4LOWA

Structure and identification of a pterin dehydratase-like protein as a rubisco assembly factor in the alpha-carboxysome
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
87
structure length
84
Chain Sequence
b'HHHHHHSWREQGKPPMLFKRFAFGSYAQTRAFLDALAALSEETGQHPQNINFGTTYVNITLDAATLGEAERAFAARVDALAGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acRAF
publication title Structure and Identification of a Pterin Dehydratase-like Protein as a Ribulose-bisphosphate Carboxylase/Oxygenase (RuBisCO) Assembly Factor in the alpha-Carboxysome.
pubmed doi rcsb
source organism Thiomonas intermedia
molecule tags Unknown function
total genus 26
structure length 84
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4lowA00
1DCOA 1DCPA 1F93A 3JSTA 1USOA 2EBBA 4WILA 4LOWA 1RU0A 4C45A 2V6UA 1DCHA 2V6TA 2V6SA 3HXAA 1USMA
chains in the Genus database with same CATH superfamily
4XSXA 4P5BA 4MEXA 2JA6A 2EBBA 4GTBA 3GTQC 4A93C 1INNA 4YFXA 3S0XA 3AD8C 3S15K 1GE9A 5L46A 3PO2K 2GSUA 3HKZL 4NOIA 1YNNA 3L4JA 2NVXK 4G0WA 3S15C 4XCHA 5IORA 3GTLA 1I50K 3FKIA 1VGXA 1B4AA 4QJVB 5EGEA 4OIQA 2VUMK 1DCPA 1XZQB 4JK1A 4YG2A 4BBRK 1Y1WC 4C2MK 2VUMC 1WOPA 4KB2A 1TWFA 4KM8A 4C3HK 2PA8L 3G4CA 1TWHC 5TMFA 1J6XA 3LPXA 4LK0A 3S2DC 5M3FK 3BP3A 3TFHA 1WCMC 4C3HC 3S2HK 5IYDK 1O2BA 3S17K 1G51A 1ZYRA 3GDZA 1ZVUA 1VRQC 4FZBA 3S17C 5IOTA 1L0WA 1XXCA 1O27A 4PABA 1XXBA 2R7ZK 3BP8C 2O5JA 4MQ9A 3GTQA 4KMHA 4A3IK 1R9TC 4A3EK 5CJ9A 4GTEA 4A3JC 3NUHA 3BUEA 2GAHC 2CFAA 2PMZD 1WSVA 4A3EC 2P5MA 5D4DA 1WQGA 4KM9A 1ZQ1C 3A8KA 4LOWA 5C44K 4G7HA 2A69A 4LQYA 2NVXA 2V6TA 4KARA 1O24A 1EH1A 5EGHA 2JA6C 1I50A 3TFIA 4C3JC 4FM9A 5CHPA 3A8IA 4OINA 1Y1WA 5IP9K 2VUMA 1WQFA 4WJ3M 5IYCK 4A3KK 3H3VL 1TWHA 1EK8A 4YFNA 3FKIC 1WCMA 3I4MK 4A3KC 3HOZK 1YX2A 1O26A 3I4MC 4A3FK 3HOZC 5IYBC 1IQ0A 3HOVK 2PPBA 3GTJK 2WB1D 4GTDA 3FHZA 2P8TA 1YCLA 4Q4ZA 4A3FC 1ISEA 3HOVC 3RZOK 3PO3K 3GTJC 4KB4A 2R7ZA 1I3QC 2E2HK 4KMAA 1WSRA 1JVIA 1BDFA 3PO3C 3AQPA 3LAPA 3GTKC 3S1QK 1RU0A 4WJ4A 3S1NK 4Y52K 4BXXC 3S1QC 3K7AK 4LLGA 2O5IA 3S1NC 4Y52C 1SFOK 4KC6A 3S14K 4O2DA 2WAQL 4BY1K 1VH2A 1SFOC 3TTGA 3S14C 1TWGK 3ADAC 2XCOA 3PO2C 2CFAB 4BY1C 3M4OK 3VA7A 2NVXC 2BE5A 1XPPA 3RZDK 2NVTK 3HOXK 1I50C 1IW7A 4GTFA 3GIRA 1IBAA 1TWAK 3RZDC 2NVTC 1BS2A 3HOXC 3S16K 1HI9A 3EQLA 2Y3PA 4A3LK 4BBRC 2R92K 4C2MC 3GTJA 2CW0A 5FJ8K 1I3QA 4A3LC 5E68A 1XZPA 3CQZK 3GTMK 1UV7A 3OEPA 1PJ7A 3GTKA 2E2HA 4GFQA 3GTGK 3S2HC 5IYDC 3GTMC 1KQ4A 4BY7K 1WOSA 5HL8A 3GTGC 4G7OA 2JH3A 3ERED 2B63K 3GTOK 4BY7C 3AD9C 2R7ZC 3HKZD 1X31C 3H0GK 3MMLB 4A3IC 1SFOA 4XLPA 1TWCK 2B63C 4A3CK 1V5VA 3Q3QA 4QIWL 1WIHA 3H0GC 1SMYA 3OPFA 1TWCC 5TMCA 4MEYA 5C44C 5C4JK 3T01A 5IP7K 3HOUK 4A3MK 3G4AA 3DXJA 2XCRB 4BLBA 5C4JC 4P5AA 4QJVA 2RGRA 2Y0SD 4AYBL 3HOUC 1WORA 2PA8D 4A3MC 1XZQA 2V6SA 5IP9C 4A3GK 4AH6A 4OIPA 3N0BA 1O29A 3TFJA 4ZH4A 5IYCC 2R92A 3HXAA 3GSIA 4Y7NK 3SZYA 1K83K 1F93A 1Y1VK 1USOA 1J6VA 3OREA 3GTMA 4BLAA 3GTPK 4GZYA 3N0CA 4M1XA 3T00A 1K83C 3IPJA 1Y1VC 4RMFA 3GTGA 4A3BK 2E2IK 4G0VA 2FQOA 3GTPC 2R93K 5C4XK 3M3YK 1EFWA 4ILDA 4KN7A 3S1RK 4LK1A 2E2IC 1B4BA 4KATA 3RZOC 2R93C 5C4XC 3M3YC 2B63A 2E2HC 3GEHA 4X6AK 1DD5A 3H0GA 3V4GA 4BBSK 5IOSA 3A8JA 1TWCA 1O2AA 1VJEA 1IS1A 4BBSC 4BKWA 3AQOA 3K7AC 2E2JK 4C3IK 3JSTA 2YU9K 4Q5SA 4OIOA 2GSNA 3H3VD 4PAAA 3WODA 3HOWK 2E2JC 4A93K 3FOEA 4KASA 4G0UA 2KWAA 2A6HA 2YU9C 1TWGC 3HOWC 4C45A 2GAGC 3M4OC 4KMDA 2JA7K 4OIRA 1O25A 1XXAA 5FLMK 4DDQA 4LJZA 2PMZL 1K83A 2ZFZA 1Y1VA 2JA7C 3GEIA 5M5YK 5FLMC 5C3EK 1TWAC 2PHCB 3GTPA 3S16C 2A6EA 5C3EC 1EI6A 2E2IA 2XCQA 2NVYK 4GTCA 1Y1WK 2R92C 4P9SA 1WQHA 2R93A 4XLNA 2NVYC 3CQZC 3T02A 1TWHK 1EQRA 4G7ZA 3S2DK 2JA8K 2Y0SL 1I6HK 1WCMK 1F9NA 2ZUEA 4YFKA 1F7VA 2W7VA 2JA8C 1IE0A 1ZBSA 1I6HC 2WAQD 1JQWA 4KDDA 3GTOC 1C0AA 4GTAA 3SZZA 1WOOA 1BGWA 4XSZA 2YU9A 1R9TK 4GTLA 1I6VA 4A3JK 4A3CC 1TWGA 1YNJA 2WB1L 2GSOA 3I4NK 1BJTA 1PJ6A 2JA5K 3QX3A 5TJ3A 5M3MK 5IOQA 2JA7A 3HOYK 4WILA 3I4NC 1TWAA 5IP7C 1J6WA 1DCHA 2JA5C 2JA6K 2D6FC 3N3YA 2ZUFA 4C3JK 3HOYC 4A3GC 1IL2A 1O2FB 2FQTA 2NVYA 3CQZA 3LAJA 1DCOA 3L4KA 4Y7NC 3GTLK 2A68A 3FKIK 5JVOA 5M5WK 5JFEA 3AH5A 3GTLC 3CAGA 2V6UA 4J3NA 4A3BC 5IYBK 1J98A 4LR2A 1VLOA 2RH6A 3GTOA 2NVQK 1TWFK 3S1RC 4KMUA 4QIWD 1ZXOA 1F7UA 1XZPB 1USMA 2NVQC 1TWFC 1JOEA 1O28A 1I3QK 4X6AC 3FOFA 1R9TA 4A3DK 3GTKK 3AD7C 4GT9A 3S1MK 4KN4A 1HQMA 4AYBD 4BXXK 4A3DC 2JA5A 4KAWX 1AB4A 5M5XK 3GTQK 4C3IC 3S1MC 1PJ5A 3GEEA
chains in the Genus database with same CATH topology
1DCOA 1DCPA 1F93A 3JSTA 1USOA 2EBBA 4WILA 4LOWA 1RU0A 4C45A 2V6UA 1DCHA 2V6TA 2V6SA 3HXAA 1USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCO A;  1DCP A;  1F93 A;  3JST A;  1USO A;  2EBB A;  4WIL A;  4LOW A;  1RU0 A;  4C45 A;  2V6U A;  1DCH A;  2V6T A;  2V6S A;  3HXA A;  1USM A; 
#chains in the Genus database with same CATH topology
 4XSX A;  4P5B A;  4MEX A;  2JA6 A;  2EBB A;  4GTB A;  3GTQ C;  4A93 C;  1INN A;  4YFX A;  3S0X A;  3AD8 C;  3S15 K;  1GE9 A;  5L46 A;  3PO2 K;  2GSU A;  3HKZ L;  4NOI A;  1YNN A;  3L4J A;  2NVX K;  4G0W A;  3S15 C;  4XCH A;  5IOR A;  3GTL A;  1I50 K;  3FKI A;  1VGX A;  1B4A A;  4QJV B;  5EGE A;  4OIQ A;  2VUM K;  1DCP A;  1XZQ B;  4JK1 A;  4YG2 A;  4BBR K;  1Y1W C;  4C2M K;  2VUM C;  1WOP A;  4KB2 A;  1TWF A;  4KM8 A;  4C3H K;  2PA8 L;  3G4C A;  1TWH C;  5TMF A;  1J6X A;  3LPX A;  4LK0 A;  3S2D C;  5M3F K;  3BP3 A;  3TFH A;  1WCM C;  4C3H C;  3S2H K;  5IYD K;  1O2B A;  3S17 K;  1G51 A;  1ZYR A;  3GDZ A;  1ZVU A;  1VRQ C;  4FZB A;  3S17 C;  5IOT A;  1L0W A;  1XXC A;  1O27 A;  4PAB A;  1XXB A;  2R7Z K;  3BP8 C;  2O5J A;  4MQ9 A;  3GTQ A;  4KMH A;  4A3I K;  1R9T C;  4A3E K;  5CJ9 A;  4GTE A;  4A3J C;  3NUH A;  3BUE A;  2GAH C;  2CFA A;  2PMZ D;  1WSV A;  4A3E C;  2P5M A;  5D4D A;  1WQG A;  4KM9 A;  1ZQ1 C;  3A8K A;  4LOW A;  5C44 K;  4G7H A;  2A69 A;  4LQY A;  2NVX A;  2V6T A;  4KAR A;  1O24 A;  1EH1 A;  5EGH A;  2JA6 C;  1I50 A;  3TFI A;  4C3J C;  4FM9 A;  5CHP A;  3A8I A;  4OIN A;  1Y1W A;  5IP9 K;  2VUM A;  1WQF A;  4WJ3 M;  5IYC K;  4A3K K;  3H3V L;  1TWH A;  1EK8 A;  4YFN A;  3FKI C;  1WCM A;  3I4M K;  4A3K C;  3HOZ K;  1YX2 A;  1O26 A;  3I4M C;  4A3F K;  3HOZ C;  5IYB C;  1IQ0 A;  3HOV K;  2PPB A;  3GTJ K;  2WB1 D;  4GTD A;  3FHZ A;  2P8T A;  1YCL A;  4Q4Z A;  4A3F C;  1ISE A;  3HOV C;  3RZO K;  3PO3 K;  3GTJ C;  4KB4 A;  2R7Z A;  1I3Q C;  2E2H K;  4KMA A;  1WSR A;  1JVI A;  1BDF A;  3PO3 C;  3AQP A;  3LAP A;  3GTK C;  3S1Q K;  1RU0 A;  4WJ4 A;  3S1N K;  4Y52 K;  4BXX C;  3S1Q C;  3K7A K;  4LLG A;  2O5I A;  3S1N C;  4Y52 C;  1SFO K;  4KC6 A;  3S14 K;  4O2D A;  2WAQ L;  4BY1 K;  1VH2 A;  1SFO C;  3TTG A;  3S14 C;  1TWG K;  3ADA C;  2XCO A;  3PO2 C;  2CFA B;  4BY1 C;  3M4O K;  3VA7 A;  2NVX C;  2BE5 A;  1XPP A;  3RZD K;  2NVT K;  3HOX K;  1I50 C;  1IW7 A;  4GTF A;  3GIR A;  1IBA A;  1TWA K;  3RZD C;  2NVT C;  1BS2 A;  3HOX C;  3S16 K;  1HI9 A;  3EQL A;  2Y3P A;  4A3L K;  4BBR C;  2R92 K;  4C2M C;  3GTJ A;  2CW0 A;  5FJ8 K;  1I3Q A;  4A3L C;  5E68 A;  1XZP A;  3CQZ K;  3GTM K;  1UV7 A;  3OEP A;  1PJ7 A;  3GTK A;  2E2H A;  4GFQ A;  3GTG K;  3S2H C;  5IYD C;  3GTM C;  1KQ4 A;  4BY7 K;  1WOS A;  5HL8 A;  3GTG C;  4G7O A;  2JH3 A;  3ERE D;  2B63 K;  3GTO K;  4BY7 C;  3AD9 C;  2R7Z C;  3HKZ D;  1X31 C;  3H0G K;  3MML B;  4A3I C;  1SFO A;  4XLP A;  1TWC K;  2B63 C;  4A3C K;  1V5V A;  3Q3Q A;  4QIW L;  1WIH A;  3H0G C;  1SMY A;  3OPF A;  1TWC C;  5TMC A;  4MEY A;  5C44 C;  5C4J K;  3T01 A;  5IP7 K;  3HOU K;  4A3M K;  3G4A A;  3DXJ A;  2XCR B;  4BLB A;  5C4J C;  4P5A A;  4QJV A;  2RGR A;  2Y0S D;  4AYB L;  3HOU C;  1WOR A;  2PA8 D;  4A3M C;  1XZQ A;  2V6S A;  5IP9 C;  4A3G K;  4AH6 A;  4OIP A;  3N0B A;  1O29 A;  3TFJ A;  4ZH4 A;  5IYC C;  2R92 A;  3HXA A;  3GSI A;  4Y7N K;  3SZY A;  1K83 K;  1F93 A;  1Y1V K;  1USO A;  1J6V A;  3ORE A;  3GTM A;  4BLA A;  3GTP K;  4GZY A;  3N0C A;  4M1X A;  3T00 A;  1K83 C;  3IPJ A;  1Y1V C;  4RMF A;  3GTG A;  4A3B K;  2E2I K;  4G0V A;  2FQO A;  3GTP C;  2R93 K;  5C4X K;  3M3Y K;  1EFW A;  4ILD A;  4KN7 A;  3S1R K;  4LK1 A;  2E2I C;  1B4B A;  4KAT A;  3RZO C;  2R93 C;  5C4X C;  3M3Y C;  2B63 A;  2E2H C;  3GEH A;  4X6A K;  1DD5 A;  3H0G A;  3V4G A;  4BBS K;  5IOS A;  3A8J A;  1TWC A;  1O2A A;  1VJE A;  1IS1 A;  4BBS C;  4BKW A;  3AQO A;  3K7A C;  2E2J K;  4C3I K;  3JST A;  2YU9 K;  4Q5S A;  4OIO A;  2GSN A;  3H3V D;  4PAA A;  3WOD A;  3HOW K;  2E2J C;  4A93 K;  3FOE A;  4KAS A;  4G0U A;  2KWA A;  2A6H A;  2YU9 C;  1TWG C;  3HOW C;  4C45 A;  2GAG C;  3M4O C;  4KMD A;  2JA7 K;  4OIR A;  1O25 A;  1XXA A;  5FLM K;  4DDQ A;  4LJZ A;  2PMZ L;  1K83 A;  2ZFZ A;  1Y1V A;  2JA7 C;  3GEI A;  5M5Y K;  5FLM C;  5C3E K;  1TWA C;  2PHC B;  3GTP A;  3S16 C;  2A6E A;  5C3E C;  1EI6 A;  2E2I A;  2XCQ A;  2NVY K;  4GTC A;  1Y1W K;  2R92 C;  4P9S A;  1WQH A;  2R93 A;  4XLN A;  2NVY C;  3CQZ C;  3T02 A;  1TWH K;  1EQR A;  4G7Z A;  3S2D K;  2JA8 K;  2Y0S L;  1I6H K;  1WCM K;  1F9N A;  2ZUE A;  4YFK A;  1F7V A;  2W7V A;  2JA8 C;  1IE0 A;  1ZBS A;  1I6H C;  2WAQ D;  1JQW A;  4KDD A;  3GTO C;  1C0A A;  4GTA A;  3SZZ A;  1WOO A;  1BGW A;  4XSZ A;  2YU9 A;  1R9T K;  4GTL A;  1I6V A;  4A3J K;  4A3C C;  1TWG A;  1YNJ A;  2WB1 L;  2GSO A;  3I4N K;  1BJT A;  1PJ6 A;  2JA5 K;  3QX3 A;  5TJ3 A;  5M3M K;  5IOQ A;  2JA7 A;  3HOY K;  4WIL A;  3I4N C;  1TWA A;  5IP7 C;  1J6W A;  1DCH A;  2JA5 C;  2JA6 K;  2D6F C;  3N3Y A;  2ZUF A;  4C3J K;  3HOY C;  4A3G C;  1IL2 A;  1O2F B;  2FQT A;  2NVY A;  3CQZ A;  3LAJ A;  1DCO A;  3L4K A;  4Y7N C;  3GTL K;  2A68 A;  3FKI K;  5JVO A;  5M5W K;  5JFE A;  3AH5 A;  3GTL C;  3CAG A;  2V6U A;  4J3N A;  4A3B C;  5IYB K;  1J98 A;  4LR2 A;  1VLO A;  2RH6 A;  3GTO A;  2NVQ K;  1TWF K;  3S1R C;  4KMU A;  4QIW D;  1ZXO A;  1F7U A;  1XZP B;  1USM A;  2NVQ C;  1TWF C;  1JOE A;  1O28 A;  1I3Q K;  4X6A C;  3FOF A;  1R9T A;  4A3D K;  3GTK K;  3AD7 C;  4GT9 A;  3S1M K;  4KN4 A;  1HQM A;  4AYB D;  4BXX K;  4A3D C;  2JA5 A;  4KAW X;  1AB4 A;  5M5X K;  3GTQ K;  4C3I C;  3S1M C;  1PJ5 A;  3GEE A; 
#chains in the Genus database with same CATH homology
 1DCO A;  1DCP A;  1F93 A;  3JST A;  1USO A;  2EBB A;  4WIL A;  4LOW A;  1RU0 A;  4C45 A;  2V6U A;  1DCH A;  2V6T A;  2V6S A;  3HXA A;  1USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...