3GTGK

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtgK00
1IW7A 3HOZC 1TWAC 3GTLK 4AYBL 1I50K 2YU9K 4OIRA 2NVXK 3GTLC 1I3QK 1I50C 2YU9C 5FJ8K 2NVXC 1I3QC 5M5XK 4OIQA 1Y1VK 1YNNA 4LJZA 4A3DK 4A3FK 1Y1VC 4A3DC 1YNJA 4MEYA 4A3IK 3HKZL 4XSZA 1TWHK 4C3IK 4A3FC 4GZYA 3S1MK 1HQMA 4A3IC 1TWFK 3GTKK 1TWHC 1WCMK 2WAQL 1TWGK 5IYDK 3S1MC 1TWFC 3H0GK 1Y1WC 4A3JK 3GTKC 2JA5K 3K7AK 1WCMC 5IYDC 1TWGC 4ZH4A 3GTGC 4BXXK 2JA6K 3H0GC 3M3YK 4X6AK 4A3JC 4C3JK 3K7AC 5M3MK 2JA5C 4A3MK 2R92K 2PA8L 3GTMK 3GTJK 2JA6C 3GTOK 3M3YC 4X6AC 3RZDK 4G7ZA 2JA8K 4LK0A 4A3MC 2R92C 3HOYK 3GTMC 3GTJC 3GTOC 3RZDC 2JA8C 3HOYC 1K83K 4XLPA 4BBSK 5IP7K 4KMUA 4LK1A 3S2HK 4BY7K 1K83C 4BBSC 4OIOA 4QJVA 5C4XK 5IP7C 3S2HC 1ZYRA 3HOWK 4BY7C 4QJVB 5C4XC 3I4NK 3PO3K 5M3FK 3HOWC 2Y0SL 3WODA 4A3GK 5IYCK 1R9TK 4AYBD 3I4NC 3PO3C 2A6HA 5M5YK 4A3GC 3DXJA 5IYCC 1R9TC 4QIWL 4Q5SA 2B63K 4Y52K 3S1NK 4YFKA 2B63C 1TWCK 4OIPA 3HOUK 4Y52C 3S1NC 3S14K 4YFXA 1TWCC 5FLMK 3HOUC 4G7OA 3HKZD 4XSXA 3HOXK 4G7HA 1SFOK 3S14C 4QIWD 4MEXA 5FLMC 3HOXC 3CQZK 1SFOC 2WAQD 4A3LK 4JK1A 3S17K 5TMCA 2NVTK 3CQZC 2BE5A 4A3LC 3S15K 3S17C 4MQ9A 2NVTC 2E2IK 2A68A 2O5JA 1BDFA 2PA8D 3S15C 3RZOK 2E2IC 5C3EK 2PMZL 3RZOC 2R7ZK 2R93K 2A6EA 3S16K 4BXXC 1I6HK 2R7ZC 3M4OK 2R93C 3S16C 1I6HC 4C3HK 2E2JK 4YG2A 4OINA 3S2DK 3M4OC 5IP9K 4A3KK 4KN7A 3GTPK 2E2JC 3S2DC 2Y0SD 2A69A 5IP9C 4A3KC 3S1QK 3GTPC 3FKIK 3PO2K 2O5IA 3S1QC 2WB1L 3FKIC 5M5WK 3H3VL 2E2HK 3PO2C 4A3CK 4A3CC 2E2HC 4A3BK 4BY1K 2VUMK 3EQLA 2JA7K 4A3BC 3GTQK 5TMFA 2WB1D 4BY1C 2VUMC 2NVYK 3H3VD 1SMYA 5IYBK 2JA7C 5C44K 4Y7NK 3GTQC 2NVYC 1XPPA 5IYBC 4YFNA 4BBRK 4XLNA 4Y7NC 5C44C 5C3EC 3S1RK 2PPBA 2NVQK 5C4JK 4BBRC 4KN4A 2NVQC 4A3EK 3S1RC 5D4DA 4Q4ZA 3HOVK 5C4JC 3I4MK 4A3EC 3HOZK 2CW0A 3HOVC 3I4MC 4A93K 2PMZD 1Y1WK 3GTGK 4NOIA 1TWAK 4C2MK 4A93C 1I6VA 4LLGA
chains in the Genus database with same CATH superfamily
1TWAC 4KASA 2YU9K 1O25A 3TTGA 1I50C 3A8JA 1I3QC 1F93A 4BLBA 4A3DK 1YNNA 4LJZA 1RU0A 2FQOA 3BP3A 4MEYA 1O28A 1J6XA 4A3FC 2E2HA 1HQMA 1TWHC 1TWGK 3BP8C 1TWFC 4A3JK 1YX2A 2PHCB 4ZH4A 3H0GC 3M3YK 1JOEA 4BXXC 1WQFA 3GTJK 4X6AC 1VRQC 1AB4A 4BLAA 4G7ZA 2JA8K 3GTMC 2R7ZA 1L0WA 1K83K 1VGXA 4KM8A 3S2HK 4BY7K 4KMHA 4KB2A 5C4XK 3I4NK 3WODA 2P5MA 5M5YK 3DXJA 4QIWL 2YU9A 5JFEA 4Y52K 3S1NK 3N3YA 2XCOA 1X31C 1IQ0A 3HOUC 5EGEA 1SFOK 3S14C 4BKWA 3HOXC 2Y3PA 3Q3QA 3NUHA 1EK8A 4WJ3M 4A3LC 1TWGA 3S15K 3S17C 1XZQA 4M1XA 2XCRB 5C3EK 3GTJA 2R93K 4GTEA 2R7ZC 3LAPA 5IORA 1K83A 3S16C 1I6HC 3S2DK 4OINA 4KN7A 4PAAA 2Y0SD 5IP9C 2CFAB 4KB4A 2O5IA 3S1QC 5M5WK 1B4BA 1F7VA 2GAHC 1ISEA 3EQLA 2JA7K 4LR2A 4C45A 2JA5A 1IBAA 3H3VD 1SMYA 3AQOA 5C44K 3ERED 3ADAC 1SFOA 1F7UA 5EGHA 5C4JK 4KN4A 2NVQC 3S1RC 4Q4ZA 3HOVK 1IS1A 3HOZK 2CW0A 1Y1WK 3GTGK 1ZXOA 4C2MK 4LLGA 2R93A 3AQPA 2ZUEA 4KATA 3GTLC 3FOEA 1USMA 2NVXC 5M5XK 3SZYA 4J3NA 3LPXA 1Y1VK 1C0AA 4WILA 3JSTA 3FHZA 4A3IC 4G0VA 4C3IC 1WCMK 3S1MC 3GTKC 5IYDC 2JA7A 3GEHA 2JA6K 1BS2A 4GTFA 3GSIA 3AD7C 3K7AC 5M3MK 2GSOA 2JA5C 2R92K 4C3JC 3HOYK 4A3MC 3IPJA 3GTOC 3A8IA 1ZQ1C 3RZDC 4XLPA 4BBSK 5IP7K 4KMUA 1WSRA 1USOA 1YCLA 4KMDA 1JQWA 3GTGA 3HOWC 5IYCK 4AYBD 3PO3C 4A3GC 1R9TC 4GTDA 2B63K 4YFKA 4OIPA 2P8TA 1Y1VA 1TWCC 5FLMK 3HKZD 4XSXA 4QIWD 4MEXA 1DD5A 3CQZK 2WAQD 1WQGA 2BE5A 1IE0A 1WCMA 4MQ9A 2NVTC 1O27A 1BDFA 4KARA 2PA8D 3RZOK 2E2IC 2R92A 3AD8C 2E2JK 3M4OC 1XXAA 3AD9C 4P5AA 4A3KK 1JVIA 4C3HC 3GTPK 3HXAA 3CAGA 3FKIK 3OPFA 3T01A 3PO2K 3T02A 2WB1L 4G0UA 4A3CK 4P5BA 1EH1A 2E2HC 2B63A 4A3BK 4BY1K 4AH6A 2VUMK 5L46A 3L4KA 3GTQK 1XZQB 2NVYK 4Y7NK 1WIHA 5IYBC 4XLNA 3CQZA 1VJEA 4BBRC 4A3EK 5D4DA 1B4AA 3I4MK 3GIRA 4A93K 2PMZD 1XXCA 1TWAK 2GSUA 3TFHA 1J6VA 1IW7A 1I50K 2GSNA 1I3QK 5CHPA 3MMLB 3A8KA 2YU9C 5FJ8K 4LQYA 3GEEA 4WJ4A 3V4GA 3FKIA 4A3FK 1WQHA 2FQTA 4A3DC 3QX3A 1TWHK 1TWFK 4FZBA 3LAJA 3H0GK 2VUMA 2KWAA 4BXXK 1TWGC 1WOPA 3GTQA 4X6AK 4A3JC 2RH6A 2NVYA 1O26A 3GTMK 3M3YC 4LK0A 3GTJC 2JA8C 4LK1A 1K83C 4GTCA 4QJVA 3S2HC 4GFQA 1ZYRA 4BY7C 4QJVB 3GDZA 5C4XC 1DCPA 1TWAA 2Y0SL 3I4NC 2A6HA 4GTBA 1DCOA 2V6SA 1I50A 5IOTA 1O2AA 1I3QA 3HOUK 1WOOA 4Y52C 2V6UA 3S1NC 3S14K 1PJ5A 1F9NA 4YFXA 1GE9A 1XZPA 3HOXK 1EI6A 1SFOC 4A3LK 3S17K 5TMCA 1TWFA 1VLOA 3H0GA 4KM9A 2XCQA 2O5JA 3S15C 3T00A 1Y1WA 3GTMA 2R7ZK 1IL2A 2A6EA 3S16K 1I6HK 5E68A 2R93C 1WOSA 1KQ4A 4YG2A 1XXBA 5IP9K 4GT9A 3S2DC 4XCHA 3FOFA 3S1QK 3OREA 2D6FC 3AH5A 3VA7A 4GTLA 1PJ6A 1O24A 4DDQA 1BGWA 3TFIA 2WB1D 3L4JA 4GTAA 2JA7C 2JA6A 3N0BA 1XPPA 5C44C 2PPBA 2NVQK 3S1RK 2W7VA 1J98A 5C4JC 1WORA 5JVOA 3S0XA 3HOVC 3GEIA 3HOZC 1UV7A 1I6VA 1Y1WC 3GTGC 3OEPA 4C2MC 3GTLK 5CJ9A 2V6TA 4AYBL 1INNA 4OIRA 2NVXK 1G51A 1EQRA 5IOQA 4OIQA 1Y1VC 1YNJA 4A3IK 3HKZL 4XSZA 4GZYA 4C3IK 5HL8A 3S1MK 3GTKK 1J6WA 2WAQL 5IYDK 1HI9A 2JA5K 3K7AK 1WCMC 4C3JK 4A3MK 2PA8L 2JA6C 3GTOK 3RZDK 2R92C 1O2BA 5TJ3A 1PJ7A 3HOYC 4BBSC 4OIOA 5IP7C 3HOWK 3GTPA 3PO3K 5M3FK 2ZFZA 4A3GK 2JH3A 1R9TK 4LOWA 5IYCC 3GTLA 3G4CA 4Q5SA 1DCHA 2NVXA 2CFAA 2B63C 1TWCK 2EBBA 1O29A 4G7OA 4KDDA 4G7HA 5FLMC 4G0WA 3BUEA 4JK1A 3G4AA 2NVTK 3GTKA 3CQZC 2E2IK 2A68A 3N0CA 4ILDA 2PMZL 1ZVUA 3RZOC 3GTOA 4RMFA 3M4OK 2RGRA 4C3HK 2E2JC 1VH2A 2A69A 4A3KC 3GTPC 4KMAA 1V5VA 1R9TA 3FKIC 3H3VL 2ZUFA 2E2HK 1XZPB 3PO2C 1TWHA 4O2DA 2GAGC 4A3CC 1ZBSA 4A3BC 1TWCA 5TMFA 5IOSA 4BY1C 2VUMC 5IYBK 3GTQC 2NVYC 4P9SA 4YFNA 3SZZA 4BBRK 4Y7NC 4FM9A 5C3EC 4PABA 4KAWX 4KC6A 1WSVA 1EFWA 2E2IA 4A3EC 3I4MC 1O2FB 4NOIA 1BJTA 4A93C 3TFJA
chains in the Genus database with same CATH topology
1IW7A 3HOZC 1TWAC 3GTLK 4AYBL 1I50K 2YU9K 4OIRA 2NVXK 3GTLC 1I3QK 1I50C 2YU9C 5FJ8K 2NVXC 1I3QC 5M5XK 4OIQA 1Y1VK 1YNNA 4LJZA 4A3DK 4A3FK 1Y1VC 4A3DC 1YNJA 4MEYA 4A3IK 3HKZL 4XSZA 1TWHK 4C3IK 4A3FC 4GZYA 3S1MK 1HQMA 4A3IC 1TWFK 3GTKK 1TWHC 1WCMK 2WAQL 1TWGK 5IYDK 3S1MC 1TWFC 3H0GK 1Y1WC 4A3JK 3GTKC 2JA5K 3K7AK 1WCMC 5IYDC 1TWGC 4ZH4A 3GTGC 4BXXK 2JA6K 3H0GC 3M3YK 4X6AK 4A3JC 4C3JK 3K7AC 5M3MK 2JA5C 4A3MK 2R92K 2PA8L 3GTMK 3GTJK 2JA6C 3GTOK 3M3YC 4X6AC 3RZDK 4G7ZA 2JA8K 4LK0A 4A3MC 2R92C 3HOYK 3GTMC 3GTJC 3GTOC 3RZDC 2JA8C 3HOYC 1K83K 4XLPA 4BBSK 5IP7K 4KMUA 4LK1A 3S2HK 4BY7K 1K83C 4BBSC 4OIOA 4QJVA 5C4XK 5IP7C 3S2HC 1ZYRA 3HOWK 4BY7C 4QJVB 5C4XC 3I4NK 3PO3K 5M3FK 3HOWC 2Y0SL 3WODA 4A3GK 5IYCK 1R9TK 4AYBD 3I4NC 3PO3C 2A6HA 5M5YK 4A3GC 3DXJA 5IYCC 1R9TC 4QIWL 4Q5SA 2B63K 4Y52K 3S1NK 4YFKA 2B63C 1TWCK 4OIPA 3HOUK 4Y52C 3S1NC 3S14K 4YFXA 1TWCC 5FLMK 3HOUC 4G7OA 3HKZD 4XSXA 3HOXK 4G7HA 1SFOK 3S14C 4QIWD 4MEXA 5FLMC 3HOXC 3CQZK 1SFOC 2WAQD 4A3LK 4JK1A 3S17K 5TMCA 2NVTK 3CQZC 2BE5A 4A3LC 3S15K 3S17C 4MQ9A 2NVTC 2E2IK 2A68A 2O5JA 1BDFA 2PA8D 3S15C 3RZOK 2E2IC 5C3EK 2PMZL 3RZOC 2R7ZK 2R93K 2A6EA 3S16K 4BXXC 1I6HK 2R7ZC 3M4OK 2R93C 3S16C 1I6HC 4C3HK 2E2JK 4YG2A 4OINA 3S2DK 3M4OC 5IP9K 4A3KK 4KN7A 3GTPK 2E2JC 3S2DC 2Y0SD 2A69A 5IP9C 4A3KC 3S1QK 3GTPC 3FKIK 3PO2K 2O5IA 3S1QC 2WB1L 3FKIC 5M5WK 3H3VL 2E2HK 3PO2C 4A3CK 4A3CC 2E2HC 4A3BK 4BY1K 2VUMK 3EQLA 2JA7K 4A3BC 3GTQK 5TMFA 2WB1D 4BY1C 2VUMC 2NVYK 3H3VD 1SMYA 5IYBK 2JA7C 5C44K 4Y7NK 3GTQC 2NVYC 1XPPA 5IYBC 4YFNA 4BBRK 4XLNA 4Y7NC 5C44C 5C3EC 3S1RK 2PPBA 2NVQK 5C4JK 4BBRC 4KN4A 2NVQC 4A3EK 3S1RC 5D4DA 4Q4ZA 3HOVK 5C4JC 3I4MK 4A3EC 3HOZK 2CW0A 3HOVC 3I4MC 4A93K 2PMZD 1Y1WK 3GTGK 4NOIA 1TWAK 4C2MK 4A93C 1I6VA 4LLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 A;  3HOZ C;  1TWA C;  3GTL K;  4AYB L;  1I50 K;  2YU9 K;  4OIR A;  2NVX K;  3GTL C;  1I3Q K;  1I50 C;  2YU9 C;  5FJ8 K;  2NVX C;  1I3Q C;  5M5X K;  4OIQ A;  1Y1V K;  1YNN A;  4LJZ A;  4A3D K;  4A3F K;  1Y1V C;  4A3D C;  1YNJ A;  4MEY A;  4A3I K;  3HKZ L;  4XSZ A;  1TWH K;  4C3I K;  4A3F C;  4GZY A;  3S1M K;  1HQM A;  4A3I C;  1TWF K;  3GTK K;  1TWH C;  1WCM K;  2WAQ L;  1TWG K;  5IYD K;  3S1M C;  1TWF C;  3H0G K;  1Y1W C;  4A3J K;  3GTK C;  2JA5 K;  3K7A K;  1WCM C;  5IYD C;  1TWG C;  4ZH4 A;  3GTG C;  4BXX K;  2JA6 K;  3H0G C;  3M3Y K;  4X6A K;  4A3J C;  4C3J K;  3K7A C;  5M3M K;  2JA5 C;  4A3M K;  2R92 K;  2PA8 L;  3GTM K;  3GTJ K;  2JA6 C;  3GTO K;  3M3Y C;  4X6A C;  3RZD K;  4G7Z A;  2JA8 K;  4LK0 A;  4A3M C;  2R92 C;  3HOY K;  3GTM C;  3GTJ C;  3GTO C;  3RZD C;  2JA8 C;  3HOY C;  1K83 K;  4XLP A;  4BBS K;  5IP7 K;  4KMU A;  4LK1 A;  3S2H K;  4BY7 K;  1K83 C;  4BBS C;  4OIO A;  4QJV A;  5C4X K;  5IP7 C;  3S2H C;  1ZYR A;  3HOW K;  4BY7 C;  4QJV B;  5C4X C;  3I4N K;  3PO3 K;  5M3F K;  3HOW C;  2Y0S L;  3WOD A;  4A3G K;  5IYC K;  1R9T K;  4AYB D;  3I4N C;  3PO3 C;  2A6H A;  5M5Y K;  4A3G C;  3DXJ A;  5IYC C;  1R9T C;  4QIW L;  4Q5S A;  2B63 K;  4Y52 K;  3S1N K;  4YFK A;  2B63 C;  1TWC K;  4OIP A;  3HOU K;  4Y52 C;  3S1N C;  3S14 K;  4YFX A;  1TWC C;  5FLM K;  3HOU C;  4G7O A;  3HKZ D;  4XSX A;  3HOX K;  4G7H A;  1SFO K;  3S14 C;  4QIW D;  4MEX A;  5FLM C;  3HOX C;  3CQZ K;  1SFO C;  2WAQ D;  4A3L K;  4JK1 A;  3S17 K;  5TMC A;  2NVT K;  3CQZ C;  2BE5 A;  4A3L C;  3S15 K;  3S17 C;  4MQ9 A;  2NVT C;  2E2I K;  2A68 A;  2O5J A;  1BDF A;  2PA8 D;  3S15 C;  3RZO K;  2E2I C;  5C3E K;  2PMZ L;  3RZO C;  2R7Z K;  2R93 K;  2A6E A;  3S16 K;  4BXX C;  1I6H K;  2R7Z C;  3M4O K;  2R93 C;  3S16 C;  1I6H C;  4C3H K;  2E2J K;  4YG2 A;  4OIN A;  3S2D K;  3M4O C;  5IP9 K;  4A3K K;  4KN7 A;  3GTP K;  2E2J C;  3S2D C;  2Y0S D;  2A69 A;  5IP9 C;  4A3K C;  3S1Q K;  3GTP C;  3FKI K;  3PO2 K;  2O5I A;  3S1Q C;  2WB1 L;  3FKI C;  5M5W K;  3H3V L;  2E2H K;  3PO2 C;  4A3C K;  4A3C C;  2E2H C;  4A3B K;  4BY1 K;  2VUM K;  3EQL A;  2JA7 K;  4A3B C;  3GTQ K;  5TMF A;  2WB1 D;  4BY1 C;  2VUM C;  2NVY K;  3H3V D;  1SMY A;  5IYB K;  2JA7 C;  5C44 K;  4Y7N K;  3GTQ C;  2NVY C;  1XPP A;  5IYB C;  4YFN A;  4BBR K;  4XLN A;  4Y7N C;  5C44 C;  5C3E C;  3S1R K;  2PPB A;  2NVQ K;  5C4J K;  4BBR C;  4KN4 A;  2NVQ C;  4A3E K;  3S1R C;  5D4D A;  4Q4Z A;  3HOV K;  5C4J C;  3I4M K;  4A3E C;  3HOZ K;  2CW0 A;  3HOV C;  3I4M C;  4A93 K;  2PMZ D;  1Y1W K;  3GTG K;  4NOI A;  1TWA K;  4C2M K;  4A93 C;  1I6V A;  4LLG A; 
#chains in the Genus database with same CATH topology
 1TWA C;  4KAS A;  2YU9 K;  1O25 A;  3TTG A;  1I50 C;  3A8J A;  1I3Q C;  1F93 A;  4BLB A;  4A3D K;  1YNN A;  4LJZ A;  1RU0 A;  2FQO A;  3BP3 A;  4MEY A;  1O28 A;  1J6X A;  4A3F C;  2E2H A;  1HQM A;  1TWH C;  1TWG K;  3BP8 C;  1TWF C;  4A3J K;  1YX2 A;  2PHC B;  4ZH4 A;  3H0G C;  3M3Y K;  1JOE A;  4BXX C;  1WQF A;  3GTJ K;  4X6A C;  1VRQ C;  1AB4 A;  4BLA A;  4G7Z A;  2JA8 K;  3GTM C;  2R7Z A;  1L0W A;  1K83 K;  1VGX A;  4KM8 A;  3S2H K;  4BY7 K;  4KMH A;  4KB2 A;  5C4X K;  3I4N K;  3WOD A;  2P5M A;  5M5Y K;  3DXJ A;  4QIW L;  2YU9 A;  5JFE A;  4Y52 K;  3S1N K;  3N3Y A;  2XCO A;  1X31 C;  1IQ0 A;  3HOU C;  5EGE A;  1SFO K;  3S14 C;  4BKW A;  3HOX C;  2Y3P A;  3Q3Q A;  3NUH A;  1EK8 A;  4WJ3 M;  4A3L C;  1TWG A;  3S15 K;  3S17 C;  1XZQ A;  4M1X A;  2XCR B;  5C3E K;  3GTJ A;  2R93 K;  4GTE A;  2R7Z C;  3LAP A;  5IOR A;  1K83 A;  3S16 C;  1I6H C;  3S2D K;  4OIN A;  4KN7 A;  4PAA A;  2Y0S D;  5IP9 C;  2CFA B;  4KB4 A;  2O5I A;  3S1Q C;  5M5W K;  1B4B A;  1F7V A;  2GAH C;  1ISE A;  3EQL A;  2JA7 K;  4LR2 A;  4C45 A;  2JA5 A;  1IBA A;  3H3V D;  1SMY A;  3AQO A;  5C44 K;  3ERE D;  3ADA C;  1SFO A;  1F7U A;  5EGH A;  5C4J K;  4KN4 A;  2NVQ C;  3S1R C;  4Q4Z A;  3HOV K;  1IS1 A;  3HOZ K;  2CW0 A;  1Y1W K;  3GTG K;  1ZXO A;  4C2M K;  4LLG A;  2R93 A;  3AQP A;  2ZUE A;  4KAT A;  3GTL C;  3FOE A;  1USM A;  2NVX C;  5M5X K;  3SZY A;  4J3N A;  3LPX A;  1Y1V K;  1C0A A;  4WIL A;  3JST A;  3FHZ A;  4A3I C;  4G0V A;  4C3I C;  1WCM K;  3S1M C;  3GTK C;  5IYD C;  2JA7 A;  3GEH A;  2JA6 K;  1BS2 A;  4GTF A;  3GSI A;  3AD7 C;  3K7A C;  5M3M K;  2GSO A;  2JA5 C;  2R92 K;  4C3J C;  3HOY K;  4A3M C;  3IPJ A;  3GTO C;  3A8I A;  1ZQ1 C;  3RZD C;  4XLP A;  4BBS K;  5IP7 K;  4KMU A;  1WSR A;  1USO A;  1YCL A;  4KMD A;  1JQW A;  3GTG A;  3HOW C;  5IYC K;  4AYB D;  3PO3 C;  4A3G C;  1R9T C;  4GTD A;  2B63 K;  4YFK A;  4OIP A;  2P8T A;  1Y1V A;  1TWC C;  5FLM K;  3HKZ D;  4XSX A;  4QIW D;  4MEX A;  1DD5 A;  3CQZ K;  2WAQ D;  1WQG A;  2BE5 A;  1IE0 A;  1WCM A;  4MQ9 A;  2NVT C;  1O27 A;  1BDF A;  4KAR A;  2PA8 D;  3RZO K;  2E2I C;  2R92 A;  3AD8 C;  2E2J K;  3M4O C;  1XXA A;  3AD9 C;  4P5A A;  4A3K K;  1JVI A;  4C3H C;  3GTP K;  3HXA A;  3CAG A;  3FKI K;  3OPF A;  3T01 A;  3PO2 K;  3T02 A;  2WB1 L;  4G0U A;  4A3C K;  4P5B A;  1EH1 A;  2E2H C;  2B63 A;  4A3B K;  4BY1 K;  4AH6 A;  2VUM K;  5L46 A;  3L4K A;  3GTQ K;  1XZQ B;  2NVY K;  4Y7N K;  1WIH A;  5IYB C;  4XLN A;  3CQZ A;  1VJE A;  4BBR C;  4A3E K;  5D4D A;  1B4A A;  3I4M K;  3GIR A;  4A93 K;  2PMZ D;  1XXC A;  1TWA K;  2GSU A;  3TFH A;  1J6V A;  1IW7 A;  1I50 K;  2GSN A;  1I3Q K;  5CHP A;  3MML B;  3A8K A;  2YU9 C;  5FJ8 K;  4LQY A;  3GEE A;  4WJ4 A;  3V4G A;  3FKI A;  4A3F K;  1WQH A;  2FQT A;  4A3D C;  3QX3 A;  1TWH K;  1TWF K;  4FZB A;  3LAJ A;  3H0G K;  2VUM A;  2KWA A;  4BXX K;  1TWG C;  1WOP A;  3GTQ A;  4X6A K;  4A3J C;  2RH6 A;  2NVY A;  1O26 A;  3GTM K;  3M3Y C;  4LK0 A;  3GTJ C;  2JA8 C;  4LK1 A;  1K83 C;  4GTC A;  4QJV A;  3S2H C;  4GFQ A;  1ZYR A;  4BY7 C;  4QJV B;  3GDZ A;  5C4X C;  1DCP A;  1TWA A;  2Y0S L;  3I4N C;  2A6H A;  4GTB A;  1DCO A;  2V6S A;  1I50 A;  5IOT A;  1O2A A;  1I3Q A;  3HOU K;  1WOO A;  4Y52 C;  2V6U A;  3S1N C;  3S14 K;  1PJ5 A;  1F9N A;  4YFX A;  1GE9 A;  1XZP A;  3HOX K;  1EI6 A;  1SFO C;  4A3L K;  3S17 K;  5TMC A;  1TWF A;  1VLO A;  3H0G A;  4KM9 A;  2XCQ A;  2O5J A;  3S15 C;  3T00 A;  1Y1W A;  3GTM A;  2R7Z K;  1IL2 A;  2A6E A;  3S16 K;  1I6H K;  5E68 A;  2R93 C;  1WOS A;  1KQ4 A;  4YG2 A;  1XXB A;  5IP9 K;  4GT9 A;  3S2D C;  4XCH A;  3FOF A;  3S1Q K;  3ORE A;  2D6F C;  3AH5 A;  3VA7 A;  4GTL A;  1PJ6 A;  1O24 A;  4DDQ A;  1BGW A;  3TFI A;  2WB1 D;  3L4J A;  4GTA A;  2JA7 C;  2JA6 A;  3N0B A;  1XPP A;  5C44 C;  2PPB A;  2NVQ K;  3S1R K;  2W7V A;  1J98 A;  5C4J C;  1WOR A;  5JVO A;  3S0X A;  3HOV C;  3GEI A;  3HOZ C;  1UV7 A;  1I6V A;  1Y1W C;  3GTG C;  3OEP A;  4C2M C;  3GTL K;  5CJ9 A;  2V6T A;  4AYB L;  1INN A;  4OIR A;  2NVX K;  1G51 A;  1EQR A;  5IOQ A;  4OIQ A;  1Y1V C;  1YNJ A;  4A3I K;  3HKZ L;  4XSZ A;  4GZY A;  4C3I K;  5HL8 A;  3S1M K;  3GTK K;  1J6W A;  2WAQ L;  5IYD K;  1HI9 A;  2JA5 K;  3K7A K;  1WCM C;  4C3J K;  4A3M K;  2PA8 L;  2JA6 C;  3GTO K;  3RZD K;  2R92 C;  1O2B A;  5TJ3 A;  1PJ7 A;  3HOY C;  4BBS C;  4OIO A;  5IP7 C;  3HOW K;  3GTP A;  3PO3 K;  5M3F K;  2ZFZ A;  4A3G K;  2JH3 A;  1R9T K;  4LOW A;  5IYC C;  3GTL A;  3G4C A;  4Q5S A;  1DCH A;  2NVX A;  2CFA A;  2B63 C;  1TWC K;  2EBB A;  1O29 A;  4G7O A;  4KDD A;  4G7H A;  5FLM C;  4G0W A;  3BUE A;  4JK1 A;  3G4A A;  2NVT K;  3GTK A;  3CQZ C;  2E2I K;  2A68 A;  3N0C A;  4ILD A;  2PMZ L;  1ZVU A;  3RZO C;  3GTO A;  4RMF A;  3M4O K;  2RGR A;  4C3H K;  2E2J C;  1VH2 A;  2A69 A;  4A3K C;  3GTP C;  4KMA A;  1V5V A;  1R9T A;  3FKI C;  3H3V L;  2ZUF A;  2E2H K;  1XZP B;  3PO2 C;  1TWH A;  4O2D A;  2GAG C;  4A3C C;  1ZBS A;  4A3B C;  1TWC A;  5TMF A;  5IOS A;  4BY1 C;  2VUM C;  5IYB K;  3GTQ C;  2NVY C;  4P9S A;  4YFN A;  3SZZ A;  4BBR K;  4Y7N C;  4FM9 A;  5C3E C;  4PAB A;  4KAW X;  4KC6 A;  1WSV A;  1EFW A;  2E2I A;  4A3E C;  3I4M C;  1O2F B;  4NOI A;  1BJT A;  4A93 C;  3TFJ A; 
#chains in the Genus database with same CATH homology
 1IW7 A;  3HOZ C;  1TWA C;  3GTL K;  4AYB L;  1I50 K;  2YU9 K;  4OIR A;  2NVX K;  3GTL C;  1I3Q K;  1I50 C;  2YU9 C;  5FJ8 K;  2NVX C;  1I3Q C;  5M5X K;  4OIQ A;  1Y1V K;  1YNN A;  4LJZ A;  4A3D K;  4A3F K;  1Y1V C;  4A3D C;  1YNJ A;  4MEY A;  4A3I K;  3HKZ L;  4XSZ A;  1TWH K;  4C3I K;  4A3F C;  4GZY A;  3S1M K;  1HQM A;  4A3I C;  1TWF K;  3GTK K;  1TWH C;  1WCM K;  2WAQ L;  1TWG K;  5IYD K;  3S1M C;  1TWF C;  3H0G K;  1Y1W C;  4A3J K;  3GTK C;  2JA5 K;  3K7A K;  1WCM C;  5IYD C;  1TWG C;  4ZH4 A;  3GTG C;  4BXX K;  2JA6 K;  3H0G C;  3M3Y K;  4X6A K;  4A3J C;  4C3J K;  3K7A C;  5M3M K;  2JA5 C;  4A3M K;  2R92 K;  2PA8 L;  3GTM K;  3GTJ K;  2JA6 C;  3GTO K;  3M3Y C;  4X6A C;  3RZD K;  4G7Z A;  2JA8 K;  4LK0 A;  4A3M C;  2R92 C;  3HOY K;  3GTM C;  3GTJ C;  3GTO C;  3RZD C;  2JA8 C;  3HOY C;  1K83 K;  4XLP A;  4BBS K;  5IP7 K;  4KMU A;  4LK1 A;  3S2H K;  4BY7 K;  1K83 C;  4BBS C;  4OIO A;  4QJV A;  5C4X K;  5IP7 C;  3S2H C;  1ZYR A;  3HOW K;  4BY7 C;  4QJV B;  5C4X C;  3I4N K;  3PO3 K;  5M3F K;  3HOW C;  2Y0S L;  3WOD A;  4A3G K;  5IYC K;  1R9T K;  4AYB D;  3I4N C;  3PO3 C;  2A6H A;  5M5Y K;  4A3G C;  3DXJ A;  5IYC C;  1R9T C;  4QIW L;  4Q5S A;  2B63 K;  4Y52 K;  3S1N K;  4YFK A;  2B63 C;  1TWC K;  4OIP A;  3HOU K;  4Y52 C;  3S1N C;  3S14 K;  4YFX A;  1TWC C;  5FLM K;  3HOU C;  4G7O A;  3HKZ D;  4XSX A;  3HOX K;  4G7H A;  1SFO K;  3S14 C;  4QIW D;  4MEX A;  5FLM C;  3HOX C;  3CQZ K;  1SFO C;  2WAQ D;  4A3L K;  4JK1 A;  3S17 K;  5TMC A;  2NVT K;  3CQZ C;  2BE5 A;  4A3L C;  3S15 K;  3S17 C;  4MQ9 A;  2NVT C;  2E2I K;  2A68 A;  2O5J A;  1BDF A;  2PA8 D;  3S15 C;  3RZO K;  2E2I C;  5C3E K;  2PMZ L;  3RZO C;  2R7Z K;  2R93 K;  2A6E A;  3S16 K;  4BXX C;  1I6H K;  2R7Z C;  3M4O K;  2R93 C;  3S16 C;  1I6H C;  4C3H K;  2E2J K;  4YG2 A;  4OIN A;  3S2D K;  3M4O C;  5IP9 K;  4A3K K;  4KN7 A;  3GTP K;  2E2J C;  3S2D C;  2Y0S D;  2A69 A;  5IP9 C;  4A3K C;  3S1Q K;  3GTP C;  3FKI K;  3PO2 K;  2O5I A;  3S1Q C;  2WB1 L;  3FKI C;  5M5W K;  3H3V L;  2E2H K;  3PO2 C;  4A3C K;  4A3C C;  2E2H C;  4A3B K;  4BY1 K;  2VUM K;  3EQL A;  2JA7 K;  4A3B C;  3GTQ K;  5TMF A;  2WB1 D;  4BY1 C;  2VUM C;  2NVY K;  3H3V D;  1SMY A;  5IYB K;  2JA7 C;  5C44 K;  4Y7N K;  3GTQ C;  2NVY C;  1XPP A;  5IYB C;  4YFN A;  4BBR K;  4XLN A;  4Y7N C;  5C44 C;  5C3E C;  3S1R K;  2PPB A;  2NVQ K;  5C4J K;  4BBR C;  4KN4 A;  2NVQ C;  4A3E K;  3S1R C;  5D4D A;  4Q4Z A;  3HOV K;  5C4J C;  3I4M K;  4A3E C;  3HOZ K;  2CW0 A;  3HOV C;  3I4M C;  4A93 K;  2PMZ D;  1Y1W K;  3GTG K;  4NOI A;  1TWA K;  4C2M K;  4A93 C;  1I6V A;  4LLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...