1DCOA

Dcoh, a bifunctional protein-binding transcriptional coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcriptional stimulator
molecule keywords DCOH
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcoA00
3HXAA 1F93A 3JSTA 2V6SA 1DCHA 1RU0A 1USOA 2EBBA 2V6TA 1DCOA 4LOWA 1USMA 2V6UA 1DCPA 4WILA 4C45A
chains in the Genus database with same CATH superfamily
4QJVB 2YU9A 4G7OA 3T01A 4OIOA 1HQMA 3N3YA 3GTJA 4XLPA 2YU9K 4A3GK 1VGXA 4A3LC 3S1NC 1R9TA 4BY1C 4XSZA 1TWHK 3AD8C 3AH5A 4J3NA 4C2MK 2A6EA 3GTMK 2JA7C 1WORA 4C3IK 2E2JC 4A93K 5C44K 2JA6K 2R93C 5JVOA 1IS1A 2FQTA 3NUHA 3FHZA 4FM9A 3I4NK 4A3FK 3RZOK 4KB4A 4A3EK 4GTBA 3K7AC 1F7VA 4BBSC 2JA8K 2VUMK 4KC6A 3JSTA 1DCHA 1WCMC 1TWGC 4KAWX 3LPXA 4ZH4A 5IOSA 1ISEA 2A69A 4A3KC 3S16K 1X31C 3S1MC 4WJ4A 4WILA 5C4JK 1SMYA 4LQYA 3OPFA 5FLMK 3CQZK 3MMLB 4XLNA 2NVQK 3M4OK 3TFIA 1EK8A 4A3MK 4GTAA 2NVTC 4KDDA 1WCMK 1IL2A 4PAAA 1PJ7A 4LJZA 3EQLA 1XZPA 3HOWK 3S14K 4MEYA 4KN7A 3SZYA 3GTKK 1Y1VA 1RU0A 4OINA 4MQ9A 1R9TC 1VRQC 1ZXOA 3PO3C 4C3JC 5M3FK 3I4NC 2PHCB 3GEEA 2CFAA 3HOYK 4G7HA 2RH6A 1DCPA 1I50A 1BDFA 1O27A 1O2FB 4A93C 5IYBC 1EFWA 3S17K 3FKIK 4A3EC 1WOPA 1G51A 5M3MK 1L0WA 4BY1K 1PJ6A 1TWHA 3S1NK 1HI9A 2XCRB 2JA6C 5C3EC 4GTDA 1I6HC 4OIQA 1VLOA 3HOXK 4A3IK 4C45A 4C2MC 2NVXC 1TWGA 3A8KA 3G4AA 2E2IK 1XPPA 4X6AC 2R7ZK 3GTLA 1IW7A 2PA8D 1JQWA 1YCLA 1ZQ1C 5EGHA 4OIPA 2P5MA 2ZUFA 1TWCC 3PO3K 4Q5SA 5M5WK 2R7ZA 2JA5K 2A6HA 4YG2A 3GTPC 3GTQK 4P9SA 2PMZL 3GTKC 1TWFC 2JA5A 1YNNA 4BXXK 2WB1L 3HOZC 5TMFA 5L46A 1UV7A 2R7ZC 3HOVC 2CW0A 5FJ8K 1SFOA 2XCOA 3GTPK 3S1MK 3QX3A 4G7ZA 2Y3PA 2O5JA 4KMUA 2JA5C 2P8TA 3HKZL 1TWCK 5M5YK 3A8JA 3HKZD 2NVYA 3M3YK 3GTPA 3S0XA 2NVXA 4RMFA 4PABA 3S1RC 2E2IC 1I3QA 3BP3A 3RZDC 1INNA 1VJEA 4KASA 1TWHC 4NOIA 2Y0SL 5IYBK 3DXJA 5IP9C 1O25A 3LAPA 1F9NA 3HXAA 1XXAA 4GT9A 4OIRA 2JA6A 1O26A 4GTEA 3OEPA 2NVYC 1BS2A 2E2HK 4G0VA 3GTJC 4M1XA 3H0GA 3S1RK 1K83C 2ZUEA 3I4MC 1SFOK 1I3QC 4P5BA 4A3BC 1Y1VC 2ZFZA 2Y0SD 1C0AA 4A3DC 1R9TK 4FZBA 4Y52C 5HL8A 2W7VA 3AD9C 1WSRA 2R92C 4BBRK 3N0CA 4XCHA 1Y1WA 1TWGK 4KMAA 3FOEA 3M3YC 2WB1D 3ERED 3N0BA 1I6VA 3WODA 4Y52K 4GTLA 1TWFK 1WCMA 3VA7A 1XZQA 4G0WA 2GAHC 3S16C 3HOVK 1BJTA 4A3BK 1XXCA 1J98A 3GTOK 3SZZA 4BXXC 4C3IC 1IE0A 2XCQA 1B4BA 5M5XK 4YFXA 3CAGA 4KM9A 4XSXA 4KN4A 5D4DA 3LAJA 3HOXC 2V6UA 4A3IC 1K83A 4Q4ZA 1EI6A 1WQHA 4A3FC 1WOSA 3TFHA 4BKWA 1AB4A 1ZBSA 4A3JC 2JA7K 1O28A 1PJ5A 1WQGA 2R93A 2WAQD 4G0UA 4O2DA 3S15K 1I6HK 4GFQA 3HOUC 1B4AA 4C3HC 3S1QK 5IYDC 1ZYRA 3ADAC 5CHPA 1O2AA 2GSOA 4A3CK 2PMZD 3H3VD 1JVIA 3T02A 3OREA 1JOEA 4QJVA 3TFJA 3HOYC 3S2DC 3GTOC 4C3JK 3CQZC 2NVQC 3H0GK 3M4OC 4QIWL 5C4XC 2GAGC 4A3DK 4KMHA 1USOA 4KM8A 4A3KK 3GEIA 3GTKA 4KATA 2PPBA 2E2IA 3GTMA 2VUMC 3H3VL 2NVYK 2E2HC 3K7AK 3TTGA 2A68A 2V6TA 2NVXK 3AQOA 1J6XA 2B63C 1Y1VK 1TWFA 1SFOC 4C3HK 4X6AK 2VUMA 3GTJK 4A3CC 3G4CA 1XXBA 4GTFA 3FKIC 4LLGA 1F7UA 2EBBA 3BUEA 2O5IA 1USMA 1O24A 3GTGK 3FKIA 4GZYA 5IORA 3HOUK 4LK0A 5IP9K 2E2JK 2R93K 2FQOA 2B63K 4A3GC 3GTGA 4WJ3M 1TWAC 3FOFA 2KWAA 4LOWA 3GTLC 5TJ3A 5IYCK 4JK1A 4A3JK 2JA7A 2R92A 4MEXA 3PO2C 4GTCA 1DD5A 4P5AA 2YU9C 4A3LK 1WSVA 4YFNA 2WAQL 1IBAA 1DCOA 1I50C 1WQFA 3GDZA 3T00A 5C4JC 3GTQC 4AYBL 5IOQA 2PA8L 3L4JA 3GTQA 4BBRC 3HOZK 4KMDA 3S2DK 4BLBA 3PO2K 5FLMC 3L4KA 1O29A 4KB2A 1WIHA 3AQPA 3BP8C 1XZQB 1WOOA 3A8IA 1I3QK 1EQRA 1K83K 3I4MK 3Q3QA 5IOTA 4Y7NK 1IQ0A 4BLAA 1TWAA 1YX2A 3GTLK 2BE5A 5IYCC 3S2HK 1J6VA 3S17C 3RZOC 1TWAK 4BY7C 3V4GA 5C3EK 4AYBD 1KQ4A 4DDQA 3GTGC 2JH3A 3S15C 3GTMC 1ZVUA 2GSUA 3S2HC 4LR2A 2B63A 2RGRA 4Y7NC 2V6SA 1EH1A 2E2HA 2GSNA 4BY7K 1J6WA 3CQZA 5E68A 1TWCA 5TMCA 4QIWD 1YNJA 4AH6A 1Y1WK 1O2BA 3RZDK 1GE9A 1BGWA 3HOWC 3S14C 3GIRA 5IP7K 3GEHA 5CJ9A 4A3MC 1XZPB 1F93A 2NVTK 3AD7C 3GSIA 2R92K 4ILDA 2JA8C 5C4XK 4LK1A 1Y1WC 1VH2A 3GTOA 2D6FC 3H0GC 1I50K 3IPJA 2CFAB 4YFKA 5IP7C 5IYDK 5EGEA 5JFEA 3S1QC 1V5VA 5C44C 4BBSK 4KARA
chains in the Genus database with same CATH topology
3HXAA 1F93A 3JSTA 2V6SA 1DCHA 1RU0A 1USOA 2EBBA 2V6TA 1DCOA 4LOWA 1USMA 2V6UA 1DCPA 4WILA 4C45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXA A;  1F93 A;  3JST A;  2V6S A;  1DCH A;  1RU0 A;  1USO A;  2EBB A;  2V6T A;  1DCO A;  4LOW A;  1USM A;  2V6U A;  1DCP A;  4WIL A;  4C45 A; 
#chains in the Genus database with same CATH topology
 4QJV B;  2YU9 A;  4G7O A;  3T01 A;  4OIO A;  1HQM A;  3N3Y A;  3GTJ A;  4XLP A;  2YU9 K;  4A3G K;  1VGX A;  4A3L C;  3S1N C;  1R9T A;  4BY1 C;  4XSZ A;  1TWH K;  3AD8 C;  3AH5 A;  4J3N A;  4C2M K;  2A6E A;  3GTM K;  2JA7 C;  1WOR A;  4C3I K;  2E2J C;  4A93 K;  5C44 K;  2JA6 K;  2R93 C;  5JVO A;  1IS1 A;  2FQT A;  3NUH A;  3FHZ A;  4FM9 A;  3I4N K;  4A3F K;  3RZO K;  4KB4 A;  4A3E K;  4GTB A;  3K7A C;  1F7V A;  4BBS C;  2JA8 K;  2VUM K;  4KC6 A;  3JST A;  1DCH A;  1WCM C;  1TWG C;  4KAW X;  3LPX A;  4ZH4 A;  5IOS A;  1ISE A;  2A69 A;  4A3K C;  3S16 K;  1X31 C;  3S1M C;  4WJ4 A;  4WIL A;  5C4J K;  1SMY A;  4LQY A;  3OPF A;  5FLM K;  3CQZ K;  3MML B;  4XLN A;  2NVQ K;  3M4O K;  3TFI A;  1EK8 A;  4A3M K;  4GTA A;  2NVT C;  4KDD A;  1WCM K;  1IL2 A;  4PAA A;  1PJ7 A;  4LJZ A;  3EQL A;  1XZP A;  3HOW K;  3S14 K;  4MEY A;  4KN7 A;  3SZY A;  3GTK K;  1Y1V A;  1RU0 A;  4OIN A;  4MQ9 A;  1R9T C;  1VRQ C;  1ZXO A;  3PO3 C;  4C3J C;  5M3F K;  3I4N C;  2PHC B;  3GEE A;  2CFA A;  3HOY K;  4G7H A;  2RH6 A;  1DCP A;  1I50 A;  1BDF A;  1O27 A;  1O2F B;  4A93 C;  5IYB C;  1EFW A;  3S17 K;  3FKI K;  4A3E C;  1WOP A;  1G51 A;  5M3M K;  1L0W A;  4BY1 K;  1PJ6 A;  1TWH A;  3S1N K;  1HI9 A;  2XCR B;  2JA6 C;  5C3E C;  4GTD A;  1I6H C;  4OIQ A;  1VLO A;  3HOX K;  4A3I K;  4C45 A;  4C2M C;  2NVX C;  1TWG A;  3A8K A;  3G4A A;  2E2I K;  1XPP A;  4X6A C;  2R7Z K;  3GTL A;  1IW7 A;  2PA8 D;  1JQW A;  1YCL A;  1ZQ1 C;  5EGH A;  4OIP A;  2P5M A;  2ZUF A;  1TWC C;  3PO3 K;  4Q5S A;  5M5W K;  2R7Z A;  2JA5 K;  2A6H A;  4YG2 A;  3GTP C;  3GTQ K;  4P9S A;  2PMZ L;  3GTK C;  1TWF C;  2JA5 A;  1YNN A;  4BXX K;  2WB1 L;  3HOZ C;  5TMF A;  5L46 A;  1UV7 A;  2R7Z C;  3HOV C;  2CW0 A;  5FJ8 K;  1SFO A;  2XCO A;  3GTP K;  3S1M K;  3QX3 A;  4G7Z A;  2Y3P A;  2O5J A;  4KMU A;  2JA5 C;  2P8T A;  3HKZ L;  1TWC K;  5M5Y K;  3A8J A;  3HKZ D;  2NVY A;  3M3Y K;  3GTP A;  3S0X A;  2NVX A;  4RMF A;  4PAB A;  3S1R C;  2E2I C;  1I3Q A;  3BP3 A;  3RZD C;  1INN A;  1VJE A;  4KAS A;  1TWH C;  4NOI A;  2Y0S L;  5IYB K;  3DXJ A;  5IP9 C;  1O25 A;  3LAP A;  1F9N A;  3HXA A;  1XXA A;  4GT9 A;  4OIR A;  2JA6 A;  1O26 A;  4GTE A;  3OEP A;  2NVY C;  1BS2 A;  2E2H K;  4G0V A;  3GTJ C;  4M1X A;  3H0G A;  3S1R K;  1K83 C;  2ZUE A;  3I4M C;  1SFO K;  1I3Q C;  4P5B A;  4A3B C;  1Y1V C;  2ZFZ A;  2Y0S D;  1C0A A;  4A3D C;  1R9T K;  4FZB A;  4Y52 C;  5HL8 A;  2W7V A;  3AD9 C;  1WSR A;  2R92 C;  4BBR K;  3N0C A;  4XCH A;  1Y1W A;  1TWG K;  4KMA A;  3FOE A;  3M3Y C;  2WB1 D;  3ERE D;  3N0B A;  1I6V A;  3WOD A;  4Y52 K;  4GTL A;  1TWF K;  1WCM A;  3VA7 A;  1XZQ A;  4G0W A;  2GAH C;  3S16 C;  3HOV K;  1BJT A;  4A3B K;  1XXC A;  1J98 A;  3GTO K;  3SZZ A;  4BXX C;  4C3I C;  1IE0 A;  2XCQ A;  1B4B A;  5M5X K;  4YFX A;  3CAG A;  4KM9 A;  4XSX A;  4KN4 A;  5D4D A;  3LAJ A;  3HOX C;  2V6U A;  4A3I C;  1K83 A;  4Q4Z A;  1EI6 A;  1WQH A;  4A3F C;  1WOS A;  3TFH A;  4BKW A;  1AB4 A;  1ZBS A;  4A3J C;  2JA7 K;  1O28 A;  1PJ5 A;  1WQG A;  2R93 A;  2WAQ D;  4G0U A;  4O2D A;  3S15 K;  1I6H K;  4GFQ A;  3HOU C;  1B4A A;  4C3H C;  3S1Q K;  5IYD C;  1ZYR A;  3ADA C;  5CHP A;  1O2A A;  2GSO A;  4A3C K;  2PMZ D;  3H3V D;  1JVI A;  3T02 A;  3ORE A;  1JOE A;  4QJV A;  3TFJ A;  3HOY C;  3S2D C;  3GTO C;  4C3J K;  3CQZ C;  2NVQ C;  3H0G K;  3M4O C;  4QIW L;  5C4X C;  2GAG C;  4A3D K;  4KMH A;  1USO A;  4KM8 A;  4A3K K;  3GEI A;  3GTK A;  4KAT A;  2PPB A;  2E2I A;  3GTM A;  2VUM C;  3H3V L;  2NVY K;  2E2H C;  3K7A K;  3TTG A;  2A68 A;  2V6T A;  2NVX K;  3AQO A;  1J6X A;  2B63 C;  1Y1V K;  1TWF A;  1SFO C;  4C3H K;  4X6A K;  2VUM A;  3GTJ K;  4A3C C;  3G4C A;  1XXB A;  4GTF A;  3FKI C;  4LLG A;  1F7U A;  2EBB A;  3BUE A;  2O5I A;  1USM A;  1O24 A;  3GTG K;  3FKI A;  4GZY A;  5IOR A;  3HOU K;  4LK0 A;  5IP9 K;  2E2J K;  2R93 K;  2FQO A;  2B63 K;  4A3G C;  3GTG A;  4WJ3 M;  1TWA C;  3FOF A;  2KWA A;  4LOW A;  3GTL C;  5TJ3 A;  5IYC K;  4JK1 A;  4A3J K;  2JA7 A;  2R92 A;  4MEX A;  3PO2 C;  4GTC A;  1DD5 A;  4P5A A;  2YU9 C;  4A3L K;  1WSV A;  4YFN A;  2WAQ L;  1IBA A;  1DCO A;  1I50 C;  1WQF A;  3GDZ A;  3T00 A;  5C4J C;  3GTQ C;  4AYB L;  5IOQ A;  2PA8 L;  3L4J A;  3GTQ A;  4BBR C;  3HOZ K;  4KMD A;  3S2D K;  4BLB A;  3PO2 K;  5FLM C;  3L4K A;  1O29 A;  4KB2 A;  1WIH A;  3AQP A;  3BP8 C;  1XZQ B;  1WOO A;  3A8I A;  1I3Q K;  1EQR A;  1K83 K;  3I4M K;  3Q3Q A;  5IOT A;  4Y7N K;  1IQ0 A;  4BLA A;  1TWA A;  1YX2 A;  3GTL K;  2BE5 A;  5IYC C;  3S2H K;  1J6V A;  3S17 C;  3RZO C;  1TWA K;  4BY7 C;  3V4G A;  5C3E K;  4AYB D;  1KQ4 A;  4DDQ A;  3GTG C;  2JH3 A;  3S15 C;  3GTM C;  1ZVU A;  2GSU A;  3S2H C;  4LR2 A;  2B63 A;  2RGR A;  4Y7N C;  2V6S A;  1EH1 A;  2E2H A;  2GSN A;  4BY7 K;  1J6W A;  3CQZ A;  5E68 A;  1TWC A;  5TMC A;  4QIW D;  1YNJ A;  4AH6 A;  1Y1W K;  1O2B A;  3RZD K;  1GE9 A;  1BGW A;  3HOW C;  3S14 C;  3GIR A;  5IP7 K;  3GEH A;  5CJ9 A;  4A3M C;  1XZP B;  1F93 A;  2NVT K;  3AD7 C;  3GSI A;  2R92 K;  4ILD A;  2JA8 C;  5C4X K;  4LK1 A;  1Y1W C;  1VH2 A;  3GTO A;  2D6F C;  3H0G C;  1I50 K;  3IPJ A;  2CFA B;  4YFK A;  5IP7 C;  5IYD K;  5EGE A;  5JFE A;  3S1Q C;  1V5V A;  5C44 C;  4BBS K;  4KAR A; 
#chains in the Genus database with same CATH homology
 3HXA A;  1F93 A;  3JST A;  2V6S A;  1DCH A;  1RU0 A;  1USO A;  2EBB A;  2V6T A;  1DCO A;  4LOW A;  1USM A;  2V6U A;  1DCP A;  4WIL A;  4C45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...