1DCOA

Dcoh, a bifunctional protein-binding transcriptional coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCOH
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcoA00
2EBBA 1F93A 1DCHA 3HXAA 4WILA 4LOWA 3JSTA 2V6SA 1DCPA 2V6TA 1USMA 1DCOA 4C45A 1USOA 2V6UA 1RU0A
chains in the Genus database with same CATH superfamily
1F9NA 1O28A 4BLBA 3GTGK 4BXXC 3HOUC 4J3NA 2JA6K 3RZDK 1HQMA 2A6HA 1IBAA 4KM9A 2GSNA 3ADAC 3G4CA 3FKIK 4AYBD 1WCMC 1ZYRA 4A3BK 4QIWL 1WQFA 4LR2A 2JA5K 3HOVC 4LLGA 4MQ9A 3AD8C 3MMLB 1YCLA 3CQZC 1TWAA 3GTMK 4C3HK 3S16C 1WOOA 4BY1C 3I4MK 4WJ3M 2R92A 2B63K 5IYBK 5HL8A 2VUMA 4G7OA 3M3YK 2VUMK 1JVIA 3GTOK 3OREA 5IP9C 2GSUA 2JA8C 1TWCK 5C4XC 2GSOA 4M1XA 5IOSA 3AH5A 4ZH4A 1ZQ1C 2E2HA 4BBRC 3LPXA 5JVOA 2E2HK 2W7VA 1TWFK 4XLPA 3WODA 4LK1A 2XCOA 3S14C 2CFAA 4ILDA 1JOEA 2CFAB 4Y7NK 3GTLK 1VH2A 1J98A 3GTPA 4OINA 1I6HK 4LJZA 2O5JA 2R7ZC 4X6AC 1B4AA 1WOSA 1O25A 3GTPC 1YX2A 3A8JA 3S1MK 2E2IK 3TFHA 3S2HC 4WILA 2BE5A 1BJTA 4GTFA 5IYCC 2NVYK 3PO3K 3S17K 2EBBA 4A3IC 5IYDK 4KARA 3GEHA 4G0VA 1Y1VA 4KB4A 3L4KA 3EQLA 2E2JK 1Y1WA 2NVQK 1UV7A 3AQOA 3GDZA 1B4BA 2ZUFA 3IPJA 3GTJA 3HOWK 4A93K 1SMYA 2A6EA 3S1RK 3HOYC 3RZOK 3GTJC 4A3FK 5IP7K 3HOXC 1ZBSA 3CAGA 4Q5SA 3DXJA 1EQRA 2PA8L 2PHCB 5M5WK 2WB1D 1O29A 1R9TK 5TMCA 1USMA 3N0CA 2JA7K 4GTCA 3BUEA 4AH6A 1VJEA 2YU9A 1J6WA 4KMAA 2WAQD 4Q4ZA 4A3JC 3GTGA 2YU9K 2JA6A 4BLAA 2Y3PA 1TWGC 4GFQA 3FOEA 3GTGC 2NVXK 2JA6C 1WORA 5FLMK 1HI9A 3I4NK 3FKIA 5C4JK 4A3KK 3GSIA 3FKIC 3GTKK 1O2FB 3LAJA 1DCOA 1C0AA 2JA5A 4A3BC 4BXXK 2JA5C 3TFIA 3FOFA 1WSRA 1O24A 3BP8C 5C44C 3GTMA 4QJVA 4P9SA 3ERED 4BBSK 1WCMK 1XZQA 4O2DA 1O2AA 4C3HC 1TWAC 2B63A 4A3DK 3AD9C 3T02A 1I6VA 2B63C 2NVTK 1VGXA 5IYBC 3S2DK 1SFOK 2R92C 2PA8D 4JK1A 3GTOA 1I50K 3M3YC 1TWCA 2VUMC 1PJ6A 3GTOC 3CQZK 1PJ7A 1ZVUA 1K83K 3G4AA 1TWCC 3S16K 4OIOA 3K7AK 3T01A 1TWHK 2V6SA 5M3MK 3GTQK 1TWFA 5C3EK 2E2HC 3H0GA 4A3CK 3H0GK 2WB1L 1IS1A 4G0UA 5IP9K 4KMDA 5C4XK 5JFEA 4C45A 5IORA 3GTLA 3LAPA 4A3GK 1XXCA 1XXAA 2WAQL 1IW7A 4BY7K 2A69A 3M4OK 5EGEA 4G0WA 2E2IA 2P5MA 3S14K 1YNNA 2E2IC 2GAGC 2R93K 3HOZC 1G51A 2NVYA 3PO2K 1KQ4A 5L46A 1F7UA 4X6AK 3S15K 2NVYC 1XXBA 3T00A 2O5IA 4A3MK 3A8IA 5E68A 5IYDC 1V5VA 4MEYA 4OIRA 1Y1VC 5TJ3A 2V6UA 4YFXA 2PMZL 3H3VL 2E2JC 3S2HK 1WIHA 1Y1WC 4XSXA 4A93C 4C2MK 1VRQC 3S1RC 5CJ9A 4A3IK 3RZOC 3S1QC 3VA7A 4KN7A 4GT9A 1R9TA 4Y52C 3V4GA 2JA7A 4BKWA 4KM8A 5M5XK 4YFNA 2CW0A 4WJ4A 3OEPA 2V6TA 4NOIA 3HOYK 3L4JA 3HOXK 1ISEA 4A3LC 3QX3A 4C3IC 2FQTA 2GAHC 2YU9C 2NVXA 5IOQA 3S0XA 2ZFZA 2ZUEA 1VLOA 4MEXA 3RZDC 4A3EK 3N3YA 4KATA 3S1NK 3AQPA 3I4NC 2D6FC 4GTBA 4LOWA 1EFWA 3GTKA 5C4JC 4A3KC 4C3JK 1J6XA 4YG2A 5TMFA 2KWAA 4KMUA 4XSZA 3GTKC 1I3QK 4A3JK 3HOUK 4GTEA 1TWGK 4KAWX 2PMZD 3H3VD 1WOPA 1WCMA 4QJVB 4XLNA 1XZQB 4BBSC 3GTMC 1WQHA 1O26A 3HKZD 4A3DC 3I4MC 4KB2A 3HOVK 1SFOA 3FHZA 1XZPA 1XZPB 2Y0SL 4GTAA 1I50A 5D4DA 2NVTC 3S2DC 1DD5A 1SFOC 3CQZA 5FJ8K 4RMFA 1K83A 1I50C 5C44K 4BY1K 1K83C 1TWHA 1TWAK 3GIRA 3GTQA 3K7AC 1TWHC 1GE9A 4LQYA 3GTQC 2R92K 1IL2A 1JQWA 3Q3QA 1WSVA 1O27A 1BGWA 2RH6A 4OIPA 5M5YK 5C3EC 1TWFC 2JA8K 4PABA 2RGRA 1J6VA 1X31C 4KC6A 4A3CC 3H0GC 1YNJA 4FZBA 4GTDA 1IQ0A 1PJ5A 4Y7NC 3GTLC 4BBRK 3N0BA 2FQOA 4LK0A 4A3GC 1F93A 1I6HC 1EH1A 4BY7C 3M4OC 3TTGA 2R93A 3S1MC 2A68A 1USOA 3SZZA 3BP3A 2R93C 1DCHA 2P8TA 2R7ZA 3PO2C 4QIWD 4GTLA 2R7ZK 3PO3C 1L0WA 4KDDA 3TFJA 3S17C 3A8KA 3S15C 2Y0SD 5IOTA 5M3FK 3GTPK 4A3MC 4DDQA 4YFKA 1EI6A 4P5BA 4GZYA 3HXAA 1ZXOA 2NVQC 1DCPA 3HOZK 4KN4A 1XPPA 3GEIA 3HOWC 5IYCK 4PAAA 4AYBL 2JH3A 3HKZL 3NUHA 5EGHA 4C2MC 4A3FC 5IP7C 4FM9A 3AD7C 1Y1VK 1EK8A 1AB4A 1BDFA 1F7VA 1R9TC 4KMHA 1Y1WK 2JA7C 4G7HA 2XCRB 1INNA 3GTJK 3JSTA 3S1QK 1RU0A 4OIQA 3SZYA 3OPFA 4G7ZA 1WQGA 2XCQA 4Y52K 1O2BA 4XCHA 3GEEA 2NVXC 4P5AA 5FLMC 1IE0A 4A3EC 5CHPA 1BS2A 3S1NC 1I3QA 4A3LK 4C3JC 2PPBA 4KASA 1TWGA 1I3QC 4C3IK
chains in the Genus database with same CATH topology
2EBBA 1F93A 1DCHA 3HXAA 4WILA 4LOWA 3JSTA 2V6SA 1DCPA 2V6TA 1USMA 1DCOA 4C45A 1USOA 2V6UA 1RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBB A;  1F93 A;  1DCH A;  3HXA A;  4WIL A;  4LOW A;  3JST A;  2V6S A;  1DCP A;  2V6T A;  1USM A;  1DCO A;  4C45 A;  1USO A;  2V6U A;  1RU0 A; 
#chains in the Genus database with same CATH topology
 1F9N A;  1O28 A;  4BLB A;  3GTG K;  4BXX C;  3HOU C;  4J3N A;  2JA6 K;  3RZD K;  1HQM A;  2A6H A;  1IBA A;  4KM9 A;  2GSN A;  3ADA C;  3G4C A;  3FKI K;  4AYB D;  1WCM C;  1ZYR A;  4A3B K;  4QIW L;  1WQF A;  4LR2 A;  2JA5 K;  3HOV C;  4LLG A;  4MQ9 A;  3AD8 C;  3MML B;  1YCL A;  3CQZ C;  1TWA A;  3GTM K;  4C3H K;  3S16 C;  1WOO A;  4BY1 C;  3I4M K;  4WJ3 M;  2R92 A;  2B63 K;  5IYB K;  5HL8 A;  2VUM A;  4G7O A;  3M3Y K;  2VUM K;  1JVI A;  3GTO K;  3ORE A;  5IP9 C;  2GSU A;  2JA8 C;  1TWC K;  5C4X C;  2GSO A;  4M1X A;  5IOS A;  3AH5 A;  4ZH4 A;  1ZQ1 C;  2E2H A;  4BBR C;  3LPX A;  5JVO A;  2E2H K;  2W7V A;  1TWF K;  4XLP A;  3WOD A;  4LK1 A;  2XCO A;  3S14 C;  2CFA A;  4ILD A;  1JOE A;  2CFA B;  4Y7N K;  3GTL K;  1VH2 A;  1J98 A;  3GTP A;  4OIN A;  1I6H K;  4LJZ A;  2O5J A;  2R7Z C;  4X6A C;  1B4A A;  1WOS A;  1O25 A;  3GTP C;  1YX2 A;  3A8J A;  3S1M K;  2E2I K;  3TFH A;  3S2H C;  4WIL A;  2BE5 A;  1BJT A;  4GTF A;  5IYC C;  2NVY K;  3PO3 K;  3S17 K;  2EBB A;  4A3I C;  5IYD K;  4KAR A;  3GEH A;  4G0V A;  1Y1V A;  4KB4 A;  3L4K A;  3EQL A;  2E2J K;  1Y1W A;  2NVQ K;  1UV7 A;  3AQO A;  3GDZ A;  1B4B A;  2ZUF A;  3IPJ A;  3GTJ A;  3HOW K;  4A93 K;  1SMY A;  2A6E A;  3S1R K;  3HOY C;  3RZO K;  3GTJ C;  4A3F K;  5IP7 K;  3HOX C;  1ZBS A;  3CAG A;  4Q5S A;  3DXJ A;  1EQR A;  2PA8 L;  2PHC B;  5M5W K;  2WB1 D;  1O29 A;  1R9T K;  5TMC A;  1USM A;  3N0C A;  2JA7 K;  4GTC A;  3BUE A;  4AH6 A;  1VJE A;  2YU9 A;  1J6W A;  4KMA A;  2WAQ D;  4Q4Z A;  4A3J C;  3GTG A;  2YU9 K;  2JA6 A;  4BLA A;  2Y3P A;  1TWG C;  4GFQ A;  3FOE A;  3GTG C;  2NVX K;  2JA6 C;  1WOR A;  5FLM K;  1HI9 A;  3I4N K;  3FKI A;  5C4J K;  4A3K K;  3GSI A;  3FKI C;  3GTK K;  1O2F B;  3LAJ A;  1DCO A;  1C0A A;  2JA5 A;  4A3B C;  4BXX K;  2JA5 C;  3TFI A;  3FOF A;  1WSR A;  1O24 A;  3BP8 C;  5C44 C;  3GTM A;  4QJV A;  4P9S A;  3ERE D;  4BBS K;  1WCM K;  1XZQ A;  4O2D A;  1O2A A;  4C3H C;  1TWA C;  2B63 A;  4A3D K;  3AD9 C;  3T02 A;  1I6V A;  2B63 C;  2NVT K;  1VGX A;  5IYB C;  3S2D K;  1SFO K;  2R92 C;  2PA8 D;  4JK1 A;  3GTO A;  1I50 K;  3M3Y C;  1TWC A;  2VUM C;  1PJ6 A;  3GTO C;  3CQZ K;  1PJ7 A;  1ZVU A;  1K83 K;  3G4A A;  1TWC C;  3S16 K;  4OIO A;  3K7A K;  3T01 A;  1TWH K;  2V6S A;  5M3M K;  3GTQ K;  1TWF A;  5C3E K;  2E2H C;  3H0G A;  4A3C K;  3H0G K;  2WB1 L;  1IS1 A;  4G0U A;  5IP9 K;  4KMD A;  5C4X K;  5JFE A;  4C45 A;  5IOR A;  3GTL A;  3LAP A;  4A3G K;  1XXC A;  1XXA A;  2WAQ L;  1IW7 A;  4BY7 K;  2A69 A;  3M4O K;  5EGE A;  4G0W A;  2E2I A;  2P5M A;  3S14 K;  1YNN A;  2E2I C;  2GAG C;  2R93 K;  3HOZ C;  1G51 A;  2NVY A;  3PO2 K;  1KQ4 A;  5L46 A;  1F7U A;  4X6A K;  3S15 K;  2NVY C;  1XXB A;  3T00 A;  2O5I A;  4A3M K;  3A8I A;  5E68 A;  5IYD C;  1V5V A;  4MEY A;  4OIR A;  1Y1V C;  5TJ3 A;  2V6U A;  4YFX A;  2PMZ L;  3H3V L;  2E2J C;  3S2H K;  1WIH A;  1Y1W C;  4XSX A;  4A93 C;  4C2M K;  1VRQ C;  3S1R C;  5CJ9 A;  4A3I K;  3RZO C;  3S1Q C;  3VA7 A;  4KN7 A;  4GT9 A;  1R9T A;  4Y52 C;  3V4G A;  2JA7 A;  4BKW A;  4KM8 A;  5M5X K;  4YFN A;  2CW0 A;  4WJ4 A;  3OEP A;  2V6T A;  4NOI A;  3HOY K;  3L4J A;  3HOX K;  1ISE A;  4A3L C;  3QX3 A;  4C3I C;  2FQT A;  2GAH C;  2YU9 C;  2NVX A;  5IOQ A;  3S0X A;  2ZFZ A;  2ZUE A;  1VLO A;  4MEX A;  3RZD C;  4A3E K;  3N3Y A;  4KAT A;  3S1N K;  3AQP A;  3I4N C;  2D6F C;  4GTB A;  4LOW A;  1EFW A;  3GTK A;  5C4J C;  4A3K C;  4C3J K;  1J6X A;  4YG2 A;  5TMF A;  2KWA A;  4KMU A;  4XSZ A;  3GTK C;  1I3Q K;  4A3J K;  3HOU K;  4GTE A;  1TWG K;  4KAW X;  2PMZ D;  3H3V D;  1WOP A;  1WCM A;  4QJV B;  4XLN A;  1XZQ B;  4BBS C;  3GTM C;  1WQH A;  1O26 A;  3HKZ D;  4A3D C;  3I4M C;  4KB2 A;  3HOV K;  1SFO A;  3FHZ A;  1XZP A;  1XZP B;  2Y0S L;  4GTA A;  1I50 A;  5D4D A;  2NVT C;  3S2D C;  1DD5 A;  1SFO C;  3CQZ A;  5FJ8 K;  4RMF A;  1K83 A;  1I50 C;  5C44 K;  4BY1 K;  1K83 C;  1TWH A;  1TWA K;  3GIR A;  3GTQ A;  3K7A C;  1TWH C;  1GE9 A;  4LQY A;  3GTQ C;  2R92 K;  1IL2 A;  1JQW A;  3Q3Q A;  1WSV A;  1O27 A;  1BGW A;  2RH6 A;  4OIP A;  5M5Y K;  5C3E C;  1TWF C;  2JA8 K;  4PAB A;  2RGR A;  1J6V A;  1X31 C;  4KC6 A;  4A3C C;  3H0G C;  1YNJ A;  4FZB A;  4GTD A;  1IQ0 A;  1PJ5 A;  4Y7N C;  3GTL C;  4BBR K;  3N0B A;  2FQO A;  4LK0 A;  4A3G C;  1F93 A;  1I6H C;  1EH1 A;  4BY7 C;  3M4O C;  3TTG A;  2R93 A;  3S1M C;  2A68 A;  1USO A;  3SZZ A;  3BP3 A;  2R93 C;  1DCH A;  2P8T A;  2R7Z A;  3PO2 C;  4QIW D;  4GTL A;  2R7Z K;  3PO3 C;  1L0W A;  4KDD A;  3TFJ A;  3S17 C;  3A8K A;  3S15 C;  2Y0S D;  5IOT A;  5M3F K;  3GTP K;  4A3M C;  4DDQ A;  4YFK A;  1EI6 A;  4P5B A;  4GZY A;  3HXA A;  1ZXO A;  2NVQ C;  1DCP A;  3HOZ K;  4KN4 A;  1XPP A;  3GEI A;  3HOW C;  5IYC K;  4PAA A;  4AYB L;  2JH3 A;  3HKZ L;  3NUH A;  5EGH A;  4C2M C;  4A3F C;  5IP7 C;  4FM9 A;  3AD7 C;  1Y1V K;  1EK8 A;  1AB4 A;  1BDF A;  1F7V A;  1R9T C;  4KMH A;  1Y1W K;  2JA7 C;  4G7H A;  2XCR B;  1INN A;  3GTJ K;  3JST A;  3S1Q K;  1RU0 A;  4OIQ A;  3SZY A;  3OPF A;  4G7Z A;  1WQG A;  2XCQ A;  4Y52 K;  1O2B A;  4XCH A;  3GEE A;  2NVX C;  4P5A A;  5FLM C;  1IE0 A;  4A3E C;  5CHP A;  1BS2 A;  3S1N C;  1I3Q A;  4A3L K;  4C3J C;  2PPB A;  4KAS A;  1TWG A;  1I3Q C;  4C3I K; 
#chains in the Genus database with same CATH homology
 2EBB A;  1F93 A;  1DCH A;  3HXA A;  4WIL A;  4LOW A;  3JST A;  2V6S A;  1DCP A;  2V6T A;  1USM A;  1DCO A;  4C45 A;  1USO A;  2V6U A;  1RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...