1DCOA

Dcoh, a bifunctional protein-binding transcriptional coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCOH
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcoA00
1RU0A 1DCOA 1DCHA 4WILA 2V6TA 1USOA 1F93A 1USMA 4C45A 1DCPA 3JSTA 2V6SA 4LOWA 2V6UA 2EBBA 3HXAA
chains in the Genus database with same CATH superfamily
3HOWC 5C4JC 5IYDK 4KATA 3V4GA 3AD7C 1TWGK 4MQ9A 4A3GC 5IORA 2JA5A 4Y52C 1I3QA 1YNNA 3A8IA 2R93A 5M3MK 2NVYC 3S1RC 1XZQB 3S17K 1WSVA 4FM9A 4KC6A 1XZPA 4G7HA 1USOA 1ZXOA 1O28A 4Q4ZA 4NOIA 4QIWL 3TFJA 3RZOC 1F7UA 3S2DK 1JQWA 4A3JK 3WODA 2PMZL 1Y1WK 4BXXC 3BP3A 3H3VD 3IPJA 4A3BK 4Q5SA 2PA8D 4KMUA 4XSXA 4C3JC 4A3DK 2E2JK 1EI6A 4X6AC 1I50C 4BBSK 2A6HA 2WAQL 1EK8A 1I6VA 1Y1VC 1TWFC 3FKIA 1J6WA 1O27A 2FQTA 4KM9A 1I6HC 4XLNA 3HOWK 1JOEA 5C4JK 2E2HA 3HXAA 4A3LC 1EH1A 1O2FB 1HQMA 3GTKA 3HOXC 1SFOA 5IOTA 4A3GK 3GTPC 1WOSA 4OIPA 4GTEA 3N0CA 4Y52K 4BLAA 1VRQC 5TMFA 2E2IA 3ERED 2P8TA 1J98A 2NVYK 3RZDC 4C2MC 3S1RK 3M4OC 2V6TA 2NVXA 1TWAC 2FQOA 2B63A 5IYCC 1J6XA 3GTPA 3GDZA 3MMLB 3N0BA 3RZOK 4G7ZA 4XCHA 5IP7C 1WOOA 3JSTA 1TWCA 1WCMC 3L4KA 4KASA 1IBAA 4BXXK 3GTMA 1DD5A 5C4XC 4C3JK 1KQ4A 3OREA 4X6AK 1GE9A 1I50K 2V6SA 4ILDA 4WJ4A 4LK1A 1Y1VK 1TWFK 1XZPB 1TWGA 2JA8C 3HOYC 4KM8A 2JA6C 3H0GC 4RMFA 3CAGA 1I6HK 4GTBA 4KB2A 1J6VA 3LAJA 1ZYRA 4A3LK 3DXJA 3HOXK 1V5VA 4QIWD 1VLOA 4AH6A 1O24A 3GTPK 3H0GA 2GSUA 1EQRA 1WQGA 1Y1WA 3GTJC 2PMZD 2KWAA 4A3MC 4LQYA 1YX2A 1DCOA 2Y0SL 3S1QC 3RZDK 4C2MK 4OIRA 1EFWA 3M4OK 5EGEA 1TWAK 2PHCB 1O29A 2WAQD 4LJZA 5IYCK 4A3FC 2YU9C 5IP7K 1AB4A 5IYBC 3LAPA 4GFQA 2D6FC 4OIOA 1BDFA 4QJVA 3G4CA 1WCMK 4GZYA 3I4NC 2VUMC 4LOWA 4BY7C 2EBBA 1IQ0A 4BKWA 1ISEA 5C4XK 4PABA 5IP9C 1XXAA 1JVIA 4AYBL 3SZYA 3GTGC 4KDDA 3OEPA 4P9SA 2JA8K 3HOYK 4LR2A 1PJ5A 4C3IC 1ZQ1C 2JA7C 2JA6K 3H0GK 1IS1A 2R92C 3FOEA 4PAAA 3GTLC 2NVYA 4BLBA 3GTGA 4KARA 1YCLA 3S2HC 5C3EC 4FZBA 2R92A 4JK1A 3GTJK 4A3MK 3GTLA 4G0UA 1K83C 3S1QK 4MEXA 3AH5A 1G51A 5M3FK 4GTAA 4P5BA 4A3IC 1I50A 3GTOC 5IOSA 3TFHA 1ZBSA 4A3FK 2YU9K 5FLMC 1Y1VA 1TWFA 5IYBK 4KMAA 1WQFA 2CFAB 3I4NK 4WJ3M 4GT9A 2VUMK 2NVTC 4BY7K 1HI9A 3M3YC 3S1MC 5IP9K 3T01A 5TMCA 3GSIA 3HOUC 5CJ9A 5EGHA 3GTGK 3ADAC 2O5IA 1L0WA 1DCPA 4C3IK 2JA7K 2GAHC 4O2DA 4A3KC 3PO3C 2R92K 2Y0SD 4QJVB 3GTLK 1VJEA 1SMYA 1XXBA 1TWAA 4OINA 3K7AC 2R7ZC 1TWHC 4BY1C 2GAGC 3G4AA 3BUEA 3S2HK 5C3EK 4A3EC 3S14C 3S16C 3GEEA 2P5MA 1WCMA 1K83K 5CHPA 5JFEA 1BGWA 1WQHA 4A93C 1TWHA 4A3IK 2WB1L 3GTOK 3EQLA 4AYBD 2GSOA 1F93A 5FLMK 2XCRB 1WSRA 4YFXA 3TTGA 3GTQC 3TFIA 1O25A 2JA6A 2NVTK 5L46A 3M3YK 3HOVC 3S1MK 4LK0A 1DCHA 4A3CC 5JVOA 3VA7A 4KN4A 2GSNA 4YG2A 3HOUK 1INNA 4C3HC 1RU0A 3AD9C 4GTDA 3GTJA 4A3KK 4YFNA 3PO3K 4G0WA 3N3YA 3AQPA 3K7AK 1PJ7A 1F7VA 2R7ZK 3OPFA 1TWHK 1R9TC 4BY1K 2YU9A 4KMDA 1F9NA 4A3EK 2JA5C 3S14K 3S16K 5HL8A 1I3QC 1WIHA 2R93C 2Y3PA 1B4BA 2VUMA 1XPPA 4MEYA 4OIQA 2BE5A 4A93K 1R9TA 1BJTA 4DDQA 3HOZC 3GEHA 4Y7NC 4BBRC 2A69A 3T02A 1IL2A 4GTCA 3GTQK 2JA7A 1YNJA 3HOVK 5M5XK 2A68A 2XCOA 4A3CK 3S1NC 3HKZL 4C3HK 2RH6A 1BS2A 3FKIC 4XSZA 4WILA 5IOQA 3S15C 3PO2C 3NUHA 1K83A 5M5YK 1ZVUA 2E2HC 2NVQC 4YFKA 4KAWX 3GTKC 1SFOC 3GEIA 3GTOA 3CQZC 1R9TK 2WB1D 3L4JA 3SZZA 2JA5K 2ZFZA 5FJ8K 2O5JA 4KN7A 3FOFA 2E2IC 1I3QK 2R93K 5C44C 2NVXC 3I4MC 2ZUEA 1IW7A 2B63C 3CQZA 2ZUFA 3HOZK 1X31C 4Y7NK 3A8JA 1TWCC 4BBRK 1XZQA 1C0AA 5M5WK 3LPXA 3H3VL 3GTMC 2PPBA 2PA8L 4LLGA 2A6EA 1O2BA 3BP8C 5IYDC 1O26A 3GIRA 4ZH4A 3S1NK 4J3NA 3S0XA 4G0VA 2RGRA 2R7ZA 3FHZA 1IE0A 1VH2A 1TWGC 1O2AA 3FKIK 1WORA 3S15K 3QX3A 3PO2K 4KB4A 3S17C 4C45A 4P5AA 4XLPA 1WOPA 1B4AA 2V6UA 2E2HK 4GTLA 2NVQK 3GTKK 1SFOK 3CQZK 3S2DC 3AD8C 4A3JC 2XCQA 3T00A 2W7VA 1Y1WC 1USMA 2E2IK 1UV7A 3GTQA 5D4DA 3AQOA 4A3BC 4GTFA 1PJ6A 5C44K 5TJ3A 4G7OA 2NVXK 3I4MK 4A3DC 2CW0A 5E68A 2E2JC 1VGXA 2B63K 2CFAA 4BBSC 3A8KA 4KMHA 3HKZD 1TWCK 3GTMK 1XXCA 3Q3QA 2JH3A 4M1XA
chains in the Genus database with same CATH topology
1RU0A 1DCOA 1DCHA 4WILA 2V6TA 1USOA 1F93A 1USMA 4C45A 1DCPA 3JSTA 2V6SA 4LOWA 2V6UA 2EBBA 3HXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU0 A;  1DCO A;  1DCH A;  4WIL A;  2V6T A;  1USO A;  1F93 A;  1USM A;  4C45 A;  1DCP A;  3JST A;  2V6S A;  4LOW A;  2V6U A;  2EBB A;  3HXA A; 
#chains in the Genus database with same CATH topology
 3HOW C;  5C4J C;  5IYD K;  4KAT A;  3V4G A;  3AD7 C;  1TWG K;  4MQ9 A;  4A3G C;  5IOR A;  2JA5 A;  4Y52 C;  1I3Q A;  1YNN A;  3A8I A;  2R93 A;  5M3M K;  2NVY C;  3S1R C;  1XZQ B;  3S17 K;  1WSV A;  4FM9 A;  4KC6 A;  1XZP A;  4G7H A;  1USO A;  1ZXO A;  1O28 A;  4Q4Z A;  4NOI A;  4QIW L;  3TFJ A;  3RZO C;  1F7U A;  3S2D K;  1JQW A;  4A3J K;  3WOD A;  2PMZ L;  1Y1W K;  4BXX C;  3BP3 A;  3H3V D;  3IPJ A;  4A3B K;  4Q5S A;  2PA8 D;  4KMU A;  4XSX A;  4C3J C;  4A3D K;  2E2J K;  1EI6 A;  4X6A C;  1I50 C;  4BBS K;  2A6H A;  2WAQ L;  1EK8 A;  1I6V A;  1Y1V C;  1TWF C;  3FKI A;  1J6W A;  1O27 A;  2FQT A;  4KM9 A;  1I6H C;  4XLN A;  3HOW K;  1JOE A;  5C4J K;  2E2H A;  3HXA A;  4A3L C;  1EH1 A;  1O2F B;  1HQM A;  3GTK A;  3HOX C;  1SFO A;  5IOT A;  4A3G K;  3GTP C;  1WOS A;  4OIP A;  4GTE A;  3N0C A;  4Y52 K;  4BLA A;  1VRQ C;  5TMF A;  2E2I A;  3ERE D;  2P8T A;  1J98 A;  2NVY K;  3RZD C;  4C2M C;  3S1R K;  3M4O C;  2V6T A;  2NVX A;  1TWA C;  2FQO A;  2B63 A;  5IYC C;  1J6X A;  3GTP A;  3GDZ A;  3MML B;  3N0B A;  3RZO K;  4G7Z A;  4XCH A;  5IP7 C;  1WOO A;  3JST A;  1TWC A;  1WCM C;  3L4K A;  4KAS A;  1IBA A;  4BXX K;  3GTM A;  1DD5 A;  5C4X C;  4C3J K;  1KQ4 A;  3ORE A;  4X6A K;  1GE9 A;  1I50 K;  2V6S A;  4ILD A;  4WJ4 A;  4LK1 A;  1Y1V K;  1TWF K;  1XZP B;  1TWG A;  2JA8 C;  3HOY C;  4KM8 A;  2JA6 C;  3H0G C;  4RMF A;  3CAG A;  1I6H K;  4GTB A;  4KB2 A;  1J6V A;  3LAJ A;  1ZYR A;  4A3L K;  3DXJ A;  3HOX K;  1V5V A;  4QIW D;  1VLO A;  4AH6 A;  1O24 A;  3GTP K;  3H0G A;  2GSU A;  1EQR A;  1WQG A;  1Y1W A;  3GTJ C;  2PMZ D;  2KWA A;  4A3M C;  4LQY A;  1YX2 A;  1DCO A;  2Y0S L;  3S1Q C;  3RZD K;  4C2M K;  4OIR A;  1EFW A;  3M4O K;  5EGE A;  1TWA K;  2PHC B;  1O29 A;  2WAQ D;  4LJZ A;  5IYC K;  4A3F C;  2YU9 C;  5IP7 K;  1AB4 A;  5IYB C;  3LAP A;  4GFQ A;  2D6F C;  4OIO A;  1BDF A;  4QJV A;  3G4C A;  1WCM K;  4GZY A;  3I4N C;  2VUM C;  4LOW A;  4BY7 C;  2EBB A;  1IQ0 A;  4BKW A;  1ISE A;  5C4X K;  4PAB A;  5IP9 C;  1XXA A;  1JVI A;  4AYB L;  3SZY A;  3GTG C;  4KDD A;  3OEP A;  4P9S A;  2JA8 K;  3HOY K;  4LR2 A;  1PJ5 A;  4C3I C;  1ZQ1 C;  2JA7 C;  2JA6 K;  3H0G K;  1IS1 A;  2R92 C;  3FOE A;  4PAA A;  3GTL C;  2NVY A;  4BLB A;  3GTG A;  4KAR A;  1YCL A;  3S2H C;  5C3E C;  4FZB A;  2R92 A;  4JK1 A;  3GTJ K;  4A3M K;  3GTL A;  4G0U A;  1K83 C;  3S1Q K;  4MEX A;  3AH5 A;  1G51 A;  5M3F K;  4GTA A;  4P5B A;  4A3I C;  1I50 A;  3GTO C;  5IOS A;  3TFH A;  1ZBS A;  4A3F K;  2YU9 K;  5FLM C;  1Y1V A;  1TWF A;  5IYB K;  4KMA A;  1WQF A;  2CFA B;  3I4N K;  4WJ3 M;  4GT9 A;  2VUM K;  2NVT C;  4BY7 K;  1HI9 A;  3M3Y C;  3S1M C;  5IP9 K;  3T01 A;  5TMC A;  3GSI A;  3HOU C;  5CJ9 A;  5EGH A;  3GTG K;  3ADA C;  2O5I A;  1L0W A;  1DCP A;  4C3I K;  2JA7 K;  2GAH C;  4O2D A;  4A3K C;  3PO3 C;  2R92 K;  2Y0S D;  4QJV B;  3GTL K;  1VJE A;  1SMY A;  1XXB A;  1TWA A;  4OIN A;  3K7A C;  2R7Z C;  1TWH C;  4BY1 C;  2GAG C;  3G4A A;  3BUE A;  3S2H K;  5C3E K;  4A3E C;  3S14 C;  3S16 C;  3GEE A;  2P5M A;  1WCM A;  1K83 K;  5CHP A;  5JFE A;  1BGW A;  1WQH A;  4A93 C;  1TWH A;  4A3I K;  2WB1 L;  3GTO K;  3EQL A;  4AYB D;  2GSO A;  1F93 A;  5FLM K;  2XCR B;  1WSR A;  4YFX A;  3TTG A;  3GTQ C;  3TFI A;  1O25 A;  2JA6 A;  2NVT K;  5L46 A;  3M3Y K;  3HOV C;  3S1M K;  4LK0 A;  1DCH A;  4A3C C;  5JVO A;  3VA7 A;  4KN4 A;  2GSN A;  4YG2 A;  3HOU K;  1INN A;  4C3H C;  1RU0 A;  3AD9 C;  4GTD A;  3GTJ A;  4A3K K;  4YFN A;  3PO3 K;  4G0W A;  3N3Y A;  3AQP A;  3K7A K;  1PJ7 A;  1F7V A;  2R7Z K;  3OPF A;  1TWH K;  1R9T C;  4BY1 K;  2YU9 A;  4KMD A;  1F9N A;  4A3E K;  2JA5 C;  3S14 K;  3S16 K;  5HL8 A;  1I3Q C;  1WIH A;  2R93 C;  2Y3P A;  1B4B A;  2VUM A;  1XPP A;  4MEY A;  4OIQ A;  2BE5 A;  4A93 K;  1R9T A;  1BJT A;  4DDQ A;  3HOZ C;  3GEH A;  4Y7N C;  4BBR C;  2A69 A;  3T02 A;  1IL2 A;  4GTC A;  3GTQ K;  2JA7 A;  1YNJ A;  3HOV K;  5M5X K;  2A68 A;  2XCO A;  4A3C K;  3S1N C;  3HKZ L;  4C3H K;  2RH6 A;  1BS2 A;  3FKI C;  4XSZ A;  4WIL A;  5IOQ A;  3S15 C;  3PO2 C;  3NUH A;  1K83 A;  5M5Y K;  1ZVU A;  2E2H C;  2NVQ C;  4YFK A;  4KAW X;  3GTK C;  1SFO C;  3GEI A;  3GTO A;  3CQZ C;  1R9T K;  2WB1 D;  3L4J A;  3SZZ A;  2JA5 K;  2ZFZ A;  5FJ8 K;  2O5J A;  4KN7 A;  3FOF A;  2E2I C;  1I3Q K;  2R93 K;  5C44 C;  2NVX C;  3I4M C;  2ZUE A;  1IW7 A;  2B63 C;  3CQZ A;  2ZUF A;  3HOZ K;  1X31 C;  4Y7N K;  3A8J A;  1TWC C;  4BBR K;  1XZQ A;  1C0A A;  5M5W K;  3LPX A;  3H3V L;  3GTM C;  2PPB A;  2PA8 L;  4LLG A;  2A6E A;  1O2B A;  3BP8 C;  5IYD C;  1O26 A;  3GIR A;  4ZH4 A;  3S1N K;  4J3N A;  3S0X A;  4G0V A;  2RGR A;  2R7Z A;  3FHZ A;  1IE0 A;  1VH2 A;  1TWG C;  1O2A A;  3FKI K;  1WOR A;  3S15 K;  3QX3 A;  3PO2 K;  4KB4 A;  3S17 C;  4C45 A;  4P5A A;  4XLP A;  1WOP A;  1B4A A;  2V6U A;  2E2H K;  4GTL A;  2NVQ K;  3GTK K;  1SFO K;  3CQZ K;  3S2D C;  3AD8 C;  4A3J C;  2XCQ A;  3T00 A;  2W7V A;  1Y1W C;  1USM A;  2E2I K;  1UV7 A;  3GTQ A;  5D4D A;  3AQO A;  4A3B C;  4GTF A;  1PJ6 A;  5C44 K;  5TJ3 A;  4G7O A;  2NVX K;  3I4M K;  4A3D C;  2CW0 A;  5E68 A;  2E2J C;  1VGX A;  2B63 K;  2CFA A;  4BBS C;  3A8K A;  4KMH A;  3HKZ D;  1TWC K;  3GTM K;  1XXC A;  3Q3Q A;  2JH3 A;  4M1X A; 
#chains in the Genus database with same CATH homology
 1RU0 A;  1DCO A;  1DCH A;  4WIL A;  2V6T A;  1USO A;  1F93 A;  1USM A;  4C45 A;  1DCP A;  3JST A;  2V6S A;  4LOW A;  2V6U A;  2EBB A;  3HXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...