4LOWA

Structure and identification of a pterin dehydratase-like protein as a rubisco assembly factor in the alpha-carboxysome
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
84
Chain Sequence
HHHHHHSWREQGKPPMLFKRFAFGSYAQTRAFLDALAALSEETGQHPQNINFGTTYVNITLDAATLGEAERAFAARVDALAGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Identification of a Pterin Dehydratase-like Protein as a Ribulose-bisphosphate Carboxylase/Oxygenase (RuBisCO) Assembly Factor in the alpha-Carboxysome.
pubmed doi rcsb
source organism Thiomonas intermedia
molecule tags Unknown function
molecule keywords acRAF
total genus 26
structure length 84
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4lowA00
2V6UA 4LOWA 1DCOA 2EBBA 1F93A 2V6TA 4WILA 1USOA 3HXAA 4C45A 2V6SA 1DCPA 1RU0A 1DCHA 1USMA 3JSTA
chains in the Genus database with same CATH superfamily
3AQOA 2XCOA 5EGEA 3BP8C 1Y1VC 2ZUEA 4A3CC 1V5VA 3S1QC 2CW0A 3FHZA 2B63K 1VRQC 2E2JK 3S1RK 1Y1VA 1WORA 4A3DK 1Y1VK 1XXBA 3FKIK 4KATA 1DD5A 2WAQD 4FM9A 2E2IK 4A3DC 1HI9A 1IQ0A 2NVYK 2A69A 4A3FC 4C2MC 4BXXC 2Y0SL 3FOEA 1O24A 1YCLA 1TWGA 4WJ3M 3IPJA 3GEHA 5IP7C 4A3GC 4KC6A 4ZH4A 4KDDA 1I3QA 4OIRA 2NVQK 2JA8K 1O2FB 5IYCC 2YU9C 2ZFZA 1EQRA 1XPPA 3M3YK 4C3JK 1TWFK 4LJZA 3JSTA 4A3FK 5TMCA 2JA6C 5IOQA 1K83C 2R92A 3N3YA 1IS1A 1EK8A 4BBRC 4WJ4A 4FZBA 1I6VA 2GSOA 5L46A 5IP9C 4OIPA 4QIWL 1IE0A 4A3BC 1WOOA 1PJ5A 3ADAC 5IYDC 4BKWA 2R7ZC 2E2JC 4KB4A 3H0GK 3V4GA 5JFEA 3A8IA 3CQZK 2R7ZA 4LQYA 3RZOK 4M1XA 3TTGA 3GTPK 1TWGC 5FJ8K 2A6HA 3HKZL 1I3QC 4KAWX 3NUHA 3GTQC 3HOXC 3GTQA 2RH6A 4A93C 1VGXA 3M3YC 1ZVUA 1TWAA 4YG2A 1WOSA 4A3EK 1EFWA 1DCPA 2NVXC 4PABA 3PO3C 5E68A 3M4OC 3HOVK 4C3IK 4ILDA 4AYBD 3OREA 2NVTC 3HOZK 4C3HK 4OINA 1C0AA 2R93A 1ZBSA 1IW7A 3GTOC 3N0CA 3K7AC 4O2DA 3S17C 3GTMA 5EGHA 3T00A 5C3EC 2JA7K 1PJ6A 1WQFA 2R7ZK 3WODA 5IYBK 3VA7A 3S1MC 1WCMA 4WILA 1R9TK 1I50A 3I4MC 3ERED 4A3BK 3PO2C 4LK1A 5IOSA 1O28A 3S1NC 3S1QK 4A3IK 3H3VL 5C4XC 2W7VA 5HL8A 4G0WA 1B4BA 1JOEA 4A3JC 1ISEA 3LAPA 3GTMK 4KB2A 3HOVC 4GTFA 4GT9A 2VUMA 3FOFA 2VUMK 4LLGA 1I6HC 3CQZA 4LOWA 2WAQL 4GFQA 2KWAA 1J6XA 2NVQC 1J6WA 2JA8C 4MEXA 1EI6A 4GTLA 1J98A 4Y7NC 4A3KK 1O2AA 4G7ZA 4BLBA 3BUEA 1X31C 4A3GK 3TFJA 1F7UA 3S14K 4LK0A 1I3QK 1F9NA 1TWCC 1YX2A 3GDZA 1ZYRA 4GTDA 3TFIA 2R92C 3OEPA 1KQ4A 4BLAA 1O2BA 2JA6K 3CQZC 4X6AC 1DCHA 2GSUA 1HQMA 1O26A 4GTCA 4DDQA 3T01A 1ZXOA 2R92K 2PA8D 5M3MK 1XZPB 3MMLB 3RZDK 5TJ3A 3G4AA 2E2HK 4KM9A 4A3LC 4BY7K 1USMA 3GTOK 3HOUK 4Y7NK 1K83A 4Y52C 3I4NC 1VLOA 2RGRA 2A6EA 5FLMC 1I50C 3LAJA 5TMFA 4MEYA 2A68A 3HOZC 1JQWA 4A3EC 2NVXK 4BXXK 5CJ9A 1BS2A 1WSRA 1BDFA 2Y0SD 3GTGK 2NVYC 4BBSK 4GTBA 4BY7C 1VJEA 3GTJC 1SFOA 2XCRB 1TWCA 4A3MC 2NVYA 5IP7K 3H0GC 3RZDC 3N0BA 1TWAC 2PHCB 2R93K 3GTOA 4BY1K 1K83K 3A8JA 4XSXA 2O5IA 1VH2A 3Q3QA 3I4MK 3S14C 4QIWD 4XLPA 4A3IC 4GTAA 3S1NK 3AD8C 1TWCK 2NVXA 1YNJA 2EBBA 1ZQ1C 1XZQB 4C45A 2PA8L 3HKZD 4G0VA 4C3IC 1WCMC 3GTLA 1WIHA 3GTLK 5FLMK 1G51A 3HOYK 2O5JA 1PJ7A 3GTJK 3GTJA 1WOPA 1WQGA 2CFAA 1INNA 1J6VA 4C2MK 4X6AK 3FKIC 1TWGK 2E2IC 1JVIA 3AH5A 3S0XA 3S15C 3GEEA 4MQ9A 5M3FK 1Y1WK 3OPFA 2CFAB 4AYBL 4YFXA 4KMAA 3GTGA 2JA5A 1F7VA 2JH3A 1TWAK 3H3VD 2FQTA 1Y1WC 1TWHK 5C3EK 3TFHA 4BBSC 1YNNA 5CHPA 5IYBC 3S1MK 4KMHA 4KARA 4OIQA 3GTLC 5JVOA 1GE9A 4C3JC 1XZPA 1R9TC 4KMDA 4AH6A 2JA7A 2D6FC 2JA6A 3H0GA 1EH1A 3A8KA 3L4JA 1TWFC 4Q4ZA 4BBRK 1WQHA 1L0WA 4G7HA 2BE5A 3AD7C 2WB1D 4KASA 1I50K 2B63A 2GSNA 4LR2A 3GTQK 2VUMC 4P5AA 5C4XK 2JA5K 5IYCK 1O25A 2YU9K 3GTKA 4A93K 4XCHA 3S2DK 4JK1A 3S2HK 4J3NA 1WSVA 5IORA 4G7OA 3T02A 4KN7A 3RZOC 3GIRA 1B4AA 2FQOA 3AQPA 1DCOA 2GAGC 1F93A 4P5BA 3BP3A 3GEIA 3L4KA 2P5MA 3SZZA 3K7AK 2WB1L 3HXAA 2P8TA 4Q5SA 5C44C 1SFOC 1BJTA 2JA7C 5C4JK 1R9TA 2GAHC 2V6TA 1TWFA 4OIOA 2R93C 1IL2A 2B63C 3LPXA 1TWHA 2V6UA 4P9SA 3S16K 4PAAA 1SMYA 3S17K 3GTKK 1XZQA 4YFNA 3S2DC 5M5YK 4GZYA 4Y52K 3GTGC 4GTEA 5IOTA 3GTKC 3QX3A 2V6SA 5C4JC 3AD9C 1AB4A 3G4CA 4A3LK 4A3JK 1XXCA 1O27A 1I6HK 1WCMK 3GTMC 3GTPA 5C44K 1SFOK 4XLNA 2E2HA 4NOIA 5IP9K 1XXAA 5IYDK 3GTPC 3HOUC 2YU9A 3SZYA 2XCQA 3S1RC 5D4DA 4YFKA 1TWHC 3PO2K 3HOWC 3DXJA 3S15K 5M5XK 4A3CK 4RMFA 4KN4A 4QJVB 2Y3PA 4G0UA 3S2HC 3HOWK 3CAGA 1USOA 1Y1WA 2PPBA 2PMZL 3GSIA 1O29A 4XSZA 2JA5C 3FKIA 2NVTK 4A3MK 4C3HC 1RU0A 3HOYC 5M5WK 4QJVA 4KMUA 3PO3K 3M4OK 1UV7A 1BGWA 3HOXK 4KM8A 4BY1C 4A3KC 1IBAA 2E2IA 3S16C 3EQLA 2ZUFA 2E2HC 3I4NK 2PMZD
chains in the Genus database with same CATH topology
2V6UA 4LOWA 1DCOA 2EBBA 1F93A 2V6TA 4WILA 1USOA 3HXAA 4C45A 2V6SA 1DCPA 1RU0A 1DCHA 1USMA 3JSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6U A;  4LOW A;  1DCO A;  2EBB A;  1F93 A;  2V6T A;  4WIL A;  1USO A;  3HXA A;  4C45 A;  2V6S A;  1DCP A;  1RU0 A;  1DCH A;  1USM A;  3JST A; 
#chains in the Genus database with same CATH topology
 3AQO A;  2XCO A;  5EGE A;  3BP8 C;  1Y1V C;  2ZUE A;  4A3C C;  1V5V A;  3S1Q C;  2CW0 A;  3FHZ A;  2B63 K;  1VRQ C;  2E2J K;  3S1R K;  1Y1V A;  1WOR A;  4A3D K;  1Y1V K;  1XXB A;  3FKI K;  4KAT A;  1DD5 A;  2WAQ D;  4FM9 A;  2E2I K;  4A3D C;  1HI9 A;  1IQ0 A;  2NVY K;  2A69 A;  4A3F C;  4C2M C;  4BXX C;  2Y0S L;  3FOE A;  1O24 A;  1YCL A;  1TWG A;  4WJ3 M;  3IPJ A;  3GEH A;  5IP7 C;  4A3G C;  4KC6 A;  4ZH4 A;  4KDD A;  1I3Q A;  4OIR A;  2NVQ K;  2JA8 K;  1O2F B;  5IYC C;  2YU9 C;  2ZFZ A;  1EQR A;  1XPP A;  3M3Y K;  4C3J K;  1TWF K;  4LJZ A;  3JST A;  4A3F K;  5TMC A;  2JA6 C;  5IOQ A;  1K83 C;  2R92 A;  3N3Y A;  1IS1 A;  1EK8 A;  4BBR C;  4WJ4 A;  4FZB A;  1I6V A;  2GSO A;  5L46 A;  5IP9 C;  4OIP A;  4QIW L;  1IE0 A;  4A3B C;  1WOO A;  1PJ5 A;  3ADA C;  5IYD C;  4BKW A;  2R7Z C;  2E2J C;  4KB4 A;  3H0G K;  3V4G A;  5JFE A;  3A8I A;  3CQZ K;  2R7Z A;  4LQY A;  3RZO K;  4M1X A;  3TTG A;  3GTP K;  1TWG C;  5FJ8 K;  2A6H A;  3HKZ L;  1I3Q C;  4KAW X;  3NUH A;  3GTQ C;  3HOX C;  3GTQ A;  2RH6 A;  4A93 C;  1VGX A;  3M3Y C;  1ZVU A;  1TWA A;  4YG2 A;  1WOS A;  4A3E K;  1EFW A;  1DCP A;  2NVX C;  4PAB A;  3PO3 C;  5E68 A;  3M4O C;  3HOV K;  4C3I K;  4ILD A;  4AYB D;  3ORE A;  2NVT C;  3HOZ K;  4C3H K;  4OIN A;  1C0A A;  2R93 A;  1ZBS A;  1IW7 A;  3GTO C;  3N0C A;  3K7A C;  4O2D A;  3S17 C;  3GTM A;  5EGH A;  3T00 A;  5C3E C;  2JA7 K;  1PJ6 A;  1WQF A;  2R7Z K;  3WOD A;  5IYB K;  3VA7 A;  3S1M C;  1WCM A;  4WIL A;  1R9T K;  1I50 A;  3I4M C;  3ERE D;  4A3B K;  3PO2 C;  4LK1 A;  5IOS A;  1O28 A;  3S1N C;  3S1Q K;  4A3I K;  3H3V L;  5C4X C;  2W7V A;  5HL8 A;  4G0W A;  1B4B A;  1JOE A;  4A3J C;  1ISE A;  3LAP A;  3GTM K;  4KB2 A;  3HOV C;  4GTF A;  4GT9 A;  2VUM A;  3FOF A;  2VUM K;  4LLG A;  1I6H C;  3CQZ A;  4LOW A;  2WAQ L;  4GFQ A;  2KWA A;  1J6X A;  2NVQ C;  1J6W A;  2JA8 C;  4MEX A;  1EI6 A;  4GTL A;  1J98 A;  4Y7N C;  4A3K K;  1O2A A;  4G7Z A;  4BLB A;  3BUE A;  1X31 C;  4A3G K;  3TFJ A;  1F7U A;  3S14 K;  4LK0 A;  1I3Q K;  1F9N A;  1TWC C;  1YX2 A;  3GDZ A;  1ZYR A;  4GTD A;  3TFI A;  2R92 C;  3OEP A;  1KQ4 A;  4BLA A;  1O2B A;  2JA6 K;  3CQZ C;  4X6A C;  1DCH A;  2GSU A;  1HQM A;  1O26 A;  4GTC A;  4DDQ A;  3T01 A;  1ZXO A;  2R92 K;  2PA8 D;  5M3M K;  1XZP B;  3MML B;  3RZD K;  5TJ3 A;  3G4A A;  2E2H K;  4KM9 A;  4A3L C;  4BY7 K;  1USM A;  3GTO K;  3HOU K;  4Y7N K;  1K83 A;  4Y52 C;  3I4N C;  1VLO A;  2RGR A;  2A6E A;  5FLM C;  1I50 C;  3LAJ A;  5TMF A;  4MEY A;  2A68 A;  3HOZ C;  1JQW A;  4A3E C;  2NVX K;  4BXX K;  5CJ9 A;  1BS2 A;  1WSR A;  1BDF A;  2Y0S D;  3GTG K;  2NVY C;  4BBS K;  4GTB A;  4BY7 C;  1VJE A;  3GTJ C;  1SFO A;  2XCR B;  1TWC A;  4A3M C;  2NVY A;  5IP7 K;  3H0G C;  3RZD C;  3N0B A;  1TWA C;  2PHC B;  2R93 K;  3GTO A;  4BY1 K;  1K83 K;  3A8J A;  4XSX A;  2O5I A;  1VH2 A;  3Q3Q A;  3I4M K;  3S14 C;  4QIW D;  4XLP A;  4A3I C;  4GTA A;  3S1N K;  3AD8 C;  1TWC K;  2NVX A;  1YNJ A;  2EBB A;  1ZQ1 C;  1XZQ B;  4C45 A;  2PA8 L;  3HKZ D;  4G0V A;  4C3I C;  1WCM C;  3GTL A;  1WIH A;  3GTL K;  5FLM K;  1G51 A;  3HOY K;  2O5J A;  1PJ7 A;  3GTJ K;  3GTJ A;  1WOP A;  1WQG A;  2CFA A;  1INN A;  1J6V A;  4C2M K;  4X6A K;  3FKI C;  1TWG K;  2E2I C;  1JVI A;  3AH5 A;  3S0X A;  3S15 C;  3GEE A;  4MQ9 A;  5M3F K;  1Y1W K;  3OPF A;  2CFA B;  4AYB L;  4YFX A;  4KMA A;  3GTG A;  2JA5 A;  1F7V A;  2JH3 A;  1TWA K;  3H3V D;  2FQT A;  1Y1W C;  1TWH K;  5C3E K;  3TFH A;  4BBS C;  1YNN A;  5CHP A;  5IYB C;  3S1M K;  4KMH A;  4KAR A;  4OIQ A;  3GTL C;  5JVO A;  1GE9 A;  4C3J C;  1XZP A;  1R9T C;  4KMD A;  4AH6 A;  2JA7 A;  2D6F C;  2JA6 A;  3H0G A;  1EH1 A;  3A8K A;  3L4J A;  1TWF C;  4Q4Z A;  4BBR K;  1WQH A;  1L0W A;  4G7H A;  2BE5 A;  3AD7 C;  2WB1 D;  4KAS A;  1I50 K;  2B63 A;  2GSN A;  4LR2 A;  3GTQ K;  2VUM C;  4P5A A;  5C4X K;  2JA5 K;  5IYC K;  1O25 A;  2YU9 K;  3GTK A;  4A93 K;  4XCH A;  3S2D K;  4JK1 A;  3S2H K;  4J3N A;  1WSV A;  5IOR A;  4G7O A;  3T02 A;  4KN7 A;  3RZO C;  3GIR A;  1B4A A;  2FQO A;  3AQP A;  1DCO A;  2GAG C;  1F93 A;  4P5B A;  3BP3 A;  3GEI A;  3L4K A;  2P5M A;  3SZZ A;  3K7A K;  2WB1 L;  3HXA A;  2P8T A;  4Q5S A;  5C44 C;  1SFO C;  1BJT A;  2JA7 C;  5C4J K;  1R9T A;  2GAH C;  2V6T A;  1TWF A;  4OIO A;  2R93 C;  1IL2 A;  2B63 C;  3LPX A;  1TWH A;  2V6U A;  4P9S A;  3S16 K;  4PAA A;  1SMY A;  3S17 K;  3GTK K;  1XZQ A;  4YFN A;  3S2D C;  5M5Y K;  4GZY A;  4Y52 K;  3GTG C;  4GTE A;  5IOT A;  3GTK C;  3QX3 A;  2V6S A;  5C4J C;  3AD9 C;  1AB4 A;  3G4C A;  4A3L K;  4A3J K;  1XXC A;  1O27 A;  1I6H K;  1WCM K;  3GTM C;  3GTP A;  5C44 K;  1SFO K;  4XLN A;  2E2H A;  4NOI A;  5IP9 K;  1XXA A;  5IYD K;  3GTP C;  3HOU C;  2YU9 A;  3SZY A;  2XCQ A;  3S1R C;  5D4D A;  4YFK A;  1TWH C;  3PO2 K;  3HOW C;  3DXJ A;  3S15 K;  5M5X K;  4A3C K;  4RMF A;  4KN4 A;  4QJV B;  2Y3P A;  4G0U A;  3S2H C;  3HOW K;  3CAG A;  1USO A;  1Y1W A;  2PPB A;  2PMZ L;  3GSI A;  1O29 A;  4XSZ A;  2JA5 C;  3FKI A;  2NVT K;  4A3M K;  4C3H C;  1RU0 A;  3HOY C;  5M5W K;  4QJV A;  4KMU A;  3PO3 K;  3M4O K;  1UV7 A;  1BGW A;  3HOX K;  4KM8 A;  4BY1 C;  4A3K C;  1IBA A;  2E2I A;  3S16 C;  3EQL A;  2ZUF A;  2E2H C;  3I4N K;  2PMZ D; 
#chains in the Genus database with same CATH homology
 2V6U A;  4LOW A;  1DCO A;  2EBB A;  1F93 A;  2V6T A;  4WIL A;  1USO A;  3HXA A;  4C45 A;  2V6S A;  1DCP A;  1RU0 A;  1DCH A;  1USM A;  3JST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...