH5 A;  3HOU K;  4GT9 A;  5M3M K;  4KMA A;  3A8K A;  2GSO A;  4WJ4 A;  1YNN A;  5IOR A;  2NVY C;  3GTO K;  3K7A C;  4BXX C;  4QIW L;  3L4K A;  1I6H K;  1EH1 A;  1ZYR A;  1HI9 A;  4A3D C;  2VUM K;  4LJZ A;  2NVX K;  2E2J C;  2JA6 C;  1O29 A;  5JFE A;  2R93 C;  3GTM A;  4KM9 A;  3S1M C;  4GTF A;  1WSR A;  4QJV A;  4WIL A;  4A3G K;  1ZXO A;  2P8T A;  1L0W A;  3GEH A;  3GSI A;  1DCP A;  4LOW A;  2KWA A;  2JH3 A;  2Y0S D;  4KN7 A;  4LR2 A;  5C44 C;  1J6W A;  2PMZ L;  5C3E C;  1G51 A;  2E2H C;  4C3I C;  1Y1V C;  2WB1 D;  2CW0 A;  1KQ4 A;  4A3L K;  5C4X C;  2A6H A;  2D6F C;  3GTM K;  3RZD C;  1XPP A;  2GAH C;  2W7V A;  3S2D K;  1YNJ A;  3EQL A;  4A93 C;  2E2I C;  3GTJ C;  1PJ6 A;  1TWG A;  4BLB A;  1RU0 A;  1TWH C;  3RZO K;  3HOY C;  3S16 K;  2JA8 C;  4BBS K;  3L4J A;  4MQ9 A;  3AD9 C;  1SMY A;  2CFA A;  3OEP A;  4PAA A;  4WJ3 M;  4PAB A;  1F7U A;  4YFN A;  4GTD A;  1TWC C;  4OIO A;  1VGX A;  1XZQ B;  3GTQ K;  3HOU C;  3S15 K;  2ZUF A;  3S1N K;  5FJ8 K;  3TFH A;  5FLM C;  3FHZ A;  2R92 C;  2EBB A;  4JK1 A;  3HOZ K;  4P5B A;  5IP7 K;  5C4J K;  3JST A;  2V6S A;  1PJ7 A;  4A3E K;  4M1X A;  1SFO A;  1WQG A;  3GTO C;  5CHP A;  5IYC K;  4GTB A;  3FKI A;  1WIH A;  1I6H C;  4A3I K;  4LLG A;  1WSV A;  3GTK A;  2NVX C;  3GTG A;  1R9T A;  1O25 A;  3H0G A;  4G0U A;  4A3G C;  1EQR A;  4KMH A;  1DCH A;  4MEY A;  2NVT K;  1B4A A;  3WOD A;  3M4O K;  1I6V A;  4KAS A;  1BJT A;  2JA5 K;  1K83 K;  1Y1W K;  3VA7 A;  3IPJ A;  4XSZ A;  2WB1 L;  4A3F K;  1J98 A;  1O26 A;  2V6U A;  4DDQ A;  3GTG K;  4A3L C;  3GIR A;  2JA7 A;  1IQ0 A;  3S2D C;  4G7H A;  3AD7 C;  4OIR A;  4C2M K;  3GDZ A;  3S2H K;  3I4M K;  1UV7 A;  3CQZ K;  4O2D A;  4A3K K;  1F93 A;  1INN A;  4G0W A;  3RZO C;  3SZZ A;  3HOX K;  4MEX A;  2Y3P A;  1I3Q A;  4KAR A;  3PO2 C;  1J6V A;  4KM8 A;  3AQP A;  3GTL A;  2ZUE A;  3HXA A;  1F7V A;  3T02 A;  3BP3 A;  5EGE A;  2O5J A;  3QX3 A;  1WCM C;  2PA8 L;  4YFK A;  2GSN A;  1ZBS A;  4FZB A;  4LK0 A;  3ADA C;  3GTQ C;  3A8J A;  4XLP A;  3S15 C;  3FOF A;  1IS1 A;  3GTL K;  5M5Y K;  3S1N C;  4GZY A;  2B63 C;  2WAQ D;  3HOZ C;  5IP7 C;  5C4J C;  1WOS A;  1XZQ A;  2FQT A;  4Y7N K;  1IE0 A;  3NUH A;  4A3E C;  4Q5S A;  1EK8 A;  5IYC C;  2R7Z A;  3I4N K;  3Q3Q A;  4GTA A;  4KB4 A;  3HKZ L;  1TWF A;  1TWA C;  3TTG A;  1YCL A;  4GTL A;  5JVO A;  3TFI A;  1HQM A;  1WOO A;  4KB2 A;  3M3Y K;  1WQF A;  5IOQ A;  4XLN A;  4BY7 K;  2NVT C;  2NVY A;  3GTP A;  3CAG A;  3HOW K;  3M4O C;  3DXJ A;  1XZP B;  4P9S A;  2JA5 C;  1K83 C;  1XXB A;  1Y1W C;  3H3V D;  2GAG C;  4Q4Z A;  2JA6 A;  4A3F C;  2R93 A;  1J6X A;  4YG2 A;  5IP9 K;  1TWG K;  4X6A K;  4C2M C;  3I4M C;  5M3F K;  2NVY K;  1BDF A;  3GTP K;  3TFJ A;  5HL8 A;  3CQZ C;  2XCQ A;  4QIW D;  5IYD K;  4KMU A;  4FM9 A;  4BBR K;  1Y1V A;  4ILD A;  3HOX C;  3ORE A;  1X31 C;  3AQO A;  5TMC A;  2JA6 K;  2R93 K;  1JOE A;  1IL2 A;  1DCO A;  1EI6 A;  2VUM C;  2E2I A;  3GTJ A;  5IYB K;  3N3Y A;  3S17 K;  1TWH A;  1PJ5 A;  1JQW A;  2PMZ D;  2Y0S L;  1SFO K;  5D4D A;  3MML B;  3BP8 C;  3FKI K;  3S1Q K;  1AB4 A;  3N0C A;  3GTK K;  4A93 K;  4Y7N C;  2E2I K;  4C3J K;  3GTJ K;  1O2F B;  1GE9 A;  4BLA A;  1R9T K;  3GTM C;  4C3H K;  3H0G K;  3I4N C;  1TWC A;  1TWH K;  3GEE A;  5IOS A;  2PPB A;  4G7Z A;  2FQO A;  4A3J K;  4A3C K;  2R92 A;  1O28 A;  3M3Y C;  3BUE A;  3S16 C;  4BBS C;  4AH6 A;  1IW7 A;  4GTE A;  2JA7 K;  3H3V L;  1V5V A;  1ZVU A;  1O2A A;  2YU9 A;  2ZFZ A;  1B4B A;  2NVQ K;  1ISE A;  1I50 A;  1XZP A;  2BE5 A;  5IP9 C;  3S14 K;  1TWG C;  4AYB D;  5FLM K;  2V6T A;  2R92 K;  4X6A C;  4Y52 K;  4RMF A;  4ZH4 A;  1VLO A;  1I3Q K;  3GTP C;  1WOP A;  5IYD C;  4XSX A;  4BBR C;  4LQY A;  2YU9 K;  4A3B K;  3SZY A;  5L46 A;  3G4A A;  1I50 K;  4KC6 A;  4A3I C; 
#chains in the Genus database with same CATH homology
 3PO3 C;  4X6A K;  3HOU K;  4NOI A;  4A3G C;  5IYB C;  5M3M K;  5M3F K;  3I4M C;  2NVY K;  4A3M K;  2NVT K;  1BDF A;  4MEY A;  3GTP K;  4LK1 A;  3S17 C;  1YNN A;  3WOD A;  3CQZ C;  3S1R K;  3HOV K;  3M4O K;  1I6V A;  4QIW D;  5IYD K;  2NVY C;  3GTO K;  4KMU A;  3K7A C;  4BXX C;  4QIW L;  2JA5 K;  4BBR K;  1K83 K;  1Y1W K;  3HOX C;  4XSZ A;  1SFO C;  2WB1 L;  5TMC A;  1ZYR A;  2JA6 K;  1I6H K;  2R7Z K;  4A3D C;  4A3F K;  2R93 K;  3FKI C;  2VUM K;  3GTG K;  3S1Q C;  4A3L C;  4LJZ A;  4BY1 K;  2NVX K;  2E2J C;  2JA6 C;  1TWF K;  3GTK C;  2R93 C;  3PO3 K;  3S1M C;  2VUM C;  3S2D C;  4QJV A;  3GTG C;  4G7H A;  4A3G K;  5IYB K;  4OIR A;  4C2M K;  1R9T C;  3S2H K;  4OIN A;  3I4M K;  3H0G C;  4G7O A;  4KN4 A;  3S17 K;  3CQZ K;  3S2H C;  2Y0S D;  2PMZ D;  4YFX A;  3PO2 K;  4KN7 A;  3K7A K;  4BXX K;  4A3K K;  5C44 C;  2Y0S L;  2PMZ L;  5C3E C;  3RZO C;  4QJV B;  3HOX K;  4MEX A;  1SFO K;  5D4D A;  4A3J C;  2E2H C;  4A3C C;  3PO2 C;  4A3D K;  1Y1V C;  4A3K C;  2WB1 D;  3FKI K;  2CW0 A;  3S1Q K;  4A3L K;  5C4X C;  2A6H A;  1WCM K;  2E2J K;  3GTM K;  3RZD C;  1XPP A;  3GTK K;  2PA8 D;  4Y7N C;  3S1M K;  3S2D K;  2E2I K;  4C3J K;  3GTJ K;  4A93 K;  1YNJ A;  2JA7 C;  2O5J A;  1WCM C;  2PA8 L;  3EQL A;  1R9T K;  2A69 A;  4C3H K;  3GTM C;  3H0G K;  4A93 C;  3I4N C;  2E2I C;  3GTJ C;  1TWH K;  2NVQ C;  4YFK A;  4AYB L;  4LK0 A;  1TWH C;  2PPB A;  3S14 C;  5C44 K;  3RZO K;  5C3E K;  2B63 K;  4G7Z A;  3GTQ C;  3HOY C;  4Y52 C;  3S16 K;  4XLP A;  4C3I K;  4A3J K;  2E2H K;  4A3C K;  3S15 C;  2JA8 C;  3GTL K;  1Y1V K;  4BBS K;  4MQ9 A;  5M5Y K;  3M3Y C;  3S1N C;  4GZY A;  1SMY A;  2A68 A;  2B63 C;  1I3Q C;  5C4X K;  3S16 C;  2WAQ D;  3HOZ C;  5IP7 C;  3RZD K;  5C4J C;  4Y7N K;  3GTL C;  2WAQ L;  4BBS C;  5M5X K;  4A3E C;  1IW7 A;  2JA7 K;  2O5I A;  4Q5S A;  5IYC C;  1TWA K;  3H3V L;  3I4N K;  3HKZ D;  4YFN A;  4OIP A;  2YU9 C;  4A3B C;  2A6E A;  3HKZ L;  2NVQ K;  1I50 C;  1TWA C;  1TWC C;  4OIO A;  2BE5 A;  5IP9 C;  3S14 K;  1TWG C;  3HOY K;  4AYB D;  3GTQ K;  5FLM K;  4X6A C;  1HQM A;  2R92 K;  4Y52 K;  3HOU C;  5TMF A;  2JA8 K;  3S15 K;  4ZH4 A;  3M3Y K;  3S1N K;  4XLN A;  5FJ8 K;  1I3Q K;  5FLM C;  4A3M C;  2NVT C;  2R92 C;  3GTP C;  4BY7 K;  4JK1 A;  3HOZ K;  5IP7 K;  5C4J K;  3S1R C;  3HOW K;  3HOV C;  3M4O C;  4A3E K;  3DXJ A;  5IYD C;  4BY7 C;  4XSX A;  3GTO C;  5IYC K;  2JA5 C;  4BBR C;  1K83 C;  1Y1W C;  5M5W K;  4OIQ A;  3HOW C;  2YU9 K;  4A3B K;  3H3V D;  4A3I K;  4LLG A;  1I6H C;  4Q4Z A;  2R7Z C;  4A3F C;  1I50 K;  1TWC K;  4YG2 A;  4BY1 C;  2NVX C;  5IP9 K;  4A3I C;  1TWF C;  1TWG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...