1DCOA

Dcoh, a bifunctional protein-binding transcriptional coactivator
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcriptional stimulator
molecule keywords DCOH
publication title High-resolution structures of the bifunctional enzyme and transcriptional coactivator DCoH and its complex with a product analogue.
pubmed rcsb
source organism Rattus norvegicus
total genus 31
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 1996-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1dcoA00
4C45A 4WILA 2V6SA 1USMA 3JSTA 2V6TA 3HXAA 2EBBA 2V6UA 1DCHA 1F93A 1DCOA 4LOWA 1USOA 1RU0A 1DCPA
chains in the Genus database with same CATH superfamily
4LK0A 4KARA 4C3JC 4A3IK 1ZXOA 5FLMK 3HOZC 2JA8K 2WAQL 4A3GK 1V5VA 2NVTK 3S2DK 4LOWA 1RU0A 4C3JK 3S1RK 2P5MA 3GTJA 5C3EC 1O2AA 1F7VA 4BLAA 4C3HC 4MEXA 1O27A 5CJ9A 2JA6C 4GT9A 3H0GC 4KMUA 2GSUA 3S17C 1TWGA 4C3HK 4QIWL 4YFKA 4YFNA 1BDFA 2R92A 3N0CA 4XCHA 4LJZA 4Q4ZA 1O2FB 1I3QA 3GTKC 3GEEA 4O2DA 4KN4A 2CFAA 4C3IC 1SFOA 2NVXA 2NVQC 2GSOA 1F9NA 2NVQK 4XLPA 1J6WA 4GTEA 1WOPA 4BKWA 2WB1D 3I4MK 3GEIA 1TWAC 3GEHA 2RH6A 4AH6A 2B63K 4KB4A 2E2JC 1I6HK 2A6HA 2E2HC 2E2JK 2XCRB 5IP7C 2E2HK 4AYBD 3GTPA 5E68A 3AD8C 3S2HC 2JA5K 5IYDK 1WSVA 2FQTA 4KAWX 3S2HK 4OIRA 1XZQA 1J6XA 3LPXA 4KMAA 3GSIA 2VUMC 3GTQK 2XCOA 3HOWK 3GTOK 3S16C 3RZOK 3S1MC 5IYBC 3L4KA 3GTMA 3GTQA 3OEPA 3AD7C 1TWCA 4GTAA 1R9TC 1WSRA 4ZH4A 2Y3PA 3FHZA 5CHPA 5HL8A 1BGWA 1AB4A 1R9TK 4A3LC 1F7UA 1HQMA 1K83A 5C4XK 1TWFC 5M5WK 1B4BA 1INNA 3NUHA 1O28A 3TFHA 3WODA 5FJ8K 2PHCB 1VH2A 4KATA 1XXAA 3AQOA 2PA8L 5C4JC 1JVIA 1L0WA 3HOXC 1I50K 4KC6A 3CQZC 4KDDA 4XSZA 1JOEA 3HOXK 1UV7A 4BLBA 1J98A 4BBSC 2D6FC 1WCMA 1TWHC 4G0VA 4BBSK 3A8JA 4YG2A 3S1NC 1ZYRA 4DDQA 3M3YC 4G0WA 5IOTA 3GDZA 1XXBA 3S1NK 4X6AC 1VGXA 3GTGC 2NVYC 4OINA 3M3YK 4X6AK 3GTGK 3HOZK 1PJ7A 4A3FC 5C44C 5EGEA 4A3JC 4KN7A 5C3EK 3Q3QA 2R7ZC 1USMA 1WOSA 4A3JK 4BY1C 1Y1WC 1XZQB 2R7ZK 4KASA 4KM8A 4G7OA 1Y1WK 2JA6K 5TMFA 3H0GK 3S17K 3HOYC 1DCHA 3H3VL 3I4NC 2V6TA 3GTKK 3OREA 4A3KC 3I4NK 2A69A 1I3QC 2JA6A 4C3IK 4A3MC 4G7HA 1GE9A 2R93C 1SFOC 1O26A 3BP8C 3AQPA 4A3MK 4BXXC 3GTKA 3HKZD 2R93K 3GIRA 1YX2A 1DCOA 3EQLA 4JK1A 4A3CC 5TJ3A 1EFWA 4A3CK 2A6EA 3FKIC 3IPJA 5L46A 4WJ3M 4A3BC 1WOOA 3JSTA 4NOIA 4PABA 3T01A 3FKIK 3QX3A 1TWAK 3FOFA 3V4GA 4GTBA 2B63A 2O5IA 3AD9C 4Y52C 5IP7K 3A8IA 3M4OC 1SMYA 1IS1A 3HXAA 4LQYA 2E2IC 2E2HA 1ISEA 2Y0SD 1JQWA 4LLGA 1Y1VC 2E2IK 2JA5A 2GAHC 4OIQA 4LR2A 1WORA 2VUMK 5JVOA 1O24A 2PPBA 5IOSA 3S16K 2JA7C 3S1MK 5IYBK 4Y7NC 3HOUC 3OPFA 1YCLA 3GTOA 2VUMA 4Y7NK 5IORA 3HOUK 4C45A 3TTGA 1ZBSA 2WAQD 1WQFA 2RGRA 4QJVB 4A3LK 5EGHA 4BY7C 4OIPA 4BBRC 1TWFK 1R9TA 2O5JA 1I6VA 1BS2A 3VA7A 3BUEA 4QIWD 3BP3A 4GTLA 1G51A 3G4AA 5C4JK 2PMZL 3CQZK 3H3VD 2YU9C 3HOVC 1YNJA 1I50A 2YU9K 1TWHK 1XZPB 3PO2C 3CQZA 3GTLC 3S0XA 1EK8A 3SZZA 3GTLK 1B4AA 5M5YK 1HI9A 2EBBA 4A3EC 1F93A 2NVYK 1O25A 2ZUFA 4A3FK 5C44K 3GTJC 4Q5SA 2A68A 1WIHA 1DCPA 3GTJK 3GTGA 4BY1K 5FLMC 4G0UA 4A3GC 3S2DC 2NVTC 3S1RC 4A3DC 4OIOA 1TWGC 2R92C 4A3DK 3HOYK 3T00A 2R7ZA 1TWGK 4XSXA 5D4DA 4QJVA 1Y1WA 3H0GA 2R92K 4A3KK 4GTFA 1I3QK 1WQGA 4P9SA 5IOQA 1WQHA 1KQ4A 2NVXC 1SFOK 1USOA 2NVXK 2GAGC 1IE0A 4BXXK 4FZBA 1J6VA 3N0BA 5M3FK 4J3NA 4XLNA 2R93A 3ADAC 1EI6A 1IQ0A 1PJ6A 2KWAA 1XZPA 4A3BK 4FM9A 2ZFZA 3FKIA 3I4MC 1TWAA 4M1XA 2W7VA 4KM9A 4GFQA 1O2BA 2B63C 3GTPC 4Y52K 1BJTA 1IW7A 1I6HC 3M4OK 3GTPK 3S1QC 3S14C 3ERED 2FQOA 2PA8D 3DXJA 3K7AC 1EQRA 2ZUEA 3S1QK 3S14K 1IL2A 1Y1VK 2PMZD 1XPPA 3A8KA 3K7AK 4GZYA 2JA5C 2CW0A 1VJEA 5IYDC 2P8TA 1ZQ1C 2V6UA 4WILA 4KB2A 1PJ5A 2E2IA 5M5XK 4GTDA 5M3MK 4WJ4A 2JH3A 3RZDC 3LAPA 4ILDA 2JA7K 1Y1VA 5TMCA 3GTMC 4G7ZA 1DD5A 3HKZL 3GTQC 3RZDK 1TWCC 4P5AA 3GTMK 3HOWC 3GTOC 2WB1L 3SZYA 3RZOC 1TWCK 1VRQC 2JA7A 1K83C 2BE5A 4LK1A 3G4CA 4BY7K 4RMFA 1K83K 4P5BA 1ZVUA 3CAGA 4BBRK 4YFXA 1O29A 5IYCC 1C0AA 5IYCK 1TWFA 3TFJA 5C4XC 4GTCA 4AYBL 3PO3C 2CFAB 4MQ9A 4A93C 3FOEA 4PAAA 3PO3K 3LAJA 3HOVK 4A93K 1WCMC 1I50C 3AH5A 3S15C 2Y0SL 1WCMK 3MMLB 4MEYA 1X31C 3N3YA 3TFIA 4C2MC 3PO2K 2GSNA 1VLOA 3S15K 2YU9A 3L4JA 1TWHA 4C2MK 2XCQA 3T02A 4KMHA 5IP9C 4A3EK 3GTLA 1IBAA 1EH1A 1XXCA 5IP9K 2V6SA 4KMDA 4A3IC 2NVYA 5JFEA 2JA8C 1YNNA
chains in the Genus database with same CATH topology
4C45A 4WILA 2V6SA 1USMA 3JSTA 2V6TA 3HXAA 2EBBA 2V6UA 1DCHA 1F93A 1DCOA 4LOWA 1USOA 1RU0A 1DCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C45 A;  4WIL A;  2V6S A;  1USM A;  3JST A;  2V6T A;  3HXA A;  2EBB A;  2V6U A;  1DCH A;  1F93 A;  1DCO A;  4LOW A;  1USO A;  1RU0 A;  1DCP A; 
#chains in the Genus database with same CATH topology
 4LK0 A;  4KAR A;  4C3J C;  4A3I K;  1ZXO A;  5FLM K;  3HOZ C;  2JA8 K;  2WAQ L;  4A3G K;  1V5V A;  2NVT K;  3S2D K;  4LOW A;  1RU0 A;  4C3J K;  3S1R K;  2P5M A;  3GTJ A;  5C3E C;  1O2A A;  1F7V A;  4BLA A;  4C3H C;  4MEX A;  1O27 A;  5CJ9 A;  2JA6 C;  4GT9 A;  3H0G C;  4KMU A;  2GSU A;  3S17 C;  1TWG A;  4C3H K;  4QIW L;  4YFK A;  4YFN A;  1BDF A;  2R92 A;  3N0C A;  4XCH A;  4LJZ A;  4Q4Z A;  1O2F B;  1I3Q A;  3GTK C;  3GEE A;  4O2D A;  4KN4 A;  2CFA A;  4C3I C;  1SFO A;  2NVX A;  2NVQ C;  2GSO A;  1F9N A;  2NVQ K;  4XLP A;  1J6W A;  4GTE A;  1WOP A;  4BKW A;  2WB1 D;  3I4M K;  3GEI A;  1TWA C;  3GEH A;  2RH6 A;  4AH6 A;  2B63 K;  4KB4 A;  2E2J C;  1I6H K;  2A6H A;  2E2H C;  2E2J K;  2XCR B;  5IP7 C;  2E2H K;  4AYB D;  3GTP A;  5E68 A;  3AD8 C;  3S2H C;  2JA5 K;  5IYD K;  1WSV A;  2FQT A;  4KAW X;  3S2H K;  4OIR A;  1XZQ A;  1J6X A;  3LPX A;  4KMA A;  3GSI A;  2VUM C;  3GTQ K;  2XCO A;  3HOW K;  3GTO K;  3S16 C;  3RZO K;  3S1M C;  5IYB C;  3L4K A;  3GTM A;  3GTQ A;  3OEP A;  3AD7 C;  1TWC A;  4GTA A;  1R9T C;  1WSR A;  4ZH4 A;  2Y3P A;  3FHZ A;  5CHP A;  5HL8 A;  1BGW A;  1AB4 A;  1R9T K;  4A3L C;  1F7U A;  1HQM A;  1K83 A;  5C4X K;  1TWF C;  5M5W K;  1B4B A;  1INN A;  3NUH A;  1O28 A;  3TFH A;  3WOD A;  5FJ8 K;  2PHC B;  1VH2 A;  4KAT A;  1XXA A;  3AQO A;  2PA8 L;  5C4J C;  1JVI A;  1L0W A;  3HOX C;  1I50 K;  4KC6 A;  3CQZ C;  4KDD A;  4XSZ A;  1JOE A;  3HOX K;  1UV7 A;  4BLB A;  1J98 A;  4BBS C;  2D6F C;  1WCM A;  1TWH C;  4G0V A;  4BBS K;  3A8J A;  4YG2 A;  3S1N C;  1ZYR A;  4DDQ A;  3M3Y C;  4G0W A;  5IOT A;  3GDZ A;  1XXB A;  3S1N K;  4X6A C;  1VGX A;  3GTG C;  2NVY C;  4OIN A;  3M3Y K;  4X6A K;  3GTG K;  3HOZ K;  1PJ7 A;  4A3F C;  5C44 C;  5EGE A;  4A3J C;  4KN7 A;  5C3E K;  3Q3Q A;  2R7Z C;  1USM A;  1WOS A;  4A3J K;  4BY1 C;  1Y1W C;  1XZQ B;  2R7Z K;  4KAS A;  4KM8 A;  4G7O A;  1Y1W K;  2JA6 K;  5TMF A;  3H0G K;  3S17 K;  3HOY C;  1DCH A;  3H3V L;  3I4N C;  2V6T A;  3GTK K;  3ORE A;  4A3K C;  3I4N K;  2A69 A;  1I3Q C;  2JA6 A;  4C3I K;  4A3M C;  4G7H A;  1GE9 A;  2R93 C;  1SFO C;  1O26 A;  3BP8 C;  3AQP A;  4A3M K;  4BXX C;  3GTK A;  3HKZ D;  2R93 K;  3GIR A;  1YX2 A;  1DCO A;  3EQL A;  4JK1 A;  4A3C C;  5TJ3 A;  1EFW A;  4A3C K;  2A6E A;  3FKI C;  3IPJ A;  5L46 A;  4WJ3 M;  4A3B C;  1WOO A;  3JST A;  4NOI A;  4PAB A;  3T01 A;  3FKI K;  3QX3 A;  1TWA K;  3FOF A;  3V4G A;  4GTB A;  2B63 A;  2O5I A;  3AD9 C;  4Y52 C;  5IP7 K;  3A8I A;  3M4O C;  1SMY A;  1IS1 A;  3HXA A;  4LQY A;  2E2I C;  2E2H A;  1ISE A;  2Y0S D;  1JQW A;  4LLG A;  1Y1V C;  2E2I K;  2JA5 A;  2GAH C;  4OIQ A;  4LR2 A;  1WOR A;  2VUM K;  5JVO A;  1O24 A;  2PPB A;  5IOS A;  3S16 K;  2JA7 C;  3S1M K;  5IYB K;  4Y7N C;  3HOU C;  3OPF A;  1YCL A;  3GTO A;  2VUM A;  4Y7N K;  5IOR A;  3HOU K;  4C45 A;  3TTG A;  1ZBS A;  2WAQ D;  1WQF A;  2RGR A;  4QJV B;  4A3L K;  5EGH A;  4BY7 C;  4OIP A;  4BBR C;  1TWF K;  1R9T A;  2O5J A;  1I6V A;  1BS2 A;  3VA7 A;  3BUE A;  4QIW D;  3BP3 A;  4GTL A;  1G51 A;  3G4A A;  5C4J K;  2PMZ L;  3CQZ K;  3H3V D;  2YU9 C;  3HOV C;  1YNJ A;  1I50 A;  2YU9 K;  1TWH K;  1XZP B;  3PO2 C;  3CQZ A;  3GTL C;  3S0X A;  1EK8 A;  3SZZ A;  3GTL K;  1B4A A;  5M5Y K;  1HI9 A;  2EBB A;  4A3E C;  1F93 A;  2NVY K;  1O25 A;  2ZUF A;  4A3F K;  5C44 K;  3GTJ C;  4Q5S A;  2A68 A;  1WIH A;  1DCP A;  3GTJ K;  3GTG A;  4BY1 K;  5FLM C;  4G0U A;  4A3G C;  3S2D C;  2NVT C;  3S1R C;  4A3D C;  4OIO A;  1TWG C;  2R92 C;  4A3D K;  3HOY K;  3T00 A;  2R7Z A;  1TWG K;  4XSX A;  5D4D A;  4QJV A;  1Y1W A;  3H0G A;  2R92 K;  4A3K K;  4GTF A;  1I3Q K;  1WQG A;  4P9S A;  5IOQ A;  1WQH A;  1KQ4 A;  2NVX C;  1SFO K;  1USO A;  2NVX K;  2GAG C;  1IE0 A;  4BXX K;  4FZB A;  1J6V A;  3N0B A;  5M3F K;  4J3N A;  4XLN A;  2R93 A;  3ADA C;  1EI6 A;  1IQ0 A;  1PJ6 A;  2KWA A;  1XZP A;  4A3B K;  4FM9 A;  2ZFZ A;  3FKI A;  3I4M C;  1TWA A;  4M1X A;  2W7V A;  4KM9 A;  4GFQ A;  1O2B A;  2B63 C;  3GTP C;  4Y52 K;  1BJT A;  1IW7 A;  1I6H C;  3M4O K;  3GTP K;  3S1Q C;  3S14 C;  3ERE D;  2FQO A;  2PA8 D;  3DXJ A;  3K7A C;  1EQR A;  2ZUE A;  3S1Q K;  3S14 K;  1IL2 A;  1Y1V K;  2PMZ D;  1XPP A;  3A8K A;  3K7A K;  4GZY A;  2JA5 C;  2CW0 A;  1VJE A;  5IYD C;  2P8T A;  1ZQ1 C;  2V6U A;  4WIL A;  4KB2 A;  1PJ5 A;  2E2I A;  5M5X K;  4GTD A;  5M3M K;  4WJ4 A;  2JH3 A;  3RZD C;  3LAP A;  4ILD A;  2JA7 K;  1Y1V A;  5TMC A;  3GTM C;  4G7Z A;  1DD5 A;  3HKZ L;  3GTQ C;  3RZD K;  1TWC C;  4P5A A;  3GTM K;  3HOW C;  3GTO C;  2WB1 L;  3SZY A;  3RZO C;  1TWC K;  1VRQ C;  2JA7 A;  1K83 C;  2BE5 A;  4LK1 A;  3G4C A;  4BY7 K;  4RMF A;  1K83 K;  4P5B A;  1ZVU A;  3CAG A;  4BBR K;  4YFX A;  1O29 A;  5IYC C;  1C0A A;  5IYC K;  1TWF A;  3TFJ A;  5C4X C;  4GTC A;  4AYB L;  3PO3 C;  2CFA B;  4MQ9 A;  4A93 C;  3FOE A;  4PAA A;  3PO3 K;  3LAJ A;  3HOV K;  4A93 K;  1WCM C;  1I50 C;  3AH5 A;  3S15 C;  2Y0S L;  1WCM K;  3MML B;  4MEY A;  1X31 C;  3N3Y A;  3TFI A;  4C2M C;  3PO2 K;  2GSN A;  1VLO A;  3S15 K;  2YU9 A;  3L4J A;  1TWH A;  4C2M K;  2XCQ A;  3T02 A;  4KMH A;  5IP9 C;  4A3E K;  3GTL A;  1IBA A;  1EH1 A;  1XXC A;  5IP9 K;  2V6S A;  4KMD A;  4A3I C;  2NVY A;  5JFE A;  2JA8 C;  1YNN A; 
#chains in the Genus database with same CATH homology
 4C45 A;  4WIL A;  2V6S A;  1USM A;  3JST A;  2V6T A;  3HXA A;  2EBB A;  2V6U A;  1DCH A;  1F93 A;  1DCO A;  4LOW A;  1USO A;  1RU0 A;  1DCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...