1DCOA

Dcoh, a bifunctional protein-binding transcriptional coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
molecule keywords DCOH
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcoA00
4LOWA 1USMA 1DCPA 1DCHA 2V6SA 4WILA 3JSTA 2V6TA 1RU0A 1USOA 3HXAA 4C45A 1DCOA 2V6UA 1F93A 2EBBA
chains in the Genus database with same CATH superfamily
3V4GA 3S16C 1I3QC 3GTLA 3WODA 4A93C 2NVQC 2JA5C 1I3QK 3Q3QA 2JA7K 2JA5K 4LQYA 4LR2A 3SZYA 3A8KA 2PMZL 2PPBA 2JA6A 3HOVC 5IP9C 4KMDA 4MEYA 2ZUFA 4DDQA 3GEHA 3TFJA 4GTAA 3TTGA 1TWFA 1O28A 4YFNA 4AYBL 3MMLB 4ZH4A 4OINA 2FQTA 1WQFA 4MEXA 1BDFA 3S16K 3AD7C 4QJVA 1XPPA 2EBBA 1JOEA 1I50C 3S0XA 4C3JC 1O2BA 3CQZK 4GTBA 3N0CA 1I50K 1O2AA 5L46A 1PJ6A 5IP7K 1R9TK 5EGEA 4OIRA 3FKIK 1I6HC 2E2HK 5IOTA 3HOWC 2A68A 1HQMA 1WORA 1Y1WK 3HOWK 4LJZA 1BJTA 4X6AK 2A6EA 1ZBSA 2P8TA 3FOEA 4BBSC 3BUEA 2PHCB 4C3JK 2R7ZK 4XLNA 1HI9A 3GSIA 5C3EC 4A3MC 1ZVUA 5M5XK 4A3MK 1ISEA 1L0WA 3DXJA 2E2IC 1X31C 2JA6C 1VRQC 4P5AA 4KMUA 2R93K 3GTPA 1Y1WA 4C3HC 3A8IA 3FOFA 2RH6A 3GTPK 4LLGA 1O25A 4C3HK 2R93A 1EQRA 4AH6A 2A69A 4KB4A 3HOYC 5CJ9A 2B63C 4Y52K 1R9TA 4LOWA 1F9NA 1PJ7A 3T01A 3GTOA 3AQOA 1K83C 3CQZA 3GTQA 1G51A 2CFAB 1TWHC 1EH1A 2PMZD 4QIWL 1GE9A 3HOUK 2R7ZA 3GTMA 4J3NA 4A3CK 1ZQ1C 2E2IK 3L4KA 4GTDA 4A3CC 1YNJA 1DD5A 4A3DC 3LAJA 3GEEA 2WAQL 2JA7C 1TWGC 3LPXA 3AD8C 3TFIA 2E2JC 3GDZA 3GTGC 5EGHA 2B63K 2E2HA 5IP9K 5FLMK 2JH3A 3BP3A 3FKIA 5JVOA 5M5YK 1F7VA 3HOZK 1YX2A 2E2JK 2VUMK 3S15C 4G0WA 2NVYA 1I50A 1UV7A 5JFEA 3RZDC 2YU9C 4YFKA 3S15K 1O29A 2PA8L 4A3BC 3T02A 5IORA 1J6WA 2O5JA 1F7UA 3S1QC 3H0GK 4C3IK 4G7OA 2A6HA 1V5VA 1Y1VA 3EQLA 1SFOK 4BY7K 3H0GC 2Y0SL 1USOA 4A93K 1XXAA 4G7HA 1SFOC 4BY7C 1WCMA 4BLAA 4KAWX 3GTGK 2NVXA 1I6HK 3S2HK 4G0VA 1IW7A 3FHZA 1VJEA 1WOPA 1O2FB 1I3QA 3GIRA 1XXBA 4OIOA 2NVXK 4LK0A 5FJ8K 4A3KC 2GSNA 3S1QK 4BBSK 2RGRA 2R92C 5M3MK 1TWAC 4A3KK 2D6FC 2Y3PA 3SZZA 5C3EK 4KM9A 1Y1VK 1SFOA 1TWAA 1TWAK 2WB1L 4FM9A 4A3FC 4PAAA 4WJ4A 4KMHA 5C4JK 3HKZL 3H3VD 5IP7C 2JA8K 4GFQA 4P9SA 4KASA 4A3EK 3H3VL 1USMA 3K7AK 4FZBA 1WIHA 3ERED 2VUMA 1TWCA 3A8JA 4A3EC 1VGXA 3GTPC 1XZPA 3GTJA 1WCMC 3S14C 3GTJC 3GTGA 3OREA 1WCMK 1WSRA 1IL2A 3PO3C 3BP8C 1Y1VC 5IYBC 5M3FK 3GTLC 3IPJA 3S1MC 4KMAA 1IE0A 3L4JA 5C4JC 1TWHK 5C44K 3HOUC 2PA8D 2KWAA 3S1MK 2GAGC 4KB2A 4KN7A 2W7VA 2XCOA 1DCPA 4KATA 3GTQK 4A3GK 4M1XA 1KQ4A 1O27A 3GTOK 2NVYK 3OPFA 3S1RC 1B4AA 4A3DK 2XCRB 3GTQC 4A3GC 1IS1A 2R92A 3M4OK 1XZPB 3GTKA 5TMCA 1EFWA 1J98A 3S14K 4G0UA 2NVQK 3M4OC 4Y7NC 2B63A 4KDDA 2CW0A 3HOYK 1DCOA 3HKZD 5IYDK 4Y7NK 5D4DA 4BXXK 4XSZA 5IYDC 3RZDK 2YU9K 1K83K 3TFHA 2NVTC 1RU0A 3GTMC 1O24A 4GT9A 1J6VA 2E2IA 3GTMK 4C3IC 2GSOA 4LK1A 3S17C 2CFAA 1VH2A 3AD9C 3S1RK 4OIQA 2V6SA 4QJVB 5CHPA 4Q4ZA 3AH5A 1WSVA 4AYBD 4JK1A 4KN4A 1BS2A 4A3JK 4MQ9A 4PABA 1TWGK 3S2HC 2YU9A 4XSXA 1AB4A 1XZQB 1XXCA 3G4CA 3I4MC 3T00A 3FKIC 2VUMC 2E2HC 3I4MK 2WB1D 4A3IK 3HOVK 3OEPA 5IOQA 4BBRK 1TWGA 5E68A 4A3IC 4KC6A 2XCQA 4XLPA 4XCHA 4BBRC 5IOSA 1B4BA 4OIPA 4KARA 4KM8A 1ZYRA 1JQWA 4A3FK 4GTCA 1SMYA 4RMFA 5HL8A 4YG2A 2R7ZC 3N3YA 2JA8C 1TWHA 3LAPA 1YCLA 1EK8A 3CQZC 1K83A 1JVIA 1TWFK 4GTLA 5TMFA 3QX3A 4A3LK 1DCHA 1IBAA 1C0AA 1BGWA 1R9TC 4BKWA 3I4NK 2JA6K 3GTKC 3NUHA 2R93C 3GTJK 4P5BA 4O2DA 2NVXC 1XZQA 3GTKK 1IQ0A 1Y1WC 3PO3K 2R92K 5M5WK 3RZOK 2P5MA 3ADAC 4X6AC 4BY1C 2FQOA 3M3YK 1ZXOA 4Y52C 1F93A 1WQGA 4BY1K 3PO2C 2BE5A 4QIWD 4YFXA 4WJ3M 1TWFC 3PO2K 3S1NK 4GZYA 4A3LC 3GEIA 2NVYC 3CAGA 3K7AC 3I4NC 1PJ5A 3VA7A 2WAQD 4C2MK 5IYCC 1WQHA 2V6UA 2V6TA 3HOXK 1O26A 1I6VA 2Y0SD 5IYCK 1TWCC 5C4XC 3G4AA 4G7ZA 3HOXC 2JA5A 3RZOC 3AQPA 1TWCK 1WOSA 5C4XK 4BXXC 2JA7A 4ILDA 3HXAA 3S2DK 3M3YC 5FLMC 3HOZC 5IYBK 2NVTK 3GTLK 3S2DC 3N0BA 4GTEA 4BLBA 4C45A 4GTFA 5C44C 1INNA 4NOIA 4Q5SA 4WILA 3JSTA 3S1NC 5TJ3A 3S17K 2GSUA 1VLOA 2O5IA 4A3BK 1J6XA 3H0GA 3GTOC 2GAHC 1WOOA 2ZUEA 2ZFZA 4C2MC 1EI6A 4A3JC 1YNNA
chains in the Genus database with same CATH topology
4LOWA 1USMA 1DCPA 1DCHA 2V6SA 4WILA 3JSTA 2V6TA 1RU0A 1USOA 3HXAA 4C45A 1DCOA 2V6UA 1F93A 2EBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LOW A;  1USM A;  1DCP A;  1DCH A;  2V6S A;  4WIL A;  3JST A;  2V6T A;  1RU0 A;  1USO A;  3HXA A;  4C45 A;  1DCO A;  2V6U A;  1F93 A;  2EBB A; 
#chains in the Genus database with same CATH topology
 3V4G A;  3S16 C;  1I3Q C;  3GTL A;  3WOD A;  4A93 C;  2NVQ C;  2JA5 C;  1I3Q K;  3Q3Q A;  2JA7 K;  2JA5 K;  4LQY A;  4LR2 A;  3SZY A;  3A8K A;  2PMZ L;  2PPB A;  2JA6 A;  3HOV C;  5IP9 C;  4KMD A;  4MEY A;  2ZUF A;  4DDQ A;  3GEH A;  3TFJ A;  4GTA A;  3TTG A;  1TWF A;  1O28 A;  4YFN A;  4AYB L;  3MML B;  4ZH4 A;  4OIN A;  2FQT A;  1WQF A;  4MEX A;  1BDF A;  3S16 K;  3AD7 C;  4QJV A;  1XPP A;  2EBB A;  1JOE A;  1I50 C;  3S0X A;  4C3J C;  1O2B A;  3CQZ K;  4GTB A;  3N0C A;  1I50 K;  1O2A A;  5L46 A;  1PJ6 A;  5IP7 K;  1R9T K;  5EGE A;  4OIR A;  3FKI K;  1I6H C;  2E2H K;  5IOT A;  3HOW C;  2A68 A;  1HQM A;  1WOR A;  1Y1W K;  3HOW K;  4LJZ A;  1BJT A;  4X6A K;  2A6E A;  1ZBS A;  2P8T A;  3FOE A;  4BBS C;  3BUE A;  2PHC B;  4C3J K;  2R7Z K;  4XLN A;  1HI9 A;  3GSI A;  5C3E C;  4A3M C;  1ZVU A;  5M5X K;  4A3M K;  1ISE A;  1L0W A;  3DXJ A;  2E2I C;  1X31 C;  2JA6 C;  1VRQ C;  4P5A A;  4KMU A;  2R93 K;  3GTP A;  1Y1W A;  4C3H C;  3A8I A;  3FOF A;  2RH6 A;  3GTP K;  4LLG A;  1O25 A;  4C3H K;  2R93 A;  1EQR A;  4AH6 A;  2A69 A;  4KB4 A;  3HOY C;  5CJ9 A;  2B63 C;  4Y52 K;  1R9T A;  4LOW A;  1F9N A;  1PJ7 A;  3T01 A;  3GTO A;  3AQO A;  1K83 C;  3CQZ A;  3GTQ A;  1G51 A;  2CFA B;  1TWH C;  1EH1 A;  2PMZ D;  4QIW L;  1GE9 A;  3HOU K;  2R7Z A;  3GTM A;  4J3N A;  4A3C K;  1ZQ1 C;  2E2I K;  3L4K A;  4GTD A;  4A3C C;  1YNJ A;  1DD5 A;  4A3D C;  3LAJ A;  3GEE A;  2WAQ L;  2JA7 C;  1TWG C;  3LPX A;  3AD8 C;  3TFI A;  2E2J C;  3GDZ A;  3GTG C;  5EGH A;  2B63 K;  2E2H A;  5IP9 K;  5FLM K;  2JH3 A;  3BP3 A;  3FKI A;  5JVO A;  5M5Y K;  1F7V A;  3HOZ K;  1YX2 A;  2E2J K;  2VUM K;  3S15 C;  4G0W A;  2NVY A;  1I50 A;  1UV7 A;  5JFE A;  3RZD C;  2YU9 C;  4YFK A;  3S15 K;  1O29 A;  2PA8 L;  4A3B C;  3T02 A;  5IOR A;  1J6W A;  2O5J A;  1F7U A;  3S1Q C;  3H0G K;  4C3I K;  4G7O A;  2A6H A;  1V5V A;  1Y1V A;  3EQL A;  1SFO K;  4BY7 K;  3H0G C;  2Y0S L;  1USO A;  4A93 K;  1XXA A;  4G7H A;  1SFO C;  4BY7 C;  1WCM A;  4BLA A;  4KAW X;  3GTG K;  2NVX A;  1I6H K;  3S2H K;  4G0V A;  1IW7 A;  3FHZ A;  1VJE A;  1WOP A;  1O2F B;  1I3Q A;  3GIR A;  1XXB A;  4OIO A;  2NVX K;  4LK0 A;  5FJ8 K;  4A3K C;  2GSN A;  3S1Q K;  4BBS K;  2RGR A;  2R92 C;  5M3M K;  1TWA C;  4A3K K;  2D6F C;  2Y3P A;  3SZZ A;  5C3E K;  4KM9 A;  1Y1V K;  1SFO A;  1TWA A;  1TWA K;  2WB1 L;  4FM9 A;  4A3F C;  4PAA A;  4WJ4 A;  4KMH A;  5C4J K;  3HKZ L;  3H3V D;  5IP7 C;  2JA8 K;  4GFQ A;  4P9S A;  4KAS A;  4A3E K;  3H3V L;  1USM A;  3K7A K;  4FZB A;  1WIH A;  3ERE D;  2VUM A;  1TWC A;  3A8J A;  4A3E C;  1VGX A;  3GTP C;  1XZP A;  3GTJ A;  1WCM C;  3S14 C;  3GTJ C;  3GTG A;  3ORE A;  1WCM K;  1WSR A;  1IL2 A;  3PO3 C;  3BP8 C;  1Y1V C;  5IYB C;  5M3F K;  3GTL C;  3IPJ A;  3S1M C;  4KMA A;  1IE0 A;  3L4J A;  5C4J C;  1TWH K;  5C44 K;  3HOU C;  2PA8 D;  2KWA A;  3S1M K;  2GAG C;  4KB2 A;  4KN7 A;  2W7V A;  2XCO A;  1DCP A;  4KAT A;  3GTQ K;  4A3G K;  4M1X A;  1KQ4 A;  1O27 A;  3GTO K;  2NVY K;  3OPF A;  3S1R C;  1B4A A;  4A3D K;  2XCR B;  3GTQ C;  4A3G C;  1IS1 A;  2R92 A;  3M4O K;  1XZP B;  3GTK A;  5TMC A;  1EFW A;  1J98 A;  3S14 K;  4G0U A;  2NVQ K;  3M4O C;  4Y7N C;  2B63 A;  4KDD A;  2CW0 A;  3HOY K;  1DCO A;  3HKZ D;  5IYD K;  4Y7N K;  5D4D A;  4BXX K;  4XSZ A;  5IYD C;  3RZD K;  2YU9 K;  1K83 K;  3TFH A;  2NVT C;  1RU0 A;  3GTM C;  1O24 A;  4GT9 A;  1J6V A;  2E2I A;  3GTM K;  4C3I C;  2GSO A;  4LK1 A;  3S17 C;  2CFA A;  1VH2 A;  3AD9 C;  3S1R K;  4OIQ A;  2V6S A;  4QJV B;  5CHP A;  4Q4Z A;  3AH5 A;  1WSV A;  4AYB D;  4JK1 A;  4KN4 A;  1BS2 A;  4A3J K;  4MQ9 A;  4PAB A;  1TWG K;  3S2H C;  2YU9 A;  4XSX A;  1AB4 A;  1XZQ B;  1XXC A;  3G4C A;  3I4M C;  3T00 A;  3FKI C;  2VUM C;  2E2H C;  3I4M K;  2WB1 D;  4A3I K;  3HOV K;  3OEP A;  5IOQ A;  4BBR K;  1TWG A;  5E68 A;  4A3I C;  4KC6 A;  2XCQ A;  4XLP A;  4XCH A;  4BBR C;  5IOS A;  1B4B A;  4OIP A;  4KAR A;  4KM8 A;  1ZYR A;  1JQW A;  4A3F K;  4GTC A;  1SMY A;  4RMF A;  5HL8 A;  4YG2 A;  2R7Z C;  3N3Y A;  2JA8 C;  1TWH A;  3LAP A;  1YCL A;  1EK8 A;  3CQZ C;  1K83 A;  1JVI A;  1TWF K;  4GTL A;  5TMF A;  3QX3 A;  4A3L K;  1DCH A;  1IBA A;  1C0A A;  1BGW A;  1R9T C;  4BKW A;  3I4N K;  2JA6 K;  3GTK C;  3NUH A;  2R93 C;  3GTJ K;  4P5B A;  4O2D A;  2NVX C;  1XZQ A;  3GTK K;  1IQ0 A;  1Y1W C;  3PO3 K;  2R92 K;  5M5W K;  3RZO K;  2P5M A;  3ADA C;  4X6A C;  4BY1 C;  2FQO A;  3M3Y K;  1ZXO A;  4Y52 C;  1F93 A;  1WQG A;  4BY1 K;  3PO2 C;  2BE5 A;  4QIW D;  4YFX A;  4WJ3 M;  1TWF C;  3PO2 K;  3S1N K;  4GZY A;  4A3L C;  3GEI A;  2NVY C;  3CAG A;  3K7A C;  3I4N C;  1PJ5 A;  3VA7 A;  2WAQ D;  4C2M K;  5IYC C;  1WQH A;  2V6U A;  2V6T A;  3HOX K;  1O26 A;  1I6V A;  2Y0S D;  5IYC K;  1TWC C;  5C4X C;  3G4A A;  4G7Z A;  3HOX C;  2JA5 A;  3RZO C;  3AQP A;  1TWC K;  1WOS A;  5C4X K;  4BXX C;  2JA7 A;  4ILD A;  3HXA A;  3S2D K;  3M3Y C;  5FLM C;  3HOZ C;  5IYB K;  2NVT K;  3GTL K;  3S2D C;  3N0B A;  4GTE A;  4BLB A;  4C45 A;  4GTF A;  5C44 C;  1INN A;  4NOI A;  4Q5S A;  4WIL A;  3JST A;  3S1N C;  5TJ3 A;  3S17 K;  2GSU A;  1VLO A;  2O5I A;  4A3B K;  1J6X A;  3H0G A;  3GTO C;  2GAH C;  1WOO A;  2ZUE A;  2ZFZ A;  4C2M C;  1EI6 A;  4A3J C;  1YNN A; 
#chains in the Genus database with same CATH homology
 4LOW A;  1USM A;  1DCP A;  1DCH A;  2V6S A;  4WIL A;  3JST A;  2V6T A;  1RU0 A;  1USO A;  3HXA A;  4C45 A;  1DCO A;  2V6U A;  1F93 A;  2EBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...