1DCOA

Dcoh, a bifunctional protein-binding transcriptional coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCOH
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcoA00
1USOA 2V6SA 1RU0A 1F93A 3JSTA 4C45A 2V6UA 2V6TA 3HXAA 1DCPA 4LOWA 1DCOA 2EBBA 1USMA 4WILA 1DCHA
chains in the Genus database with same CATH superfamily
4KATA 1WSRA 5IP9K 4X6AC 1XZPB 4LR2A 3BP8C 1XXBA 4Q4ZA 3HXAA 2NVYC 3MMLB 4BY1C 3TFHA 5L46A 5JVOA 3GTMC 2JA7K 5C4JK 4OINA 1BDFA 3S14K 3CQZC 1TWHK 2JA6K 4BY7C 3FKIA 2BE5A 3GTQA 1IL2A 3GSIA 4OIRA 1TWCA 1J6XA 1TWGK 1TWGA 1WOOA 3S17K 1JQWA 1V5VA 5EGHA 3GTKA 2KWAA 2PMZD 1USMA 2JA7C 5C4JC 3S14C 1J98A 3AD9C 1TWHC 2JA6C 1O29A 4KMUA 1DCPA 3GIRA 2D6FC 4A3BK 2V6UA 3S1NK 1TWGC 1YX2A 4FM9A 3S17C 4YFNA 3EQLA 1WQGA 2XCRB 1SFOK 1SFOA 1VLOA 1Y1VK 3DXJA 2Y0SL 3GTOA 4A3CK 2R92K 4C3JK 4AYBL 4A3BC 2W7VA 3ERED 3S1NC 3A8KA 3N3YA 5C4XK 4BLBA 5CHPA 1WQHA 3T00A 4XSZA 1Y1WK 4P5BA 3T02A 1ZQ1C 4QIWD 1R9TK 4KMHA 1SFOC 4WILA 1Y1VC 4WJ3M 1PJ6A 2WAQD 2R92C 4C3JC 2VUMA 1J6WA 3LPXA 4A3EK 5C4XC 4AH6A 3GTLK 3GTLA 4YFKA 2FQOA 3RZOC 3S1MK 1USOA 4JK1A 1Y1WC 2JA5K 5IORA 1R9TC 1O27A 2R7ZK 2E2IK 2PPBA 4Y7NK 2E2IA 1PJ7A 2R93A 4A3DK 3H3VL 4ILDA 3GTGK 3GTGA 3HKZL 4A3EC 1C0AA 4GTEA 3GTLC 1ZXOA 4MEYA 1EI6A 5C3EK 2XCOA 3G4AA 3HOYK 3S1MC 3N0CA 1VGXA 2JA5C 2R7ZC 1TWFA 4KM9A 3Q3QA 4OIPA 1WCMC 4A3DC 1BS2A 2GSNA 1O2FB 1K83K 5C3EC 1TWAK 1PJ5A 3HOYC 3S2HK 1L0WA 4M1XA 1XZQA 2NVYA 1IBAA 1WSVA 2P5MA 5EGEA 4ZH4A 4Y52K 3CQZA 5D4DA 3LAJA 4GTCA 2E2HK 2CFAB 2FQTA 1K83C 1TWAC 4KB2A 3S2HC 1BGWA 2A6HA 4G0UA 1ZVUA 1EQRA 1F93A 4Y52C 1UV7A 3K7AC 2JA7A 3HOUK 4QJVA 3L4KA 1TWHA 2JA6A 1IQ0A 3GTJK 3PO3K 4A3GK 3TTGA 2V6TA 2E2HC 4GT9A 4A3IK 1XXCA 5M3MK 4KMAA 1O26A 3S16K 1JVIA 1EFWA 3M4OK 4Q5SA 2P8TA 3V4GA 3AQPA 2ZUEA 4KN7A 2O5JA 2NVTK 3HOUC 4J3NA 1WIHA 3SZYA 3GTJC 3PO3C 4A3GC 3AH5A 4KC6A 2PA8D 2A68A 5IOTA 4G7OA 4A3IC 2RGRA 3HKZD 3S16C 3M4OC 3JSTA 4G7HA 3G4CA 1I6HK 3CAGA 3TFJA 5IP7K 2NVTC 1O28A 2WB1D 1X31C 1BJTA 1Y1VA 3TFIA 4LJZA 2R92A 1IE0A 3OEPA 3HOZK 1IW7A 3RZOK 3I4MK 1Y1WA 1VJEA 3M3YK 1I6HC 2EBBA 4MEXA 2Y3PA 1VRQC 3SZZA 1R9TA 5IP7C 1ZYRA 4GTLA 4FZBA 3S1RK 5IYCK 4A3LK 3HOWK 3AQOA 2A69A 4A93K 3HOZC 3QX3A 1I50K 1EK8A 3I4MC 1IS1A 3M3YC 2JA5A 1YNNA 3S2DK 1DCHA 4KAWX 3GTPK 2R7ZA 4BBSK 3H0GC 4A3MK 4BLAA 1WCMK 1WCMA 3S1RC 5IYCC 4A3LC 3HOWC 1AB4A 4PABA 4A93C 3S0XA 4XSXA 1I50C 4WJ4A 1XPPA 1O24A 3S2DC 2PMZL 3GTPC 4BBSC 4A3MC 3FOFA 2GAGC 2XCQA 4LQYA 4GFQA 1I3QK 5CJ9A 5TMCA 2YU9C 1YNJA 1K83A 1TWAA 4KARA 5HL8A 4GTFA 3HOVK 1B4AA 3K7AK 3FOEA 4LK0A 4A3KK 1EH1A 1I3QC 2Y0SD 2E2HA 4GTBA 4AYBD 3L4JA 4C3HK 1XZPA 4KMDA 3IPJA 2NVXK 3HOVC 4O2DA 5TJ3A 4MQ9A 4KN4A 3S1QK 5IOSA 3GTJA 2JH3A 3VA7A 4A3KC 1O2BA 1GE9A 1HQMA 2ZUFA 4P9SA 1DD5A 4C3HC 4LOWA 4G0VA 2NVXC 1J6VA 3PO2K 3FHZA 4A3FC 5IYBK 4QJVB 2B63K 4C2MK 3S1QC 2B63A 1WORA 4KM8A 2PHCB 3FKIK 2GSUA 3GTQK 3H3VD 5IP9C 4NOIA 5IYDK 1TWCK 3GEIA 5M5WK 3PO2C 4OIOA 5IYBC 3GTKK 2B63C 4C2MC 1F7UA 2GAHC 3OPFA 3HOXK 4DDQA 4GTDA 3FKIC 3RZDK 4C3IK 3GTQC 1F7VA 5IYDC 5FLMK 4GZYA 1TWCC 2V6SA 4LLGA 1I6VA 1O2AA 3WODA 4A3JK 1VH2A 4BXXK 3GTKC 2CW0A 3ADAC 5M5YK 3H0GK 4BBRK 3H0GA 1B4BA 3HOXC 2ZFZA 3RZDC 4C3IC 3NUHA 3LAPA 3GTOK 5FLMC 2GSOA 2O5IA 1I50A 1WOSA 3I4NK 4A3JC 5M3FK 1KQ4A 4BXXC 3OREA 4YFXA 3GTPA 5C44K 4BBRC 3AD7C 4C45A 1WOPA 4YG2A 3GTOC 4KB4A 4A3CC 3A8IA 2VUMK 2YU9K 2YU9A 1XXAA 4P5AA 1RU0A 3I4NC 3S15K 4XLNA 3T01A 1SMYA 5C44C 2A6EA 3A8JA 3GDZA 1ISEA 1O25A 5M5XK 2PA8L 1I3QA 2R93K 4PAAA 2VUMC 4GTAA 1DCOA 2NVQK 3N0BA 3GEEA 1INNA 3S15C 4G0WA 1WQFA 4KASA 3GEHA 5FJ8K 2JA8K 5IOQA 2WB1L 4KDDA 3AD8C 2E2JK 4RMFA 2E2IC 3BP3A 4Y7NC 4OIQA 5E68A 1TWFK 4LK1A 2R93C 1YCLA 5JFEA 3GTGC 4X6AK 2NVQC 1XZQB 2CFAA 1ZBSA 4XCHA 2NVXA 1HI9A 2RH6A 5TMFA 4QIWL 1G51A 2NVYK 4XLPA 4A3FK 4BY1K 2JA8C 2E2JC 1JOEA 4G7ZA 3GTMK 3GTMA 1F9NA 3CQZK 1TWFC 4BKWA 3BUEA 4BY7K 2WAQL
chains in the Genus database with same CATH topology
1USOA 2V6SA 1RU0A 1F93A 3JSTA 4C45A 2V6UA 2V6TA 3HXAA 1DCPA 4LOWA 1DCOA 2EBBA 1USMA 4WILA 1DCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USO A;  2V6S A;  1RU0 A;  1F93 A;  3JST A;  4C45 A;  2V6U A;  2V6T A;  3HXA A;  1DCP A;  4LOW A;  1DCO A;  2EBB A;  1USM A;  4WIL A;  1DCH A; 
#chains in the Genus database with same CATH topology
 4KAT A;  1WSR A;  5IP9 K;  4X6A C;  1XZP B;  4LR2 A;  3BP8 C;  1XXB A;  4Q4Z A;  3HXA A;  2NVY C;  3MML B;  4BY1 C;  3TFH A;  5L46 A;  5JVO A;  3GTM C;  2JA7 K;  5C4J K;  4OIN A;  1BDF A;  3S14 K;  3CQZ C;  1TWH K;  2JA6 K;  4BY7 C;  3FKI A;  2BE5 A;  3GTQ A;  1IL2 A;  3GSI A;  4OIR A;  1TWC A;  1J6X A;  1TWG K;  1TWG A;  1WOO A;  3S17 K;  1JQW A;  1V5V A;  5EGH A;  3GTK A;  2KWA A;  2PMZ D;  1USM A;  2JA7 C;  5C4J C;  3S14 C;  1J98 A;  3AD9 C;  1TWH C;  2JA6 C;  1O29 A;  4KMU A;  1DCP A;  3GIR A;  2D6F C;  4A3B K;  2V6U A;  3S1N K;  1TWG C;  1YX2 A;  4FM9 A;  3S17 C;  4YFN A;  3EQL A;  1WQG A;  2XCR B;  1SFO K;  1SFO A;  1VLO A;  1Y1V K;  3DXJ A;  2Y0S L;  3GTO A;  4A3C K;  2R92 K;  4C3J K;  4AYB L;  4A3B C;  2W7V A;  3ERE D;  3S1N C;  3A8K A;  3N3Y A;  5C4X K;  4BLB A;  5CHP A;  1WQH A;  3T00 A;  4XSZ A;  1Y1W K;  4P5B A;  3T02 A;  1ZQ1 C;  4QIW D;  1R9T K;  4KMH A;  1SFO C;  4WIL A;  1Y1V C;  4WJ3 M;  1PJ6 A;  2WAQ D;  2R92 C;  4C3J C;  2VUM A;  1J6W A;  3LPX A;  4A3E K;  5C4X C;  4AH6 A;  3GTL K;  3GTL A;  4YFK A;  2FQO A;  3RZO C;  3S1M K;  1USO A;  4JK1 A;  1Y1W C;  2JA5 K;  5IOR A;  1R9T C;  1O27 A;  2R7Z K;  2E2I K;  2PPB A;  4Y7N K;  2E2I A;  1PJ7 A;  2R93 A;  4A3D K;  3H3V L;  4ILD A;  3GTG K;  3GTG A;  3HKZ L;  4A3E C;  1C0A A;  4GTE A;  3GTL C;  1ZXO A;  4MEY A;  1EI6 A;  5C3E K;  2XCO A;  3G4A A;  3HOY K;  3S1M C;  3N0C A;  1VGX A;  2JA5 C;  2R7Z C;  1TWF A;  4KM9 A;  3Q3Q A;  4OIP A;  1WCM C;  4A3D C;  1BS2 A;  2GSN A;  1O2F B;  1K83 K;  5C3E C;  1TWA K;  1PJ5 A;  3HOY C;  3S2H K;  1L0W A;  4M1X A;  1XZQ A;  2NVY A;  1IBA A;  1WSV A;  2P5M A;  5EGE A;  4ZH4 A;  4Y52 K;  3CQZ A;  5D4D A;  3LAJ A;  4GTC A;  2E2H K;  2CFA B;  2FQT A;  1K83 C;  1TWA C;  4KB2 A;  3S2H C;  1BGW A;  2A6H A;  4G0U A;  1ZVU A;  1EQR A;  1F93 A;  4Y52 C;  1UV7 A;  3K7A C;  2JA7 A;  3HOU K;  4QJV A;  3L4K A;  1TWH A;  2JA6 A;  1IQ0 A;  3GTJ K;  3PO3 K;  4A3G K;  3TTG A;  2V6T A;  2E2H C;  4GT9 A;  4A3I K;  1XXC A;  5M3M K;  4KMA A;  1O26 A;  3S16 K;  1JVI A;  1EFW A;  3M4O K;  4Q5S A;  2P8T A;  3V4G A;  3AQP A;  2ZUE A;  4KN7 A;  2O5J A;  2NVT K;  3HOU C;  4J3N A;  1WIH A;  3SZY A;  3GTJ C;  3PO3 C;  4A3G C;  3AH5 A;  4KC6 A;  2PA8 D;  2A68 A;  5IOT A;  4G7O A;  4A3I C;  2RGR A;  3HKZ D;  3S16 C;  3M4O C;  3JST A;  4G7H A;  3G4C A;  1I6H K;  3CAG A;  3TFJ A;  5IP7 K;  2NVT C;  1O28 A;  2WB1 D;  1X31 C;  1BJT A;  1Y1V A;  3TFI A;  4LJZ A;  2R92 A;  1IE0 A;  3OEP A;  3HOZ K;  1IW7 A;  3RZO K;  3I4M K;  1Y1W A;  1VJE A;  3M3Y K;  1I6H C;  2EBB A;  4MEX A;  2Y3P A;  1VRQ C;  3SZZ A;  1R9T A;  5IP7 C;  1ZYR A;  4GTL A;  4FZB A;  3S1R K;  5IYC K;  4A3L K;  3HOW K;  3AQO A;  2A69 A;  4A93 K;  3HOZ C;  3QX3 A;  1I50 K;  1EK8 A;  3I4M C;  1IS1 A;  3M3Y C;  2JA5 A;  1YNN A;  3S2D K;  1DCH A;  4KAW X;  3GTP K;  2R7Z A;  4BBS K;  3H0G C;  4A3M K;  4BLA A;  1WCM K;  1WCM A;  3S1R C;  5IYC C;  4A3L C;  3HOW C;  1AB4 A;  4PAB A;  4A93 C;  3S0X A;  4XSX A;  1I50 C;  4WJ4 A;  1XPP A;  1O24 A;  3S2D C;  2PMZ L;  3GTP C;  4BBS C;  4A3M C;  3FOF A;  2GAG C;  2XCQ A;  4LQY A;  4GFQ A;  1I3Q K;  5CJ9 A;  5TMC A;  2YU9 C;  1YNJ A;  1K83 A;  1TWA A;  4KAR A;  5HL8 A;  4GTF A;  3HOV K;  1B4A A;  3K7A K;  3FOE A;  4LK0 A;  4A3K K;  1EH1 A;  1I3Q C;  2Y0S D;  2E2H A;  4GTB A;  4AYB D;  3L4J A;  4C3H K;  1XZP A;  4KMD A;  3IPJ A;  2NVX K;  3HOV C;  4O2D A;  5TJ3 A;  4MQ9 A;  4KN4 A;  3S1Q K;  5IOS A;  3GTJ A;  2JH3 A;  3VA7 A;  4A3K C;  1O2B A;  1GE9 A;  1HQM A;  2ZUF A;  4P9S A;  1DD5 A;  4C3H C;  4LOW A;  4G0V A;  2NVX C;  1J6V A;  3PO2 K;  3FHZ A;  4A3F C;  5IYB K;  4QJV B;  2B63 K;  4C2M K;  3S1Q C;  2B63 A;  1WOR A;  4KM8 A;  2PHC B;  3FKI K;  2GSU A;  3GTQ K;  3H3V D;  5IP9 C;  4NOI A;  5IYD K;  1TWC K;  3GEI A;  5M5W K;  3PO2 C;  4OIO A;  5IYB C;  3GTK K;  2B63 C;  4C2M C;  1F7U A;  2GAH C;  3OPF A;  3HOX K;  4DDQ A;  4GTD A;  3FKI C;  3RZD K;  4C3I K;  3GTQ C;  1F7V A;  5IYD C;  5FLM K;  4GZY A;  1TWC C;  2V6S A;  4LLG A;  1I6V A;  1O2A A;  3WOD A;  4A3J K;  1VH2 A;  4BXX K;  3GTK C;  2CW0 A;  3ADA C;  5M5Y K;  3H0G K;  4BBR K;  3H0G A;  1B4B A;  3HOX C;  2ZFZ A;  3RZD C;  4C3I C;  3NUH A;  3LAP A;  3GTO K;  5FLM C;  2GSO A;  2O5I A;  1I50 A;  1WOS A;  3I4N K;  4A3J C;  5M3F K;  1KQ4 A;  4BXX C;  3ORE A;  4YFX A;  3GTP A;  5C44 K;  4BBR C;  3AD7 C;  4C45 A;  1WOP A;  4YG2 A;  3GTO C;  4KB4 A;  4A3C C;  3A8I A;  2VUM K;  2YU9 K;  2YU9 A;  1XXA A;  4P5A A;  1RU0 A;  3I4N C;  3S15 K;  4XLN A;  3T01 A;  1SMY A;  5C44 C;  2A6E A;  3A8J A;  3GDZ A;  1ISE A;  1O25 A;  5M5X K;  2PA8 L;  1I3Q A;  2R93 K;  4PAA A;  2VUM C;  4GTA A;  1DCO A;  2NVQ K;  3N0B A;  3GEE A;  1INN A;  3S15 C;  4G0W A;  1WQF A;  4KAS A;  3GEH A;  5FJ8 K;  2JA8 K;  5IOQ A;  2WB1 L;  4KDD A;  3AD8 C;  2E2J K;  4RMF A;  2E2I C;  3BP3 A;  4Y7N C;  4OIQ A;  5E68 A;  1TWF K;  4LK1 A;  2R93 C;  1YCL A;  5JFE A;  3GTG C;  4X6A K;  2NVQ C;  1XZQ B;  2CFA A;  1ZBS A;  4XCH A;  2NVX A;  1HI9 A;  2RH6 A;  5TMF A;  4QIW L;  1G51 A;  2NVY K;  4XLP A;  4A3F K;  4BY1 K;  2JA8 C;  2E2J C;  1JOE A;  4G7Z A;  3GTM K;  3GTM A;  1F9N A;  3CQZ K;  1TWF C;  4BKW A;  3BUE A;  4BY7 K;  2WAQ L; 
#chains in the Genus database with same CATH homology
 1USO A;  2V6S A;  1RU0 A;  1F93 A;  3JST A;  4C45 A;  2V6U A;  2V6T A;  3HXA A;  1DCP A;  4LOW A;  1DCO A;  2EBB A;  1USM A;  4WIL A;  1DCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...