4LOWA

Structure and identification of a pterin dehydratase-like protein as a rubisco assembly factor in the alpha-carboxysome
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
84
Chain Sequence
HHHHHHSWREQGKPPMLFKRFAFGSYAQTRAFLDALAALSEETGQHPQNINFGTTYVNITLDAATLGEAERAFAARVDALAGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords acRAF
publication title Structure and Identification of a Pterin Dehydratase-like Protein as a Ribulose-bisphosphate Carboxylase/Oxygenase (RuBisCO) Assembly Factor in the alpha-Carboxysome.
pubmed doi rcsb
source organism Thiomonas intermedia
total genus 26
structure length 84
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4lowA00
3HXAA 4WILA 1USMA 1RU0A 1DCHA 1F93A 2V6SA 1DCOA 2V6TA 2EBBA 1USOA 3JSTA 4C45A 2V6UA 1DCPA 4LOWA
chains in the Genus database with same CATH superfamily
1YCLA 3S1NK 5IYDC 5IOQA 4A3GC 3S0XA 3M3YC 3S1RK 1KQ4A 3WODA 2VUMK 3H0GA 4AYBD 3OEPA 3HOWK 2A69A 4BBRC 5IP7C 3GTGC 1XZPB 1C0AA 2FQTA 2V6UA 3S2HC 1TWAA 5M5WK 1WORA 3GTJK 1O28A 4LOWA 1WQHA 4A3FK 1TWFC 2E2IC 2V6SA 4AH6A 5CJ9A 2V6TA 3I4MK 1USOA 5M3FK 2VUMA 4OIPA 2O5JA 1X31C 2JA7K 1O2AA 1I3QK 1WSRA 3TTGA 2NVQK 2Y0SD 1IQ0A 5M5YK 4GTLA 1USMA 4XSZA 1J98A 3A8KA 4A3EK 4GTBA 4XCHA 1ZXOA 3TFJA 5M5XK 3SZZA 1O2BA 4YG2A 3IPJA 4KM8A 1PJ6A 3AQOA 3GTJA 2E2HC 3GTOK 1BJTA 2GAHC 1TWGK 2KWAA 2GAGC 4KAWX 5IYDK 5IOTA 4A3GK 1O27A 3A8IA 3M4OC 3GTKC 3M3YK 2O5IA 4KM9A 3G4AA 2JA7A 2Y0SL 1I3QA 3GEEA 1WSVA 1WQGA 3S2DC 4LK1A 3S1MC 1XXAA 4BY7C 2PHCB 4BBRK 1O2FB 1F93A 3PO2C 3S15C 3AD9C 2NVXC 2JA5C 3GTOA 3S2HK 4A3KC 1TWGA 1BGWA 3GTPC 3LPXA 4KATA 4KN4A 1VJEA 4JK1A 4QJVA 2E2IK 1O26A 1PJ5A 1TWHC 4A3DC 4C3HC 3N3YA 3GTGA 3NUHA 3RZDC 3I4NC 4NOIA 1XZQB 3Q3QA 2R7ZC 3FOFA 5IYBC 4LQYA 4GTEA 4G0VA 2ZUEA 2E2HK 1XPPA 4GT9A 4BBSC 3GSIA 1TWFA 1EK8A 3G4CA 2E2IA 2A6EA 3S14C 2JH3A 2WB1L 1ZVUA 4MEYA 4G7ZA 3GTKK 3M4OK 3H3VL 4KB4A 1J6XA 3S17C 4OIRA 3GIRA 3S2DK 4XSXA 3S1MK 2GSNA 1R9TC 4BY7K 5HL8A 4OIQA 4BXXC 3FHZA 1JOEA 4YFNA 3PO2K 3S15K 1AB4A 2NVXK 4LK0A 3GTMC 2JA5K 1TWCC 4OIOA 4A3KK 3GTPK 4Q4ZA 4P5BA 3GTKA 1O24A 1SMYA 3T02A 4M1XA 4G0UA 1EI6A 4KN7A 4KMUA 2CFAA 1TWHK 4A3DK 4A93C 3CQZC 4C3HK 4A3CC 4A3JC 1SFOC 4MQ9A 3RZDK 3I4NK 2NVXA 4A3LC 1DCHA 2RH6A 2JA5A 2R7ZK 4C3JC 5IYBK 5E68A 3GEIA 3HKZL 1ISEA 3GTPA 3OREA 4GFQA 1RU0A 3HOYC 1VGXA 4BBSK 2CW0A 1ZQ1C 3S14K 3N0BA 5IOSA 2JA8C 3BP8C 1TWHA 5M3MK 2CFAB 3OPFA 4FM9A 3S17K 1G51A 4GTAA 1VRQC 1IE0A 1VH2A 2A68A 1R9TK 2YU9C 4BXXK 2R7ZA 3ADAC 1IS1A 1I50C 1ZBSA 3AH5A 4A3IC 3GTMK 1DCOA 1I6VA 4A3BK 1GE9A 1TWCK 4WJ3M 5FLMC 4A3MK 1WQFA 3K7AC 2XCRB 1EH1A 3RZOC 5L46A 4BLAA 5C4XC 4Q5SA 2B63C 3HOZC 3L4JA 1IL2A 3BP3A 3T01A 2W7VA 4QIWD 4A93K 3CQZK 3GTQC 1WCMK 1TWAC 1R9TA 3QX3A 1B4AA 4G0WA 1F7UA 4A3CK 1VLOA 4A3JK 3S16C 2GSUA 1SFOK 4WILA 4A3LK 1WOSA 3GTMA 3AD8C 3VA7A 4Y52C 4C3JK 2WB1D 1TWCA 2PA8D 3H3VD 3GEHA 1INNA 4G7HA 3HOYK 1DD5A 2E2JC 4XLNA 5JVOA 4KC6A 1YNNA 1EQRA 4QIWL 2JA8K 3PO3C 4C3IC 3CQZA 1WOOA 2NVTC 3FOEA 4P9SA 2FQOA 2P8TA 5C44C 1SFOA 4QJVB 5IYCC 4XLPA 2PA8L 2YU9K 4KASA 2JA6C 3HOVC 2PMZL 4C2MC 1I50K 4A3IK 1HI9A 2A6HA 5FLMK 5C3EC 1F7VA 3K7AK 4GTCA 2R93C 3RZOK 2WAQL 5C4XK 1XZPA 3TFHA 4KDDA 2B63K 3HOZK 2E2HA 4KB2A 4A3BC 4X6AC 1L0WA 4A3MC 3FKIC 1DCPA 2XCOA 2RGRA 3GTQK 4KMDA 3HKZD 1TWAK 4C45A 1ZYRA 2YU9A 1XXCA 5C4JC 3S16K 1I50A 3HOXK 1I6HC 4Y52K 2GSOA 3HXAA 1XXBA 1K83C 1Y1VC 1WCMC 4YFXA 4BY1C 1JQWA 1UV7A 1V5VA 2XCQA 2E2JK 2P5MA 2B63A 2ZFZA 2BE5A 3PO3K 4BKWA 2NVYC 4C3IK 4DDQA 1Y1WC 3GTQA 4LLGA 2NVTK 2D6FC 1O29A 2Y3PA 1WIHA 4GTFA 1F9NA 5C44K 2R92C 5IYCK 3S1QC 2JA6K 1PJ7A 3HOVK 4C2MK 3LAPA 4FZBA 3BUEA 4LJZA 4AYBL 4YFKA 1YX2A 5D4DA 5IP9C 3GTLC 2PPBA 5C3EK 3LAJA 3T00A 1IW7A 3TFIA 2R93K 1J6WA 3AD7C 4Y7NC 4GTDA 4G7OA 1BS2A 4X6AK 3FKIK 1WOPA 2EBBA 3H0GC 3V4GA 1YNJA 3EQLA 5TMCA 1J6VA 5C4JK 2JA6A 4P5AA 1JVIA 3HOUC 1I6HK 3AQPA 4PAAA 1K83K 1Y1VK 4BY1K 3S1NC 1B4BA 4ILDA 2R93A 5IORA 5EGEA 5TMFA 4OINA 3HOXC 5IP7K 1XZQA 3GTGK 3S1RC 3A8JA 3FKIA 2VUMC 4J3NA 4KMHA 4BLBA 2PMZD 2NVYK 1Y1WK 3L4KA 3HOWC 3SZYA 5TJ3A 2R92K 4RMFA 1BDFA 4GZYA 3S1QK 4MEXA 1O25A 1TWFK 2WAQD 4KMAA 1K83A 1Y1VA 1WCMA 3JSTA 4WJ4A 1IBAA 3GTJC 5FJ8K 5IP9K 5EGHA 3GTLK 5JFEA 4A3FC 2ZUFA 4LR2A 3I4MC 3CAGA 3ERED 4Y7NK 2NVYA 3N0CA 1Y1WA 4PABA 2JA7C 1I3QC 4O2DA 2NVQC 3H0GK 3MMLB 4KARA 2R92A 4A3EC 3DXJA 5CHPA 1HQMA 3HOUK 3GTLA 1EFWA 3GTOC 3GDZA 1TWGC 4ZH4A
chains in the Genus database with same CATH topology
3HXAA 4WILA 1USMA 1RU0A 1DCHA 1F93A 2V6SA 1DCOA 2V6TA 2EBBA 1USOA 3JSTA 4C45A 2V6UA 1DCPA 4LOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXA A;  4WIL A;  1USM A;  1RU0 A;  1DCH A;  1F93 A;  2V6S A;  1DCO A;  2V6T A;  2EBB A;  1USO A;  3JST A;  4C45 A;  2V6U A;  1DCP A;  4LOW A; 
#chains in the Genus database with same CATH topology
 1YCL A;  3S1N K;  5IYD C;  5IOQ A;  4A3G C;  3S0X A;  3M3Y C;  3S1R K;  1KQ4 A;  3WOD A;  2VUM K;  3H0G A;  4AYB D;  3OEP A;  3HOW K;  2A69 A;  4BBR C;  5IP7 C;  3GTG C;  1XZP B;  1C0A A;  2FQT A;  2V6U A;  3S2H C;  1TWA A;  5M5W K;  1WOR A;  3GTJ K;  1O28 A;  4LOW A;  1WQH A;  4A3F K;  1TWF C;  2E2I C;  2V6S A;  4AH6 A;  5CJ9 A;  2V6T A;  3I4M K;  1USO A;  5M3F K;  2VUM A;  4OIP A;  2O5J A;  1X31 C;  2JA7 K;  1O2A A;  1I3Q K;  1WSR A;  3TTG A;  2NVQ K;  2Y0S D;  1IQ0 A;  5M5Y K;  4GTL A;  1USM A;  4XSZ A;  1J98 A;  3A8K A;  4A3E K;  4GTB A;  4XCH A;  1ZXO A;  3TFJ A;  5M5X K;  3SZZ A;  1O2B A;  4YG2 A;  3IPJ A;  4KM8 A;  1PJ6 A;  3AQO A;  3GTJ A;  2E2H C;  3GTO K;  1BJT A;  2GAH C;  1TWG K;  2KWA A;  2GAG C;  4KAW X;  5IYD K;  5IOT A;  4A3G K;  1O27 A;  3A8I A;  3M4O C;  3GTK C;  3M3Y K;  2O5I A;  4KM9 A;  3G4A A;  2JA7 A;  2Y0S L;  1I3Q A;  3GEE A;  1WSV A;  1WQG A;  3S2D C;  4LK1 A;  3S1M C;  1XXA A;  4BY7 C;  2PHC B;  4BBR K;  1O2F B;  1F93 A;  3PO2 C;  3S15 C;  3AD9 C;  2NVX C;  2JA5 C;  3GTO A;  3S2H K;  4A3K C;  1TWG A;  1BGW A;  3GTP C;  3LPX A;  4KAT A;  4KN4 A;  1VJE A;  4JK1 A;  4QJV A;  2E2I K;  1O26 A;  1PJ5 A;  1TWH C;  4A3D C;  4C3H C;  3N3Y A;  3GTG A;  3NUH A;  3RZD C;  3I4N C;  4NOI A;  1XZQ B;  3Q3Q A;  2R7Z C;  3FOF A;  5IYB C;  4LQY A;  4GTE A;  4G0V A;  2ZUE A;  2E2H K;  1XPP A;  4GT9 A;  4BBS C;  3GSI A;  1TWF A;  1EK8 A;  3G4C A;  2E2I A;  2A6E A;  3S14 C;  2JH3 A;  2WB1 L;  1ZVU A;  4MEY A;  4G7Z A;  3GTK K;  3M4O K;  3H3V L;  4KB4 A;  1J6X A;  3S17 C;  4OIR A;  3GIR A;  3S2D K;  4XSX A;  3S1M K;  2GSN A;  1R9T C;  4BY7 K;  5HL8 A;  4OIQ A;  4BXX C;  3FHZ A;  1JOE A;  4YFN A;  3PO2 K;  3S15 K;  1AB4 A;  2NVX K;  4LK0 A;  3GTM C;  2JA5 K;  1TWC C;  4OIO A;  4A3K K;  3GTP K;  4Q4Z A;  4P5B A;  3GTK A;  1O24 A;  1SMY A;  3T02 A;  4M1X A;  4G0U A;  1EI6 A;  4KN7 A;  4KMU A;  2CFA A;  1TWH K;  4A3D K;  4A93 C;  3CQZ C;  4C3H K;  4A3C C;  4A3J C;  1SFO C;  4MQ9 A;  3RZD K;  3I4N K;  2NVX A;  4A3L C;  1DCH A;  2RH6 A;  2JA5 A;  2R7Z K;  4C3J C;  5IYB K;  5E68 A;  3GEI A;  3HKZ L;  1ISE A;  3GTP A;  3ORE A;  4GFQ A;  1RU0 A;  3HOY C;  1VGX A;  4BBS K;  2CW0 A;  1ZQ1 C;  3S14 K;  3N0B A;  5IOS A;  2JA8 C;  3BP8 C;  1TWH A;  5M3M K;  2CFA B;  3OPF A;  4FM9 A;  3S17 K;  1G51 A;  4GTA A;  1VRQ C;  1IE0 A;  1VH2 A;  2A68 A;  1R9T K;  2YU9 C;  4BXX K;  2R7Z A;  3ADA C;  1IS1 A;  1I50 C;  1ZBS A;  3AH5 A;  4A3I C;  3GTM K;  1DCO A;  1I6V A;  4A3B K;  1GE9 A;  1TWC K;  4WJ3 M;  5FLM C;  4A3M K;  1WQF A;  3K7A C;  2XCR B;  1EH1 A;  3RZO C;  5L46 A;  4BLA A;  5C4X C;  4Q5S A;  2B63 C;  3HOZ C;  3L4J A;  1IL2 A;  3BP3 A;  3T01 A;  2W7V A;  4QIW D;  4A93 K;  3CQZ K;  3GTQ C;  1WCM K;  1TWA C;  1R9T A;  3QX3 A;  1B4A A;  4G0W A;  1F7U A;  4A3C K;  1VLO A;  4A3J K;  3S16 C;  2GSU A;  1SFO K;  4WIL A;  4A3L K;  1WOS A;  3GTM A;  3AD8 C;  3VA7 A;  4Y52 C;  4C3J K;  2WB1 D;  1TWC A;  2PA8 D;  3H3V D;  3GEH A;  1INN A;  4G7H A;  3HOY K;  1DD5 A;  2E2J C;  4XLN A;  5JVO A;  4KC6 A;  1YNN A;  1EQR A;  4QIW L;  2JA8 K;  3PO3 C;  4C3I C;  3CQZ A;  1WOO A;  2NVT C;  3FOE A;  4P9S A;  2FQO A;  2P8T A;  5C44 C;  1SFO A;  4QJV B;  5IYC C;  4XLP A;  2PA8 L;  2YU9 K;  4KAS A;  2JA6 C;  3HOV C;  2PMZ L;  4C2M C;  1I50 K;  4A3I K;  1HI9 A;  2A6H A;  5FLM K;  5C3E C;  1F7V A;  3K7A K;  4GTC A;  2R93 C;  3RZO K;  2WAQ L;  5C4X K;  1XZP A;  3TFH A;  4KDD A;  2B63 K;  3HOZ K;  2E2H A;  4KB2 A;  4A3B C;  4X6A C;  1L0W A;  4A3M C;  3FKI C;  1DCP A;  2XCO A;  2RGR A;  3GTQ K;  4KMD A;  3HKZ D;  1TWA K;  4C45 A;  1ZYR A;  2YU9 A;  1XXC A;  5C4J C;  3S16 K;  1I50 A;  3HOX K;  1I6H C;  4Y52 K;  2GSO A;  3HXA A;  1XXB A;  1K83 C;  1Y1V C;  1WCM C;  4YFX A;  4BY1 C;  1JQW A;  1UV7 A;  1V5V A;  2XCQ A;  2E2J K;  2P5M A;  2B63 A;  2ZFZ A;  2BE5 A;  3PO3 K;  4BKW A;  2NVY C;  4C3I K;  4DDQ A;  1Y1W C;  3GTQ A;  4LLG A;  2NVT K;  2D6F C;  1O29 A;  2Y3P A;  1WIH A;  4GTF A;  1F9N A;  5C44 K;  2R92 C;  5IYC K;  3S1Q C;  2JA6 K;  1PJ7 A;  3HOV K;  4C2M K;  3LAP A;  4FZB A;  3BUE A;  4LJZ A;  4AYB L;  4YFK A;  1YX2 A;  5D4D A;  5IP9 C;  3GTL C;  2PPB A;  5C3E K;  3LAJ A;  3T00 A;  1IW7 A;  3TFI A;  2R93 K;  1J6W A;  3AD7 C;  4Y7N C;  4GTD A;  4G7O A;  1BS2 A;  4X6A K;  3FKI K;  1WOP A;  2EBB A;  3H0G C;  3V4G A;  1YNJ A;  3EQL A;  5TMC A;  1J6V A;  5C4J K;  2JA6 A;  4P5A A;  1JVI A;  3HOU C;  1I6H K;  3AQP A;  4PAA A;  1K83 K;  1Y1V K;  4BY1 K;  3S1N C;  1B4B A;  4ILD A;  2R93 A;  5IOR A;  5EGE A;  5TMF A;  4OIN A;  3HOX C;  5IP7 K;  1XZQ A;  3GTG K;  3S1R C;  3A8J A;  3FKI A;  2VUM C;  4J3N A;  4KMH A;  4BLB A;  2PMZ D;  2NVY K;  1Y1W K;  3L4K A;  3HOW C;  3SZY A;  5TJ3 A;  2R92 K;  4RMF A;  1BDF A;  4GZY A;  3S1Q K;  4MEX A;  1O25 A;  1TWF K;  2WAQ D;  4KMA A;  1K83 A;  1Y1V A;  1WCM A;  3JST A;  4WJ4 A;  1IBA A;  3GTJ C;  5FJ8 K;  5IP9 K;  5EGH A;  3GTL K;  5JFE A;  4A3F C;  2ZUF A;  4LR2 A;  3I4M C;  3CAG A;  3ERE D;  4Y7N K;  2NVY A;  3N0C A;  1Y1W A;  4PAB A;  2JA7 C;  1I3Q C;  4O2D A;  2NVQ C;  3H0G K;  3MML B;  4KAR A;  2R92 A;  4A3E C;  3DXJ A;  5CHP A;  1HQM A;  3HOU K;  3GTL A;  1EFW A;  3GTO C;  3GDZ A;  1TWG C;  4ZH4 A; 
#chains in the Genus database with same CATH homology
 3HXA A;  4WIL A;  1USM A;  1RU0 A;  1DCH A;  1F93 A;  2V6S A;  1DCO A;  2V6T A;  2EBB A;  1USO A;  3JST A;  4C45 A;  2V6U A;  1DCP A;  4LOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...